Citrus Sinensis ID: 047010


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQP
cccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEEcHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccc
cccccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHcccc
cycnkndfFEARKVIDYMfdngyhpnvtTYTILEAYEMLMNVkndglkpdvyTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHnvidighiprtitFNNVIQALCGVGKIDKALLLLFLMYEhgkipsrtLYDTLIKKLDQQP
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQP
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQP
*YCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIK******
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQP
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQP
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTILEAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLIKKLDQQP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
Q9LUR2 507 Putative pentatricopeptid yes no 0.947 0.285 0.300 7e-17
Q9FIX3 747 Pentatricopeptide repeat- no no 0.993 0.203 0.294 2e-16
Q3EDF8 598 Pentatricopeptide repeat- no no 0.947 0.242 0.304 3e-16
Q9T0D6 566 Pentatricopeptide repeat- no no 0.941 0.254 0.319 4e-16
Q3ECK2 548 Pentatricopeptide repeat- no no 0.947 0.264 0.254 9e-15
Q9SZ52 1112 Pentatricopeptide repeat- no no 0.960 0.132 0.302 1e-14
Q940A6 838 Pentatricopeptide repeat- no no 0.843 0.153 0.310 1e-14
Q6NQ83619 Pentatricopeptide repeat- no no 0.967 0.239 0.272 1e-14
Q9M9X9 987 Pentatricopeptide repeat- no no 0.928 0.143 0.288 2e-14
Q9FMF6 730 Pentatricopeptide repeat- no no 0.895 0.187 0.337 2e-14
>sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 Back     alignment and function desciption
 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 84/173 (48%), Gaps = 28/173 (16%)

Query: 2   YCNKNDFFEARKVIDYMFDNGYHPNVTTYTIL-----------EAYEMLMNVKNDGLKPD 50
           YC+ N   +A  + D +   G+ PNV TYT L            A E+   +  +G +P+
Sbjct: 163 YCHWNRIEDAIALFDQILGMGFKPNVVTYTTLIRCLCKNRHLNHAVELFNQMGTNGSRPN 222

Query: 51  VYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLI----------------HLHN 94
           V TY A++ G C++GR  +   LL + ++R + PNV+T                   L+N
Sbjct: 223 VVTYNALVTGLCEIGRWGDAAWLLRDMMKRRIEPNVITFTALIDAFVKVGKLMEAKELYN 282

Query: 95  V-IDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHGKIPSRTLYDTLI 146
           V I +   P   T+ ++I  LC  G +D+A  + +LM  +G  P+  +Y TLI
Sbjct: 283 VMIQMSVYPDVFTYGSLINGLCMYGLLDEARQMFYLMERNGCYPNEVIYTTLI 335





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 Back     alignment and function description
>sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 Back     alignment and function description
>sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 Back     alignment and function description
>sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
224140601 535 predicted protein [Populus trichocarpa] 0.856 0.244 0.333 7e-21
255575578 271 pentatricopeptide repeat-containing prot 0.562 0.317 0.378 4e-18
297830278 504 hypothetical protein ARALYDRAFT_479138 [ 0.947 0.287 0.289 2e-16
449463386 830 PREDICTED: pentatricopeptide repeat-cont 0.954 0.175 0.304 4e-16
449508067 830 PREDICTED: pentatricopeptide repeat-cont 0.954 0.175 0.304 4e-16
302808965 609 hypothetical protein SELMODRAFT_182249 [ 0.967 0.243 0.316 4e-16
302806475 471 hypothetical protein SELMODRAFT_20977 [S 0.967 0.314 0.316 6e-16
297741319 851 unnamed protein product [Vitis vinifera] 0.967 0.173 0.312 8e-16
302780485 1116 hypothetical protein SELMODRAFT_96794 [S 0.843 0.115 0.347 2e-15
359475386 762 PREDICTED: pentatricopeptide repeat-cont 0.967 0.194 0.312 2e-15
>gi|224140601|ref|XP_002323670.1| predicted protein [Populus trichocarpa] gi|222868300|gb|EEF05431.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 90/195 (46%), Gaps = 64/195 (32%)

Query: 1   CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTIL--------------------------- 33
           C+C K D  EA++V+D M   G++PNV T TIL                           
Sbjct: 185 CHCKKKDPGEAKRVLDQMMQKGFNPNVATLTILINSFCKMGQLQNTFQVFEVMDRIGCKP 244

Query: 34  -------------------EAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVMELL 74
                              EA+E++ ++K   ++PD+YTYTA+MDGFCKVGRS+E MELL
Sbjct: 245 NIQTYNCLLKGMCYVGRIDEAFELMEDIKKTTVEPDIYTYTAMMDGFCKVGRSDEAMELL 304

Query: 75  NEAIERGVTPNVVTLIHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEHG 134
           NEA+E G+ PNVV                  TFN ++      G+  K   +L LM +  
Sbjct: 305 NEAMEMGLAPNVV------------------TFNTLLDGYAKEGRPLKGFGVLKLMKQRK 346

Query: 135 KIPSRTLYDTLIKKL 149
            +P    Y TL+  L
Sbjct: 347 CMPDYISYSTLLHGL 361




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255575578|ref|XP_002528689.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531861|gb|EEF33678.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297830278|ref|XP_002883021.1| hypothetical protein ARALYDRAFT_479138 [Arabidopsis lyrata subsp. lyrata] gi|297328861|gb|EFH59280.1| hypothetical protein ARALYDRAFT_479138 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449463386|ref|XP_004149415.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449508067|ref|XP_004163208.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302808965|ref|XP_002986176.1| hypothetical protein SELMODRAFT_182249 [Selaginella moellendorffii] gi|300146035|gb|EFJ12707.1| hypothetical protein SELMODRAFT_182249 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302806475|ref|XP_002984987.1| hypothetical protein SELMODRAFT_20977 [Selaginella moellendorffii] gi|300147197|gb|EFJ13862.1| hypothetical protein SELMODRAFT_20977 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|297741319|emb|CBI32450.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302780485|ref|XP_002972017.1| hypothetical protein SELMODRAFT_96794 [Selaginella moellendorffii] gi|300160316|gb|EFJ26934.1| hypothetical protein SELMODRAFT_96794 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|359475386|ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
TAIR|locus:2024296 598 AT1G09900 "AT1G09900" [Arabido 0.588 0.150 0.342 1.6e-16
TAIR|locus:2026172 485 NG1 "novel gene 1" [Arabidopsi 0.960 0.303 0.225 7e-08
TAIR|locus:2116772 1112 PGR3 "AT4G31850" [Arabidopsis 0.575 0.079 0.333 2.6e-14
TAIR|locus:2016427 904 AT1G19290 [Arabidopsis thalian 0.686 0.116 0.280 2.6e-14
TAIR|locus:2161408 472 AT5G46100 "AT5G46100" [Arabido 0.562 0.182 0.381 2.9e-14
TAIR|locus:2089388 507 AT3G16710 [Arabidopsis thalian 0.718 0.216 0.295 3.9e-14
TAIR|locus:2024367 607 AT1G09680 "AT1G09680" [Arabido 0.607 0.153 0.271 4.1e-14
TAIR|locus:2084978 602 AT3G04760 [Arabidopsis thalian 0.549 0.139 0.336 1.7e-12
TAIR|locus:2173403 730 AT5G64320 "AT5G64320" [Arabido 0.509 0.106 0.388 1.2e-13
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.516 0.096 0.377 1.3e-13
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 154 (59.3 bits), Expect = 1.6e-16, Sum P(2) = 1.6e-16
 Identities = 36/105 (34%), Positives = 56/105 (53%)

Query:     3 CNKNDFFEARKVIDYMFDNGYHPNVTTYTIL-----------EAYEMLMNVKNDGLKPDV 51
             C+     +A +V+D M     +P+V TYTIL            A ++L  +++ G  PDV
Sbjct:   215 CDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDV 274

Query:    52 YTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLIHLHNVI 96
              TY  +++G CK GR +E ++ LN+    G  PNV+T    HN+I
Sbjct:   275 VTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVIT----HNII 315


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IDA
TAIR|locus:2026172 NG1 "novel gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016427 AT1G19290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161408 AT5G46100 "AT5G46100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089388 AT3G16710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024367 AT1G09680 "AT1G09680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084978 AT3G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
 Score = 55.5 bits (135), Expect = 2e-11
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 49 PDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVT 88
          PDV TY  ++DG+CK G+  E ++L NE  +RG+ PNV T
Sbjct: 1  PDVVTYNTLIDGYCKKGKVEEALKLFNEMKKRGIKPNVYT 40


This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
PLN03218 1060 maturation of RBCL 1; Provisional 99.98
PLN03218 1060 maturation of RBCL 1; Provisional 99.98
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN03077 857 Protein ECB2; Provisional 99.95
PLN03077 857 Protein ECB2; Provisional 99.94
PF1304150 PPR_2: PPR repeat family 99.78
PF1304150 PPR_2: PPR repeat family 99.72
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.62
PF1285434 PPR_1: PPR repeat 99.4
PF1285434 PPR_1: PPR repeat 99.38
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.08
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.07
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.06
PF1381234 PPR_3: Pentatricopeptide repeat domain 99.03
PRK11788389 tetratricopeptide repeat protein; Provisional 99.0
PF1381234 PPR_3: Pentatricopeptide repeat domain 99.0
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.94
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.88
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.87
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.65
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.58
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.54
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.46
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.42
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 98.33
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.32
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.26
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.05
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.05
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.01
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.93
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.92
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.91
KOG3941 406 consensus Intermediate in Toll signal transduction 97.9
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.86
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.76
PRK12370553 invasion protein regulator; Provisional 97.7
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.57
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.53
PRK15359144 type III secretion system chaperone protein SscB; 97.52
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.52
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.5
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.49
PRK12370553 invasion protein regulator; Provisional 97.47
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.47
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.46
PF13170297 DUF4003: Protein of unknown function (DUF4003) 97.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.38
KOG1126638 consensus DNA-binding cell division cycle control 97.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.33
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.29
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.28
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.23
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.22
KOG2003 840 consensus TPR repeat-containing protein [General f 97.21
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.21
KOG1126638 consensus DNA-binding cell division cycle control 97.2
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.17
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.03
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 96.99
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.97
KOG1129 478 consensus TPR repeat-containing protein [General f 96.95
KOG3941 406 consensus Intermediate in Toll signal transduction 96.92
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.91
PRK14574 822 hmsH outer membrane protein; Provisional 96.9
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.88
PRK15359144 type III secretion system chaperone protein SscB; 96.87
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 96.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.8
PRK14574 822 hmsH outer membrane protein; Provisional 96.79
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.77
KOG2003 840 consensus TPR repeat-containing protein [General f 96.7
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.67
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.6
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.51
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.46
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.46
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.43
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.39
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.37
PF1337173 TPR_9: Tetratricopeptide repeat 96.28
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.26
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.21
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.19
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.17
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.16
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.16
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.12
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.03
PRK10370198 formate-dependent nitrite reductase complex subuni 96.01
KOG1129478 consensus TPR repeat-containing protein [General f 95.94
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 95.63
COG3629280 DnrI DNA-binding transcriptional activator of the 95.61
PRK10370198 formate-dependent nitrite reductase complex subuni 95.58
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.53
KOG0553 304 consensus TPR repeat-containing protein [General f 95.5
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.47
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 95.3
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 95.29
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.28
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 95.2
PRK11189296 lipoprotein NlpI; Provisional 95.15
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.14
KOG0547606 consensus Translocase of outer mitochondrial membr 95.08
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 94.89
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 94.89
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.83
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.75
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.73
PF1337173 TPR_9: Tetratricopeptide repeat 94.73
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 94.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.68
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 94.55
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.51
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 94.49
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 94.42
KOG3785557 consensus Uncharacterized conserved protein [Funct 94.26
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.17
PRK10803263 tol-pal system protein YbgF; Provisional 94.1
KOG2076 895 consensus RNA polymerase III transcription factor 93.99
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.98
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.98
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 93.8
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.76
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 93.74
PF12688120 TPR_5: Tetratrico peptide repeat 93.69
PRK10153517 DNA-binding transcriptional activator CadC; Provis 93.61
KOG4340459 consensus Uncharacterized conserved protein [Funct 93.54
PF1342844 TPR_14: Tetratricopeptide repeat 93.48
PRK14720 906 transcript cleavage factor/unknown domain fusion p 93.45
KOG1128 777 consensus Uncharacterized conserved protein, conta 93.4
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 93.32
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 93.3
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 93.29
PF13762145 MNE1: Mitochondrial splicing apparatus component 93.19
KOG2076 895 consensus RNA polymerase III transcription factor 93.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.15
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.07
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.05
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.84
PF12688120 TPR_5: Tetratrico peptide repeat 92.82
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.39
KOG4340 459 consensus Uncharacterized conserved protein [Funct 92.31
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 92.2
PRK10564303 maltose regulon periplasmic protein; Provisional 92.17
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 91.93
KOG2047 835 consensus mRNA splicing factor [RNA processing and 91.92
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 91.92
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.73
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 91.72
PF1342844 TPR_14: Tetratricopeptide repeat 91.71
KOG4570 418 consensus Uncharacterized conserved protein [Funct 91.65
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 91.56
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 90.92
PRK11189 296 lipoprotein NlpI; Provisional 90.86
KOG3060289 consensus Uncharacterized conserved protein [Funct 90.71
KOG1915 677 consensus Cell cycle control protein (crooked neck 90.54
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 90.36
KOG4570 418 consensus Uncharacterized conserved protein [Funct 90.27
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 90.1
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 90.0
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 89.39
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.36
CHL00033168 ycf3 photosystem I assembly protein Ycf3 89.31
smart00299140 CLH Clathrin heavy chain repeat homology. 89.04
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.6
KOG2796366 consensus Uncharacterized conserved protein [Funct 88.25
PRK02603172 photosystem I assembly protein Ycf3; Provisional 88.18
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.18
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 88.17
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 88.1
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.94
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 87.73
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.52
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 87.4
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 86.55
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 86.21
KOG0495 913 consensus HAT repeat protein [RNA processing and m 86.16
KOG1128 777 consensus Uncharacterized conserved protein, conta 86.07
PRK13342 413 recombination factor protein RarA; Reviewed 85.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.83
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 85.72
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 85.55
PF1292688 MOZART2: Mitotic-spindle organizing gamma-tubulin 85.51
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 85.26
KOG3616 1636 consensus Selective LIM binding factor [Transcript 85.05
PRK10564303 maltose regulon periplasmic protein; Provisional 84.75
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.72
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 84.46
PF13929292 mRNA_stabil: mRNA stabilisation 84.41
COG3629280 DnrI DNA-binding transcriptional activator of the 84.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 84.26
KOG1125579 consensus TPR repeat-containing protein [General f 84.24
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 83.73
COG4235287 Cytochrome c biogenesis factor [Posttranslational 83.19
KOG1585308 consensus Protein required for fusion of vesicles 82.79
PF1343134 TPR_17: Tetratricopeptide repeat 82.63
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.62
PRK10153517 DNA-binding transcriptional activator CadC; Provis 82.02
PRK10803263 tol-pal system protein YbgF; Provisional 81.28
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 81.12
KOG2376 652 consensus Signal recognition particle, subunit Srp 81.06
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.72
PF14669233 Asp_Glu_race_2: Putative aspartate racemase 80.07
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 80.05
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=99.98  E-value=5.3e-31  Score=207.19  Aligned_cols=152  Identities=24%  Similarity=0.366  Sum_probs=101.2

Q ss_pred             ccccCChHHHHHHHHHHHHCCCCCChhhchHH-----------HHHHHHHHHHHcCCCccHHHHHHHHHHHHhcCCHHHH
Q 047010            2 YCNKNDFFEARKVIDYMFDNGYHPNVTTYTIL-----------EAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEV   70 (153)
Q Consensus         2 ~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~l-----------~a~~~~~~m~~~g~~~~~~t~~~ll~~~~~~g~~~~a   70 (153)
                      |++.|++++|.++|+.|.+.|++|+..+|+.+           +|.++|++|.+.|+.||..||+++|++|++.|++++|
T Consensus       589 y~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA  668 (1060)
T PLN03218        589 CANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKA  668 (1060)
T ss_pred             HHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHH
Confidence            45556666666666666666666666666555           5666666666666666666666666666666666666


Q ss_pred             HHHHHHHHHcCCCchHHHH-----------------HHHHHHHHcCCCCcHhhHHHHHHHHHccCcHHHHHHHHHHHHHC
Q 047010           71 MELLNEAIERGVTPNVVTL-----------------IHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALLLLFLMYEH  133 (153)
Q Consensus        71 ~~l~~~m~~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~  133 (153)
                      .++|++|.+.|+.||..+|                 .++.+|...+..||..+||++|.+|++.|++++|.++|++|.+.
T Consensus       669 ~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~  748 (1060)
T PLN03218        669 FEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRL  748 (1060)
T ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHc
Confidence            6666666666666666555                 44555666677777777777777777777777777777777777


Q ss_pred             CCCCCHHHHHHHHHHhhcCC
Q 047010          134 GKIPSRTLYDTLIKKLDQQP  153 (153)
Q Consensus       134 ~v~p~~~~~~~li~~~~~~g  153 (153)
                      |+.||..||+++|.+|++.|
T Consensus       749 Gi~Pd~~Ty~sLL~a~~k~G  768 (1060)
T PLN03218        749 GLCPNTITYSILLVASERKD  768 (1060)
T ss_pred             CCCCCHHHHHHHHHHHHHCC
Confidence            77777777777777777654



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12926 MOZART2: Mitotic-spindle organizing gamma-tubulin ring associated; InterPro: IPR024332 The MOZART2 family of proteins (also known as FAM128 and Mitotic-spindle organizing protein 2) operate as part of the gamma-tubulin ring complex, gamma-TuRC, one of the complexes necessary for chromosome segregation Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14669 Asp_Glu_race_2: Putative aspartate racemase Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 49.0 bits (115), Expect = 1e-07
 Identities = 19/122 (15%), Positives = 43/122 (35%), Gaps = 22/122 (18%)

Query: 34  EAYEMLMNVKN---DGLKPDVYTYTAVMDGFCKVGRSNEVMELLNEAIERGVTPNVVTLI 90
            A+ +L+             +  Y AVM G+ + G   E++ +L    + G+TP+++   
Sbjct: 145 LAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLL--- 201

Query: 91  HLHNVIDIGHIPRTITFNNVIQALCGVGKIDKALL-LLFLMYEHGKIPSRTLYDTLIKKL 149
                          ++   +Q +    +    +   L  M + G          L+ + 
Sbjct: 202 ---------------SYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEE 246

Query: 150 DQ 151
           D+
Sbjct: 247 DR 248


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.9
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.84
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.42
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.4
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.78
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.72
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.7
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.67
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.66
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.64
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 98.6
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.58
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 98.55
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.53
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.5
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.49
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.45
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.44
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.37
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.36
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.35
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.32
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.32
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.3
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.3
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.29
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.29
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 98.29
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.24
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.21
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.2
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.19
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.17
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.16
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.12
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.1
3u4t_A272 TPR repeat-containing protein; structural genomics 98.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.1
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.08
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.05
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.03
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.0
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.99
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.97
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.89
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.88
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.86
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 97.84
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.84
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.83
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.83
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.8
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.8
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.79
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.75
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.73
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.72
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.7
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.7
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.7
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 97.69
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.63
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.63
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.62
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.55
3k9i_A117 BH0479 protein; putative protein binding protein, 97.54
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.51
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.48
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.47
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 97.46
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.41
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.41
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.4
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.39
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.38
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.37
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.36
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.35
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.31
3u4t_A 272 TPR repeat-containing protein; structural genomics 97.31
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.3
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.29
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.28
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.25
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.24
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.24
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.22
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.2
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.18
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.17
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.14
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.08
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.02
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.98
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.91
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 96.9
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.9
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.89
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.87
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.82
4g1t_A472 Interferon-induced protein with tetratricopeptide 96.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.8
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 96.76
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.73
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.69
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.68
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.68
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.65
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 96.58
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.58
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.58
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.5
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.5
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.46
3k9i_A117 BH0479 protein; putative protein binding protein, 96.42
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 96.42
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.41
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.32
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.31
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.28
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.27
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.18
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.16
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 96.11
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 95.88
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.75
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.73
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 95.73
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.72
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.69
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 95.65
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.64
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.51
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.42
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.38
4g1t_A472 Interferon-induced protein with tetratricopeptide 95.27
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.17
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 95.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 94.98
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.8
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 94.75
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.69
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 94.68
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 94.62
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.39
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 94.37
2l6j_A111 TPR repeat-containing protein associated with HSP; 94.33
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 94.29
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 94.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 94.18
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.16
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 93.84
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.58
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 93.01
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.62
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 92.56
2kat_A115 Uncharacterized protein; NESG, structure, structur 92.53
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 92.49
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 92.25
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 91.97
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 91.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 91.64
1pc2_A152 Mitochondria fission protein; unknown function; NM 90.91
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.04
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 89.92
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 89.74
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 88.56
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 85.91
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 85.42
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 84.73
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.05
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 82.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 81.63
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 81.44
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 80.6
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=8.7e-36  Score=220.34  Aligned_cols=151  Identities=14%  Similarity=0.218  Sum_probs=145.8

Q ss_pred             CccccCChHHHHHHHHHHHHCCCCCChhhchHH--------------------HHHHHHHHHHHcCCCccHHHHHHHHHH
Q 047010            1 CYCNKNDFFEARKVIDYMFDNGYHPNVTTYTIL--------------------EAYEMLMNVKNDGLKPDVYTYTAVMDG   60 (153)
Q Consensus         1 a~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~l--------------------~a~~~~~~m~~~g~~~~~~t~~~ll~~   60 (153)
                      +|++.|++++|..+|++|.+.|++||..|||.|                    .|.++|++|...|+.||..|||+||.+
T Consensus        35 ~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~  114 (501)
T 4g26_A           35 MCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARL  114 (501)
T ss_dssp             HTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHH
T ss_pred             HHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHH
Confidence            489999999999999999999999999999988                    578999999999999999999999999


Q ss_pred             HHhcCCHHHHHHHHHHHHHcCCCchHHHH-----------------HHHHHHHHcCCCCcHhhHHHHHHHHHccCcHHHH
Q 047010           61 FCKVGRSNEVMELLNEAIERGVTPNVVTL-----------------IHLHNVIDIGHIPRTITFNNVIQALCGVGKIDKA  123 (153)
Q Consensus        61 ~~~~g~~~~a~~l~~~m~~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a  123 (153)
                      |++.|++++|+++|++|.+.|+.||..+|                 .++.+|.+.|+.||..||+++|.+|++.|++++|
T Consensus       115 ~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A  194 (501)
T 4g26_A          115 AVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKV  194 (501)
T ss_dssp             HHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHH
T ss_pred             HHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHH
Confidence            99999999999999999999999999998                 6778899999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHhhc
Q 047010          124 LLLLFLMYEHGKIPSRTLYDTLIKKLDQ  151 (153)
Q Consensus       124 ~~~~~~m~~~~v~p~~~~~~~li~~~~~  151 (153)
                      .++|++|++.|+.|+..||+.++..|+.
T Consensus       195 ~~ll~~Mr~~g~~ps~~T~~~l~~~F~s  222 (501)
T 4g26_A          195 YKTLQRLRDLVRQVSKSTFDMIEEWFKS  222 (501)
T ss_dssp             HHHHHHHHHHTSSBCHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHhCCCcCHHHHHHHHHHHhc
Confidence            9999999999999999999999999875



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.24
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.17
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.04
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.04
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.99
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.96
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.75
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.69
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.59
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.44
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 97.39
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.33
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.33
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.3
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.11
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.04
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 96.99
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.97
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.92
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.59
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 96.4
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.37
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.25
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.1
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 95.94
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.83
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.77
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 95.51
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 95.47
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.46
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.31
d1hz4a_366 Transcription factor MalT domain III {Escherichia 94.68
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 94.53
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 93.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 93.52
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.04
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 92.72
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 92.38
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 92.2
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 90.72
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 90.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 90.55
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.57
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.37
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 87.24
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 84.53
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 83.79
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 83.26
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.0
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 81.43
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 81.32
d1khda169 Anthranilate phosphoribosyltransferase (TrpD) {Pec 81.1
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.24  E-value=5.8e-05  Score=50.89  Aligned_cols=146  Identities=14%  Similarity=0.077  Sum_probs=90.6

Q ss_pred             cccCChHHHHHHHHHHHHCCCCCChhhchHH-----------HHHHHHHHHHHcCCCccHHHHHHHHHHHHhcCCHHHHH
Q 047010            3 CNKNDFFEARKVIDYMFDNGYHPNVTTYTIL-----------EAYEMLMNVKNDGLKPDVYTYTAVMDGFCKVGRSNEVM   71 (153)
Q Consensus         3 ~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~l-----------~a~~~~~~m~~~g~~~~~~t~~~ll~~~~~~g~~~~a~   71 (153)
                      ...|++++|...+....+.+. .+...+..+           +|...+++..+.. +-+...|..+-..+.+.|++++|.
T Consensus       214 ~~~~~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~  291 (388)
T d1w3ba_         214 KEARIFDRAVAAYLRALSLSP-NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAE  291 (388)
T ss_dssp             HTTTCTTHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHH
T ss_pred             hccccHHHHHHHHHHhHHHhh-hHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHH
Confidence            456777778777777766532 222333222           6677777665542 234566777777777778888887


Q ss_pred             HHHHHHHHcCCCchHHHH-------------HHHHHHHH--cCCCC-cHhhHHHHHHHHHccCcHHHHHHHHHHHHHCCC
Q 047010           72 ELLNEAIERGVTPNVVTL-------------IHLHNVID--IGHIP-RTITFNNVIQALCGVGKIDKALLLLFLMYEHGK  135 (153)
Q Consensus        72 ~l~~~m~~~~~~~~~~~~-------------~~~~~~~~--~~~~~-~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~v  135 (153)
                      +.++...... +.+...+             .-.....+  -...| +..+|..+-..|.+.|++++|...|++..+.  
T Consensus       292 ~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--  368 (388)
T d1w3ba_         292 DCYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--  368 (388)
T ss_dssp             HHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--
T ss_pred             HHHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--
Confidence            7777765543 2222222             11111111  12334 4567888999999999999999999988764  


Q ss_pred             CCC-HHHHHHHHHHhhcCC
Q 047010          136 IPS-RTLYDTLIKKLDQQP  153 (153)
Q Consensus       136 ~p~-~~~~~~li~~~~~~g  153 (153)
                      .|+ ...|..+-..+.+.|
T Consensus       369 ~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         369 SPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             CTTCHHHHHHHHHHHHHTC
T ss_pred             CCCCHHHHHHHHHHHHHcC
Confidence            464 667777777776544



>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure