Citrus Sinensis ID: 048152


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKLAEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN
ccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccc
ccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccHHHHHHHHHcccc
medfpkvfcgwsweeNKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLqfiesgkldhklaefqpsvhvdctqsvcwtdednnlllqldin
MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKLAEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN
MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKLAEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN
****PKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKLAEFQPSVHVDCTQSVCWTDEDNNLLLQL***
************WEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKL**********************DEDNNLLLQLDI*
MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKLAEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN
***FPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKL*****************SVCWTDEDNNLLLQLDIN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKLAEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
Q6NNN081 Protein RADIALIS-like 3 O yes no 0.576 0.740 0.540 6e-12
Q58FS393 Transcription factor RADI N/A no 0.557 0.623 0.559 1e-11
Q1A17397 Protein RADIALIS-like 6 O no no 0.557 0.597 0.525 3e-11
F4JVB8100 Protein RADIALIS-like 1 O no no 0.538 0.56 0.473 8e-10
Q8GW75100 Protein RADIALIS-like 5 O no no 0.490 0.51 0.576 6e-09
Q1G3C477 Protein RADIALIS-like 4 O no no 0.519 0.701 0.509 8e-09
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.538 0.554 0.456 5e-08
Q8S9H7 307 Transcription factor DIVA N/A no 0.538 0.182 0.508 3e-07
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (1%)

Query: 11 WSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLD 70
          W+ +ENKLFE ALA  D+  P RW  VA  VGG KSAE+V++HY +L+ D+  IESG+  
Sbjct: 12 WTRKENKLFERALATYDQDTPDRWHNVARAVGG-KSAEEVRRHYELLIRDVNDIESGRYP 70

Query: 71 H 71
          H
Sbjct: 71 H 71




Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function description
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
22413086698 predicted protein [Populus trichocarpa] 0.913 0.969 0.833 2e-37
224064752103 predicted protein [Populus trichocarpa] 0.980 0.990 0.757 6e-37
22543779998 PREDICTED: uncharacterized protein LOC10 0.942 1.0 0.721 4e-34
356503964108 PREDICTED: uncharacterized protein LOC10 0.951 0.916 0.717 1e-32
147818958202 hypothetical protein VITISV_040171 [Viti 0.855 0.440 0.726 9e-32
35172193797 uncharacterized protein LOC100500464 [Gl 0.923 0.989 0.697 5e-31
297744097132 unnamed protein product [Vitis vinifera] 0.875 0.689 0.711 1e-30
35744207793 hypothetical protein MTR_1g086180 [Medic 0.894 1.0 0.688 5e-29
255548273109 conserved hypothetical protein [Ricinus 0.855 0.816 0.681 4e-28
357511539114 DIV3B protein [Medicago truncatula] gi|3 0.855 0.780 0.670 5e-27
>gi|224130866|ref|XP_002320944.1| predicted protein [Populus trichocarpa] gi|222861717|gb|EEE99259.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (89%), Gaps = 1/96 (1%)

Query: 10  GWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKL 69
           GWSWEENKLFE+ALAVVDE+DP RW+VVAAMVGG KS EDVQKHYVILLEDLQ IESGKL
Sbjct: 3   GWSWEENKLFEMALAVVDEEDPDRWKVVAAMVGGKKSEEDVQKHYVILLEDLQGIESGKL 62

Query: 70  DHKL-AEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN 104
           DHKL  E QP V VDCT+SVCWTDED+ LL+QLDIN
Sbjct: 63  DHKLVGEAQPCVQVDCTESVCWTDEDHKLLVQLDIN 98




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224064752|ref|XP_002301546.1| predicted protein [Populus trichocarpa] gi|222843272|gb|EEE80819.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225437799|ref|XP_002281797.1| PREDICTED: uncharacterized protein LOC100250300 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356503964|ref|XP_003520769.1| PREDICTED: uncharacterized protein LOC100800948 [Glycine max] Back     alignment and taxonomy information
>gi|147818958|emb|CAN67130.1| hypothetical protein VITISV_040171 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351721937|ref|NP_001238506.1| uncharacterized protein LOC100500464 [Glycine max] gi|255630389|gb|ACU15551.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297744097|emb|CBI37067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357442077|ref|XP_003591316.1| hypothetical protein MTR_1g086180 [Medicago truncatula] gi|355480364|gb|AES61567.1| hypothetical protein MTR_1g086180 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255548273|ref|XP_002515193.1| conserved hypothetical protein [Ricinus communis] gi|223545673|gb|EEF47177.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357511539|ref|XP_003626058.1| DIV3B protein [Medicago truncatula] gi|355501073|gb|AES82276.1| DIV3B protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
TAIR|locus:211526081 RL3 "RAD-like 3" [Arabidopsis 0.576 0.740 0.540 1.2e-12
UNIPROTKB|Q58FS393 RAD "Transcription factor RADI 0.557 0.623 0.559 3.1e-12
TAIR|locus:202518297 RL6 "RAD-like 6" [Arabidopsis 0.557 0.597 0.525 1e-11
TAIR|locus:2016417100 RL5 "RAD-like 5" [Arabidopsis 0.519 0.54 0.563 4.5e-11
TAIR|locus:401071363177 RL4 "RAD-like 4" [Arabidopsis 0.548 0.740 0.5 7.4e-11
TAIR|locus:2136283100 RL1 "RAD-like 1" [Arabidopsis 0.538 0.56 0.473 7.4e-11
TAIR|locus:2074723 263 AT3G11280 [Arabidopsis thalian 0.557 0.220 0.491 2.9e-10
UNIPROTKB|Q8S9H7 307 DIVARICATA "Transcription fact 0.538 0.182 0.508 7.2e-10
TAIR|locus:2159607 298 AT5G08520 [Arabidopsis thalian 0.538 0.187 0.473 1.1e-09
TAIR|locus:2166459 277 AT5G05790 [Arabidopsis thalian 0.538 0.202 0.526 1.5e-09
TAIR|locus:2115260 RL3 "RAD-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 1.2e-12, P = 1.2e-12
 Identities = 33/61 (54%), Positives = 43/61 (70%)

Query:    11 WSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLD 70
             W+ +ENKLFE ALA  D+  P RW  VA  VGG KSAE+V++HY +L+ D+  IESG+  
Sbjct:    12 WTRKENKLFERALATYDQDTPDRWHNVARAVGG-KSAEEVRRHYELLIRDVNDIESGRYP 70

Query:    71 H 71
             H
Sbjct:    71 H 71




GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713631 RL4 "RAD-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0061007202
hypothetical protein (99 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.28
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.08
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.04
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.89
KOG0724 335 consensus Zuotin and related molecular chaperones 98.86
PLN03212 249 Transcription repressor MYB5; Provisional 98.39
PLN03091 459 hypothetical protein; Provisional 98.23
PLN03212249 Transcription repressor MYB5; Provisional 97.87
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.86
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.77
PLN03091 459 hypothetical protein; Provisional 97.69
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.33
KOG0048 238 consensus Transcription factor, Myb superfamily [T 97.31
KOG4167 907 consensus Predicted DNA-binding protein, contains 97.28
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.21
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.75
KOG1279 506 consensus Chromatin remodeling factor subunit and 96.69
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 96.6
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.48
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.91
KOG0051 607 consensus RNA polymerase I termination factor, Myb 95.8
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.63
KOG1194 534 consensus Predicted DNA-binding protein, contains 95.48
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.32
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 95.11
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.78
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 93.01
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 90.43
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.77
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 88.45
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 88.4
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 88.26
KOG4329445 consensus DNA-binding protein [General function pr 87.14
smart0059589 MADF subfamily of SANT domain. 86.63
COG5147 512 REB1 Myb superfamily proteins, including transcrip 86.37
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 85.3
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 84.85
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
Probab=99.28  E-value=1.2e-11  Score=73.76  Aligned_cols=45  Identities=22%  Similarity=0.433  Sum_probs=40.6

Q ss_pred             CCCCHHHHHHHHHHHhhcCCCCCchHHHHHHHcC-CCCCHHHHHHHHHHH
Q 048152            9 CGWSWEENKLFELALAVVDEQDPHRWEVVAAMVG-GTKSAEDVQKHYVIL   57 (104)
Q Consensus         9 ~~WT~eE~k~fE~ALa~~p~~~pdRWekIA~~vp-g~KS~~eV~~ryk~L   57 (104)
                      ..||.+|+.+|..|+.+|+.+   +|.+||..|| | ||..+|+.||..+
T Consensus         2 ~~Wt~eE~~~l~~~v~~~g~~---~W~~Ia~~~~~~-Rt~~qc~~~~~~~   47 (48)
T PF00249_consen    2 GPWTEEEDEKLLEAVKKYGKD---NWKKIAKRMPGG-RTAKQCRSRYQNL   47 (48)
T ss_dssp             -SS-HHHHHHHHHHHHHSTTT---HHHHHHHHHSSS-STHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHhCCc---HHHHHHHHcCCC-CCHHHHHHHHHhh
Confidence            469999999999999999875   8999999999 7 9999999999876



These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....

>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 1e-12
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 8e-05
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure

Iteration: 1

Score = 68.6 bits (166), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/59 (55%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Query: 11 WSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKL 69 WS +ENK FE ALAV D+ P RW VA V G ++ E+V+KHY IL+ED+++IESGK+ Sbjct: 11 WSAKENKAFERALAVYDKDTPDRWANVARAVEG-RTPEEVKKHYEILVEDIKYIESGKV 68
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
2cjj_A93 Radialis; plant development, DNA-binding protein, 1e-22
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 1e-18
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-15
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-06
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 3e-06
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 5e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 4e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score = 83.0 bits (205), Expect = 1e-22
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 1/68 (1%)

Query: 1  MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLED 60
          M         WS +ENK FE ALAV D+  P RW  VA  V G ++ E+V+KHY IL+ED
Sbjct: 1  MASTRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEG-RTPEEVKKHYEILVED 59

Query: 61 LQFIESGK 68
          +++IESGK
Sbjct: 60 IKYIESGK 67


>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.93
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.92
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.87
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.86
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.8
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.48
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.43
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.28
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.28
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.25
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.24
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.22
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.19
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.19
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.19
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.11
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.09
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.08
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.07
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 99.07
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.04
2crg_A70 Metastasis associated protein MTA3; transcription 99.0
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.99
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.98
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.91
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.86
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.86
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.86
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.85
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.85
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.76
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.71
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.71
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.14
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.66
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.65
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.49
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.29
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.26
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.22
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.97
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.93
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 97.91
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 97.83
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.74
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.92
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.57
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.49
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.4
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 97.2
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.77
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.72
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.27
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.25
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.66
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 95.04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 94.58
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 94.56
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.47
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 93.54
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.47
2crg_A70 Metastasis associated protein MTA3; transcription 93.32
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 92.04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 91.84
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 90.95
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 89.33
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 89.31
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 88.58
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 88.3
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 87.97
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 87.91
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 87.0
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 86.23
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 86.14
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 85.38
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 84.4
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 83.52
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 83.31
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 82.74
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 81.38
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 80.92
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.93  E-value=9.2e-26  Score=146.49  Aligned_cols=66  Identities=20%  Similarity=0.292  Sum_probs=61.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCCchHHHHHHHcCCCCCHHHHHHHHHHHHHhhhhhcCCCCCCcc
Q 048152            5 PKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKL   73 (104)
Q Consensus         5 ~~~~~~WT~eE~k~fE~ALa~~p~~~pdRWekIA~~vpg~KS~~eV~~ryk~L~~dV~~IEsG~v~~~~   73 (104)
                      .+....||.+|+++||+||++||.++|+||++||+++ | ||++||++||+.|++|+ .||+|+||+|.
T Consensus         5 ~~~~~~WT~eE~k~fe~al~~~p~~t~~RW~~IA~~l-g-Rt~~eV~~~y~~L~~d~-~~~~G~vp~P~   70 (72)
T 2cqq_A            5 SSGAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-G-RSVTDVTTKAKQLKDSV-TCSPGMVSGPS   70 (72)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHH-T-SCHHHHHHHHHHHHHSC-CCCSCCCSCSC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCcHHHHHHHHh-C-CCHHHHHHHHHHHHHhc-CccCCCCCCCC
Confidence            3446679999999999999999999999999999998 8 99999999999999997 68999999884



>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 6e-13
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-05
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: DnaJ homolog subfamily C member 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.3 bits (136), Expect = 6e-13
 Identities = 13/57 (22%), Positives = 22/57 (38%), Gaps = 3/57 (5%)

Query: 11 WSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESG 67
          W+ E+      ++       P RWE +A  +G  +S  DV      L + +     G
Sbjct: 4  WTEEDLSQLTRSMVKFPGGTPGRWEKIAHELG--RSVTDVTTKAKQLKDSV-TCSPG 57


>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.9
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.87
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.65
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.15
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.13
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.12
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.0
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.99
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.97
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.9
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.89
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.79
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.74
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 98.65
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.59
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.53
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.2
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.84
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.75
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.86
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 94.29
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 92.93
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 86.0
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 85.66
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 85.23
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 85.05
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 81.51
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.90  E-value=6.2e-24  Score=132.17  Aligned_cols=62  Identities=53%  Similarity=0.877  Sum_probs=60.3

Q ss_pred             CCCCHHHHHHHHHHHhhcCCCCCchHHHHHHHcCCCCCHHHHHHHHHHHHHhhhhhcCCCCCC
Q 048152            9 CGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDH   71 (104)
Q Consensus         9 ~~WT~eE~k~fE~ALa~~p~~~pdRWekIA~~vpg~KS~~eV~~ryk~L~~dV~~IEsG~v~~   71 (104)
                      ++||.+|+++|..|++.|+.+.+++|.+||..||| ||..||+.||+.|++||+.||+|+||+
T Consensus         2 ~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~g-Rt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEG-RTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTT-CCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             cCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCC-CCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            57999999999999999999999999999999999 999999999999999999999999985



>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure