Citrus Sinensis ID: 047544

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA
ccccccccccccccccccEEEEcccccEEEcccccccccEEEEEEEccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHc
EEEEEEEEEEEEEccccEEEEEEEEEEEEEccccccccEEEEEEEcccccEEEEEEccccEEEEccEcccccccccccHHHHHHHHHHHHHHHHc
kfghhggnhpvhniqngrveisaqnhnyavdpatlpkgvevthinlndgtcaglaypALNVMSLQYhleaspgpddsdcvFRDFVELMKSVKYRA
kfghhggnhpvhniQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA
KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA
*******************EISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEA******SDCVFRDFVELM*******
KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVEL*KSV****
********HPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA
KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query95 2.2.26 [Sep-21-2011]
O66727371 Carbamoyl-phosphate synth yes no 0.936 0.239 0.539 4e-26
B2URJ0372 Carbamoyl-phosphate synth yes no 0.989 0.252 0.510 4e-24
O28995358 Carbamoyl-phosphate synth yes no 0.968 0.256 0.5 8e-23
P63730366 Carbamoyl-phosphate synth yes no 0.989 0.256 0.515 1e-22
Q6GA11366 Carbamoyl-phosphate synth yes no 0.989 0.256 0.515 1e-22
P99147366 Carbamoyl-phosphate synth yes no 0.989 0.256 0.515 1e-22
P63729366 Carbamoyl-phosphate synth yes no 0.989 0.256 0.515 1e-22
Q5HGN0366 Carbamoyl-phosphate synth yes no 0.989 0.256 0.515 1e-22
Q6GHN3366 Carbamoyl-phosphate synth yes no 0.989 0.256 0.515 1e-22
Q1IWN0394 Carbamoyl-phosphate synth yes no 0.905 0.218 0.586 2e-22
>sp|O66727|CARA_AQUAE Carbamoyl-phosphate synthase small chain OS=Aquifex aeolicus (strain VF5) GN=carA PE=3 SV=1 Back     alignment and function desciption
 Score =  116 bits (291), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/89 (53%), Positives = 70/89 (78%)

Query: 1   KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALN 60
           KFGHHGGNHPV +++ G++EI+AQNHN+A+DP +LP+ VEVTH+NL D T  G+ +  L 
Sbjct: 282 KFGHHGGNHPVKDLRTGKIEITAQNHNFAIDPESLPEDVEVTHLNLLDNTVEGIKHKHLP 341

Query: 61  VMSLQYHLEASPGPDDSDCVFRDFVELMK 89
           + ++QYH E SPGP DS  +F++FV++ +
Sbjct: 342 IFAVQYHPENSPGPHDSYYLFKEFVKMAQ 370

Aquifex aeolicus (strain VF5) (taxid: 224324)
EC: 6EC: .EC: 3EC: .EC: 5EC: .EC: 5
>sp|B2URJ0|CARA_AKKM8 Carbamoyl-phosphate synthase small chain OS=Akkermansia muciniphila (strain ATCC BAA-835) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|O28995|CARA_ARCFU Carbamoyl-phosphate synthase small chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|P63730|CARA_STAAW Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MW2) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|Q6GA11|CARA_STAAS Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MSSA476) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|P99147|CARA_STAAN Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain N315) GN=carA PE=1 SV=1 Back     alignment and function description
>sp|P63729|CARA_STAAM Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|Q5HGN0|CARA_STAAC Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain COL) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|Q6GHN3|CARA_STAAR Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MRSA252) GN=carA PE=3 SV=1 Back     alignment and function description
>sp|Q1IWN0|CARA_DEIGD Carbamoyl-phosphate synthase small chain OS=Deinococcus geothermalis (strain DSM 11300) GN=carA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
359476949 426 PREDICTED: carbamoyl-phosphate synthase 1.0 0.223 0.8 3e-40
262181537 426 anthranilate synthase 02 [Vitis vinifera 1.0 0.223 0.8 3e-40
224137896 390 predicted protein [Populus trichocarpa] 1.0 0.243 0.821 1e-39
224074207 428 predicted protein [Populus trichocarpa] 1.0 0.221 0.810 3e-39
297818374 430 hypothetical protein ARALYDRAFT_484564 [ 0.968 0.213 0.782 7e-39
449435154 432 PREDICTED: carbamoyl-phosphate synthase 1.0 0.219 0.757 1e-38
18405507 430 carbamoyl phosphate synthetase A [Arabid 0.968 0.213 0.771 3e-38
2462781 428 carbamoyl phosphate synthetase small sub 0.968 0.214 0.771 3e-38
356512801 429 PREDICTED: carbamoyl-phosphate synthase 0.989 0.219 0.776 3e-38
356516335 438 PREDICTED: carbamoyl-phosphate synthase 1.0 0.216 0.778 4e-38
>gi|359476949|ref|XP_002282659.2| PREDICTED: carbamoyl-phosphate synthase small chain [Vitis vinifera] gi|296088611|emb|CBI37602.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 87/95 (91%)

Query: 1   KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALN 60
           KFGHHGGNHPV N+++GRVEISAQNHNYAVDPA+LP+GVEVTH+NLNDG+CAGLAYPALN
Sbjct: 332 KFGHHGGNHPVRNLRSGRVEISAQNHNYAVDPASLPEGVEVTHVNLNDGSCAGLAYPALN 391

Query: 61  VMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA 95
           +MSLQYH EASPGP DSD  FR+F++LMK VK  A
Sbjct: 392 IMSLQYHPEASPGPHDSDPAFREFIQLMKQVKQNA 426

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|262181537|gb|ACY29659.1| anthranilate synthase 02 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224137896|ref|XP_002326467.1| predicted protein [Populus trichocarpa] gi|222833789|gb|EEE72266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224074207|ref|XP_002304301.1| predicted protein [Populus trichocarpa] gi|222841733|gb|EEE79280.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297818374|ref|XP_002877070.1| hypothetical protein ARALYDRAFT_484564 [Arabidopsis lyrata subsp. lyrata] gi|297322908|gb|EFH53329.1| hypothetical protein ARALYDRAFT_484564 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449435154|ref|XP_004135360.1| PREDICTED: carbamoyl-phosphate synthase small chain-like [Cucumis sativus] gi|449524226|ref|XP_004169124.1| PREDICTED: carbamoyl-phosphate synthase small chain-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18405507|ref|NP_566824.1| carbamoyl phosphate synthetase A [Arabidopsis thaliana] gi|9294479|dbj|BAB02698.1| carbamoyl-phosphate synthetase small subunit [Arabidopsis thaliana] gi|15028109|gb|AAK76678.1| putative carbamoyl phosphate synthetase small subunit [Arabidopsis thaliana] gi|19310631|gb|AAL85046.1| putative carbamoyl phosphate synthetase small subunit [Arabidopsis thaliana] gi|332643837|gb|AEE77358.1| carbamoyl phosphate synthetase A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2462781|gb|AAC25961.1| carbamoyl phosphate synthetase small subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356512801|ref|XP_003525104.1| PREDICTED: carbamoyl-phosphate synthase small chain-like [Glycine max] Back     alignment and taxonomy information
>gi|356516335|ref|XP_003526851.1| PREDICTED: carbamoyl-phosphate synthase small chain-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
TAIR|locus:2089149430 CARA "AT3G27740" [Arabidopsis 0.968 0.213 0.771 8e-37
TIGR_CMR|DET_1201364 DET_1201 "carbamoyl-phosphate 0.968 0.252 0.608 1.3e-27
TIGR_CMR|APH_0381365 APH_0381 "carbamoyl-phosphate 0.926 0.241 0.5 3.9e-21
TIGR_CMR|SO_1141386 SO_1141 "carbamoyl-phosphate s 1.0 0.246 0.484 2.9e-20
TIGR_CMR|CBU_1282402 CBU_1282 "carbamoyl-phosphate 0.936 0.221 0.505 4.8e-20
UNIPROTKB|P0A6F1382 carA [Escherichia coli K-12 (t 0.968 0.240 0.510 1e-19
TIGR_CMR|BA_4026365 BA_4026 "carbamoyl-phosphate s 0.968 0.252 0.462 1.3e-19
TIGR_CMR|GSU_1273374 GSU_1273 "carbamoyl-phosphate 0.968 0.245 0.5 4.4e-19
TIGR_CMR|SPO_1377388 SPO_1377 "carbamoyl-phosphate 0.947 0.231 0.488 5.4e-19
UNIPROTKB|Q9KPH8379 carA "Carbamoyl-phosphate synt 0.978 0.245 0.473 3.9e-18
TAIR|locus:2089149 CARA "AT3G27740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 8.0e-37, P = 8.0e-37
 Identities = 71/92 (77%), Positives = 81/92 (88%)

Query:     1 KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALN 60
             KFGHHGGNHPV N + G+VEISAQNHNYAVDPA+LP GVEVTH+NLNDG+CAGL++P +N
Sbjct:   336 KFGHHGGNHPVRNNRTGQVEISAQNHNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMN 395

Query:    61 VMSLQYHLEASPGPDDSDCVFRDFVELMKSVK 92
             VMSLQYH EASPGP DSD  FR+F+ELMK  K
Sbjct:   396 VMSLQYHPEASPGPHDSDNAFREFIELMKRSK 427
GO:0004088 "carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity" evidence=ISS;IDA
GO:0006543 "glutamine catabolic process" evidence=IEA
GO:0070409 "carbamoyl phosphate biosynthetic process" evidence=IEA
GO:0016036 "cellular response to phosphate starvation" evidence=IEP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0005951 "carbamoyl-phosphate synthase complex" evidence=IDA
GO:0001510 "RNA methylation" evidence=RCA
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
TIGR_CMR|DET_1201 DET_1201 "carbamoyl-phosphate synthase, small subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0381 APH_0381 "carbamoyl-phosphate synthase, small subunit" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1141 SO_1141 "carbamoyl-phosphate synthase, small subunit" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1282 CBU_1282 "carbamoyl-phosphate synthase, small subunit" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6F1 carA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4026 BA_4026 "carbamoyl-phosphate synthase, small subunit" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1273 GSU_1273 "carbamoyl-phosphate synthase, small subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1377 SPO_1377 "carbamoyl-phosphate synthase, small subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPH8 carA "Carbamoyl-phosphate synthase small chain" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034896001
SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (407 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00024476001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (749 aa)
••••••• 0.999
GSVIVG00027272001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (403 aa)
•• • •• 0.999
GSVIVG00014587001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (261 aa)
•• • •• 0.998
GSVIVG00035979001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (582 aa)
•  • •• 0.991
GSVIVG00024477001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (388 aa)
••• • • 0.989
GSVIVG00017913001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (430 aa)
•  •  • 0.985
GSVIVG00007090001
SubName- Full=Chromosome undetermined scaffold_183, whole genome shotgun sequence; (493 aa)
•  • •• 0.979
GSVIVG00036526001
RecName- Full=N-acetyl-gamma-glutamyl-phosphate reductase; EC=1.2.1.38; (398 aa)
•  •  • 0.975
GSVIVG00015101001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (525 aa)
•  •  • 0.969
GSVIVG00032389001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (351 aa)
•  •  • 0.963

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
PLN02771415 PLN02771, PLN02771, carbamoyl-phosphate synthase ( 4e-52
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase s 1e-50
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synt 5e-46
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small s 7e-44
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 2e-43
PRK12838354 PRK12838, PRK12838, carbamoyl phosphate synthase s 2e-37
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase argin 2e-27
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 3e-17
>gnl|CDD|178370 PLN02771, PLN02771, carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information 
 Score =  167 bits (424), Expect = 4e-52
 Identities = 68/81 (83%), Positives = 74/81 (91%)

Query: 1   KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALN 60
           KFGHHGGNHPV N + GRVEISAQNHNYAVDPA+LP+GVEVTH+NLNDG+CAGLA+PALN
Sbjct: 335 KFGHHGGNHPVRNNRTGRVEISAQNHNYAVDPASLPEGVEVTHVNLNDGSCAGLAFPALN 394

Query: 61  VMSLQYHLEASPGPDDSDCVF 81
           VMSLQYH EASPGP DSD  F
Sbjct: 395 VMSLQYHPEASPGPHDSDNAF 415

Length = 415
>gnl|CDD|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233378 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|223579 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|214392 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 95
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.98
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.95
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.93
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.93
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.91
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.9
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.86
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.86
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.81
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.8
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.79
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.79
PLN02327557 CTP synthase 99.75
COG2071243 Predicted glutamine amidotransferases [General fun 99.73
PRK05670189 anthranilate synthase component II; Provisional 99.73
PLN02335222 anthranilate synthase 99.73
PRK06186229 hypothetical protein; Validated 99.71
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.71
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.69
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.66
CHL00101190 trpG anthranilate synthase component 2 99.66
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.65
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.63
PRK05380533 pyrG CTP synthetase; Validated 99.63
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.62
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.61
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.58
PRK06895190 putative anthranilate synthase component II; Provi 99.57
PRK00758184 GMP synthase subunit A; Validated 99.55
PRK05637208 anthranilate synthase component II; Provisional 99.55
PRK13566720 anthranilate synthase; Provisional 99.55
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.54
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.54
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.52
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.51
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 99.5
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.5
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.49
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.48
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.48
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 99.46
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 99.44
PLN02347 536 GMP synthetase 99.39
PRK00074 511 guaA GMP synthase; Reviewed 99.36
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.2
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.14
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.14
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.09
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.09
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.06
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.03
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.03
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.03
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 98.97
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 98.97
PRK09065237 glutamine amidotransferase; Provisional 98.95
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 98.94
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 98.89
PRK07567242 glutamine amidotransferase; Provisional 98.83
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 98.83
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 98.81
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 98.78
PLN02617 538 imidazole glycerol phosphate synthase hisHF 98.78
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 98.77
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 98.71
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 98.64
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 98.64
PRK06490239 glutamine amidotransferase; Provisional 98.63
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 98.51
PRK08250235 glutamine amidotransferase; Provisional 98.49
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 98.48
PRK05665240 amidotransferase; Provisional 98.4
PRK07053234 glutamine amidotransferase; Provisional 98.28
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 98.28
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 97.95
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 97.87
PRK05368302 homoserine O-succinyltransferase; Provisional 97.52
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 97.3
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 94.53
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 91.5
COG0311194 PDX2 Predicted glutamine amidotransferase involved 91.26
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 90.88
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 88.79
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 88.77
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 88.3
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 88.0
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 86.83
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 82.1
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.98  E-value=1.5e-32  Score=206.62  Aligned_cols=93  Identities=53%  Similarity=0.916  Sum_probs=88.2

Q ss_pred             CCCCCcCCcceeecCCCeEEEccccceeEEccCCCCCCeEEEEEeCCCCeEEEEEeCCCCEEEEeccCCCCCCCCChHHH
Q 047544            1 KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCV   80 (95)
Q Consensus         1 ~~g~~g~n~pv~~~~~~~i~~~s~~H~~~v~~~~l~~~~~v~a~~~~dg~iEai~~~~~pi~gvQfHPE~~~~~~~~~~i   80 (95)
                      ||||||.||||+|+.|++++||||||+|+|++++++....++.++++||++|+|+|+++|+|+||||||..++|.|...|
T Consensus       275 kFGHrG~NhPV~dl~tgrv~ITSQNHGyaVd~~s~~~~~~vth~nlnDgTvEGi~h~~~P~fSVQ~HPEAsPGPhDt~yl  354 (368)
T COG0505         275 KFGHRGANHPVKDLDTGRVYITSQNHGYAVDEDSLVETLKVTHVNLNDGTVEGIRHKDLPAFSVQYHPEASPGPHDTRYL  354 (368)
T ss_pred             ccCCCCCCcCcccccCCeEEEEecCCceecChhhcCCCceeEEEeCCCCCccceecCCCceEEEccCCCCCCCCcccHHH
Confidence            79999999999999999999999999999999888865589999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhc
Q 047544           81 FRDFVELMKSVKY   93 (95)
Q Consensus        81 f~~Fi~~~~~~~~   93 (95)
                      |+.|+++++..+.
T Consensus       355 Fd~Fi~~~~~~~~  367 (368)
T COG0505         355 FDEFIELMEAAKK  367 (368)
T ss_pred             HHHHHHHHHHhhc
Confidence            9999999987653

>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
1c30_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 1e-20
1cs0_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 1e-20
1t36_B382 Crystal Structure Of E. Coli Carbamoyl Phosphate Sy 1e-20
1jdb_C382 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-20
1a9x_B379 Carbamoyl Phosphate Synthetase: Caught In The Act O 1e-19
1m6v_B382 Crystal Structure Of The G359f (Small Subunit) Poin 1e-19
>pdb|1C30|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small Subunit Mutation C269s Length = 382 Back     alignment and structure 
Iteration: 1

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%)
Query: 1   KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALN 60
           KFGHHGGNHPV +++   V I+AQNH +AVD ATLP  + VTH +L DGT  G+      
Sbjct: 287 KFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKP 346
Query: 61  VMSLQYHLEASPGPDDSDCVFRDFVELMKSVKYRA 95
             S Q H EASPGP D+  +F  F+EL++  +  A
Sbjct: 347 AFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTA 381
>pdb|1CS0|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase Complexed At Cys269 In The Small Subunit With The Tetrahedral Mimic L-glutamate Gamma-semialdehyde Length = 382 Back     alignment and structure
>pdb|1T36|B Chain B, Crystal Structure Of E. Coli Carbamoyl Phosphate Synthetase Small Subunit Mutant C248d Complexed With Uridine 5'-Monophosphate Length = 382 Back     alignment and structure
>pdb|1JDB|C Chain C, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 382 Back     alignment and structure
>pdb|1A9X|B Chain B, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 379 Back     alignment and structure
>pdb|1M6V|B Chain B, Crystal Structure Of The G359f (Small Subunit) Point Mutant Of Carbamoyl Phosphate Synthetase Length = 382 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 4e-54
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Length = 379 Back     alignment and structure
 Score =  171 bits (435), Expect = 4e-54
 Identities = 45/92 (48%), Positives = 60/92 (65%)

Query: 1   KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALN 60
           KFGHHGGNHPV +++   V I+AQNH +AVD ATLP  + VTH +L DGT  G+      
Sbjct: 286 KFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKP 345

Query: 61  VMSLQYHLEASPGPDDSDCVFRDFVELMKSVK 92
             S Q + EASPGP D+  +F  F+EL++  +
Sbjct: 346 AFSFQGNPEASPGPHDAAPLFDHFIELIEQYR 377

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.91
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.7
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.68
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.67
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.64
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.62
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.62
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.61
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.6
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.59
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.59
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.56
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.48
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.48
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.44
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.42
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.4
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.39
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.36
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.35
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.34
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.31
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.26
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.25
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.25
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.24
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.22
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.1
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.06
3m3p_A250 Glutamine amido transferase; structural genomics, 99.04
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.0
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 98.9
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 98.75
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 97.51
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 97.45
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
Probab=99.91  E-value=8.1e-25  Score=165.87  Aligned_cols=92  Identities=49%  Similarity=0.802  Sum_probs=84.8

Q ss_pred             CCCCCcCCcceeecCCCeEEEccccceeEEccCCCCCCeEEEEEeCCCCeEEEEEeCCCCEEEEeccCCCCCCCCChHHH
Q 047544            1 KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCV   80 (95)
Q Consensus         1 ~~g~~g~n~pv~~~~~~~i~~~s~~H~~~v~~~~l~~~~~v~a~~~~dg~iEai~~~~~pi~gvQfHPE~~~~~~~~~~i   80 (95)
                      ++||+|.||||.++.++++++++++|+|+|+.++||++++++|++.+|++||||++++.|++|||||||..+++.+...|
T Consensus       286 ~~gh~g~n~pv~~~~~g~v~its~~H~~aV~~~~Lp~~~~v~a~s~~Dg~ieai~~~~~pi~gVQFHPE~~~~p~d~~~L  365 (379)
T 1a9x_B          286 KFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGNPEASPGPHDAAPL  365 (379)
T ss_dssp             EEEEEEEEEEEEETTTTEEEEEEEEEEEEECSTTCCTTEEEEEEETTTCCEEEEEESSSSEEEESSCTTCSSSCSTTTHH
T ss_pred             ccccccCceeeEecCCCcEEEEecCccceEecccCCCCeEEEEEeCCCCcEEEEEECCCCEEEEEeCCcCCCCcccHHHH
Confidence            46899999999999999999999999999987789999999999878999999999999999999999999877777789


Q ss_pred             HHHHHHHHHhhh
Q 047544           81 FRDFVELMKSVK   92 (95)
Q Consensus        81 f~~Fi~~~~~~~   92 (95)
                      |++|++++++++
T Consensus       366 f~~Fl~~~~~~~  377 (379)
T 1a9x_B          366 FDHFIELIEQYR  377 (379)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhh
Confidence            999999997654
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 95
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 7e-18
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 6e-09
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 1e-06
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 1e-05
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 8e-04
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Carbamoyl phosphate synthetase, small subunit C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 72.9 bits (178), Expect = 7e-18
 Identities = 44/91 (48%), Positives = 59/91 (64%)

Query: 2   FGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNV 61
           FGHHGGNHPV +++   V I+AQNH +AVD ATLP  + VTH +L DGT  G+       
Sbjct: 136 FGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPA 195

Query: 62  MSLQYHLEASPGPDDSDCVFRDFVELMKSVK 92
            S Q + EASPGP D+  +F  F+EL++  +
Sbjct: 196 FSFQGNPEASPGPHDAAPLFDHFIELIEQYR 226
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 188 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.9
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.7
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.65
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.64
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.62
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.57
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.56
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.28
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.17
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 98.92
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 98.87
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 98.71
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 98.68
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 98.68
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 98.47
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 98.16
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 96.65
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 85.67
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Carbamoyl phosphate synthetase, small subunit C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.90  E-value=4.2e-24  Score=150.58  Aligned_cols=93  Identities=48%  Similarity=0.786  Sum_probs=86.9

Q ss_pred             CCCCCcCCcceeecCCCeEEEccccceeEEccCCCCCCeEEEEEeCCCCeEEEEEeCCCCEEEEeccCCCCCCCCChHHH
Q 047544            1 KFGHHGGNHPVHNIQNGRVEISAQNHNYAVDPATLPKGVEVTHINLNDGTCAGLAYPALNVMSLQYHLEASPGPDDSDCV   80 (95)
Q Consensus         1 ~~g~~g~n~pv~~~~~~~i~~~s~~H~~~v~~~~l~~~~~v~a~~~~dg~iEai~~~~~pi~gvQfHPE~~~~~~~~~~i   80 (95)
                      ++||+|.++|+.+..++.++.+.++|++.+..++++.++.+++.+.+|++||||+|+++|+||||||||+..++.++..|
T Consensus       135 ~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~s~~d~~i~ai~h~~~~i~gVQFHPE~~~t~~dg~~l  214 (228)
T d1a9xb2         135 KFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGNPEASPGPHDAAPL  214 (228)
T ss_dssp             EEEEEEEEEEEEETTTTEEEEEEEEEEEEECSTTCCTTEEEEEEETTTCCEEEEEESSSSEEEESSCTTCSSSCSTTTHH
T ss_pred             ccccccccccccccccceeeeecccccceecccccccceEEEEEecCCCcEEEEEECCCCEEEEeCCCCCCCCcccHHHH
Confidence            36899999999999999999999999999998899999999999889999999999999999999999999888888899


Q ss_pred             HHHHHHHHHhhhc
Q 047544           81 FRDFVELMKSVKY   93 (95)
Q Consensus        81 f~~Fi~~~~~~~~   93 (95)
                      |++|++.|+++++
T Consensus       215 ~~nFl~~i~~~kk  227 (228)
T d1a9xb2         215 FDHFIELIEQYRK  227 (228)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhC
Confidence            9999999998764
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure