Citrus Sinensis ID: 048152
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| 224130866 | 98 | predicted protein [Populus trichocarpa] | 0.913 | 0.969 | 0.833 | 2e-37 | |
| 224064752 | 103 | predicted protein [Populus trichocarpa] | 0.980 | 0.990 | 0.757 | 6e-37 | |
| 225437799 | 98 | PREDICTED: uncharacterized protein LOC10 | 0.942 | 1.0 | 0.721 | 4e-34 | |
| 356503964 | 108 | PREDICTED: uncharacterized protein LOC10 | 0.951 | 0.916 | 0.717 | 1e-32 | |
| 147818958 | 202 | hypothetical protein VITISV_040171 [Viti | 0.855 | 0.440 | 0.726 | 9e-32 | |
| 351721937 | 97 | uncharacterized protein LOC100500464 [Gl | 0.923 | 0.989 | 0.697 | 5e-31 | |
| 297744097 | 132 | unnamed protein product [Vitis vinifera] | 0.875 | 0.689 | 0.711 | 1e-30 | |
| 357442077 | 93 | hypothetical protein MTR_1g086180 [Medic | 0.894 | 1.0 | 0.688 | 5e-29 | |
| 255548273 | 109 | conserved hypothetical protein [Ricinus | 0.855 | 0.816 | 0.681 | 4e-28 | |
| 357511539 | 114 | DIV3B protein [Medicago truncatula] gi|3 | 0.855 | 0.780 | 0.670 | 5e-27 |
| >gi|224130866|ref|XP_002320944.1| predicted protein [Populus trichocarpa] gi|222861717|gb|EEE99259.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 159 bits (403), Expect = 2e-37, Method: Compositional matrix adjust.
Identities = 80/96 (83%), Positives = 86/96 (89%), Gaps = 1/96 (1%)
Query: 10 GWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKL 69
GWSWEENKLFE+ALAVVDE+DP RW+VVAAMVGG KS EDVQKHYVILLEDLQ IESGKL
Sbjct: 3 GWSWEENKLFEMALAVVDEEDPDRWKVVAAMVGGKKSEEDVQKHYVILLEDLQGIESGKL 62
Query: 70 DHKL-AEFQPSVHVDCTQSVCWTDEDNNLLLQLDIN 104
DHKL E QP V VDCT+SVCWTDED+ LL+QLDIN
Sbjct: 63 DHKLVGEAQPCVQVDCTESVCWTDEDHKLLVQLDIN 98
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224064752|ref|XP_002301546.1| predicted protein [Populus trichocarpa] gi|222843272|gb|EEE80819.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225437799|ref|XP_002281797.1| PREDICTED: uncharacterized protein LOC100250300 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356503964|ref|XP_003520769.1| PREDICTED: uncharacterized protein LOC100800948 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147818958|emb|CAN67130.1| hypothetical protein VITISV_040171 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351721937|ref|NP_001238506.1| uncharacterized protein LOC100500464 [Glycine max] gi|255630389|gb|ACU15551.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297744097|emb|CBI37067.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357442077|ref|XP_003591316.1| hypothetical protein MTR_1g086180 [Medicago truncatula] gi|355480364|gb|AES61567.1| hypothetical protein MTR_1g086180 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255548273|ref|XP_002515193.1| conserved hypothetical protein [Ricinus communis] gi|223545673|gb|EEF47177.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357511539|ref|XP_003626058.1| DIV3B protein [Medicago truncatula] gi|355501073|gb|AES82276.1| DIV3B protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| TAIR|locus:2115260 | 81 | RL3 "RAD-like 3" [Arabidopsis | 0.576 | 0.740 | 0.540 | 1.2e-12 | |
| UNIPROTKB|Q58FS3 | 93 | RAD "Transcription factor RADI | 0.557 | 0.623 | 0.559 | 3.1e-12 | |
| TAIR|locus:2025182 | 97 | RL6 "RAD-like 6" [Arabidopsis | 0.557 | 0.597 | 0.525 | 1e-11 | |
| TAIR|locus:2016417 | 100 | RL5 "RAD-like 5" [Arabidopsis | 0.519 | 0.54 | 0.563 | 4.5e-11 | |
| TAIR|locus:4010713631 | 77 | RL4 "RAD-like 4" [Arabidopsis | 0.548 | 0.740 | 0.5 | 7.4e-11 | |
| TAIR|locus:2136283 | 100 | RL1 "RAD-like 1" [Arabidopsis | 0.538 | 0.56 | 0.473 | 7.4e-11 | |
| TAIR|locus:2074723 | 263 | AT3G11280 [Arabidopsis thalian | 0.557 | 0.220 | 0.491 | 2.9e-10 | |
| UNIPROTKB|Q8S9H7 | 307 | DIVARICATA "Transcription fact | 0.538 | 0.182 | 0.508 | 7.2e-10 | |
| TAIR|locus:2159607 | 298 | AT5G08520 [Arabidopsis thalian | 0.538 | 0.187 | 0.473 | 1.1e-09 | |
| TAIR|locus:2166459 | 277 | AT5G05790 [Arabidopsis thalian | 0.538 | 0.202 | 0.526 | 1.5e-09 |
| TAIR|locus:2115260 RL3 "RAD-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 168 (64.2 bits), Expect = 1.2e-12, P = 1.2e-12
Identities = 33/61 (54%), Positives = 43/61 (70%)
Query: 11 WSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLD 70
W+ +ENKLFE ALA D+ P RW VA VGG KSAE+V++HY +L+ D+ IESG+
Sbjct: 12 WTRKENKLFERALATYDQDTPDRWHNVARAVGG-KSAEEVRRHYELLIRDVNDIESGRYP 70
Query: 71 H 71
H
Sbjct: 71 H 71
|
|
| UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4010713631 RL4 "RAD-like 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0061007202 | hypothetical protein (99 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.28 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.08 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.04 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.89 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 98.86 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.39 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.23 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.87 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.86 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.77 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.69 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.33 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 97.31 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 97.28 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 97.21 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 96.75 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.69 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 96.6 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 96.48 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.91 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 95.8 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 95.63 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 95.48 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 95.32 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 95.11 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 94.78 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 93.01 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 90.43 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 89.77 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 88.45 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 88.4 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 88.26 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 87.14 | |
| smart00595 | 89 | MADF subfamily of SANT domain. | 86.63 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 86.37 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 85.3 | |
| PF10545 | 85 | MADF_DNA_bdg: Alcohol dehydrogenase transcription | 84.85 |
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
Probab=99.28 E-value=1.2e-11 Score=73.76 Aligned_cols=45 Identities=22% Similarity=0.433 Sum_probs=40.6
Q ss_pred CCCCHHHHHHHHHHHhhcCCCCCchHHHHHHHcC-CCCCHHHHHHHHHHH
Q 048152 9 CGWSWEENKLFELALAVVDEQDPHRWEVVAAMVG-GTKSAEDVQKHYVIL 57 (104)
Q Consensus 9 ~~WT~eE~k~fE~ALa~~p~~~pdRWekIA~~vp-g~KS~~eV~~ryk~L 57 (104)
..||.+|+.+|..|+.+|+.+ +|.+||..|| | ||..+|+.||..+
T Consensus 2 ~~Wt~eE~~~l~~~v~~~g~~---~W~~Ia~~~~~~-Rt~~qc~~~~~~~ 47 (48)
T PF00249_consen 2 GPWTEEEDEKLLEAVKKYGKD---NWKKIAKRMPGG-RTAKQCRSRYQNL 47 (48)
T ss_dssp -SS-HHHHHHHHHHHHHSTTT---HHHHHHHHHSSS-STHHHHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHhCCc---HHHHHHHHcCCC-CCHHHHHHHHHhh
Confidence 469999999999999999875 8999999999 7 9999999999876
|
These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B .... |
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00595 MADF subfamily of SANT domain | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 104 | ||||
| 2cjj_A | 93 | Crystal Structure Of The Myb Domain Of The Rad Tran | 1e-12 | ||
| 4eef_G | 74 | Crystal Structure Of The Designed Inhibitor Protein | 8e-05 |
| >pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 | Back alignment and structure |
|
| >pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 104 | |||
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 1e-22 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 1e-18 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 3e-15 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 1e-06 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 3e-06 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 5e-05 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 3e-04 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 4e-04 |
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
Score = 83.0 bits (205), Expect = 1e-22
Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
Query: 1 MEDFPKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLED 60
M WS +ENK FE ALAV D+ P RW VA V G ++ E+V+KHY IL+ED
Sbjct: 1 MASTRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEG-RTPEEVKKHYEILVED 59
Query: 61 LQFIESGK 68
+++IESGK
Sbjct: 60 IKYIESGK 67
|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.93 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.92 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.87 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.86 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.8 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.48 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.43 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.28 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.28 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.25 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.24 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.22 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.19 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.19 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.19 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.11 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.09 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.08 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.07 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 99.07 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.04 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 99.0 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.99 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 98.98 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 98.97 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.91 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 98.86 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.86 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.86 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 98.85 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.85 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.76 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 98.71 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.71 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.14 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.66 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.65 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 98.49 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.29 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.26 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.22 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.97 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 97.93 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 97.91 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 97.83 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.74 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.92 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 97.57 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.49 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 97.4 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 97.2 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 96.77 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.72 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 96.27 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.25 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 95.66 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 95.04 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 94.58 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 94.56 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 94.47 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 93.54 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 93.47 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 93.32 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 92.04 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 91.84 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 90.95 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 89.33 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 89.31 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 88.58 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 88.3 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 87.97 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 87.91 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 87.0 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 86.23 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 86.14 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 85.38 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 84.4 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 83.52 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 83.31 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 82.74 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 81.38 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 80.92 |
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
Probab=99.93 E-value=9.2e-26 Score=146.49 Aligned_cols=66 Identities=20% Similarity=0.292 Sum_probs=61.3
Q ss_pred CCCCCCCCHHHHHHHHHHHhhcCCCCCchHHHHHHHcCCCCCHHHHHHHHHHHHHhhhhhcCCCCCCcc
Q 048152 5 PKVFCGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDHKL 73 (104)
Q Consensus 5 ~~~~~~WT~eE~k~fE~ALa~~p~~~pdRWekIA~~vpg~KS~~eV~~ryk~L~~dV~~IEsG~v~~~~ 73 (104)
.+....||.+|+++||+||++||.++|+||++||+++ | ||++||++||+.|++|+ .||+|+||+|.
T Consensus 5 ~~~~~~WT~eE~k~fe~al~~~p~~t~~RW~~IA~~l-g-Rt~~eV~~~y~~L~~d~-~~~~G~vp~P~ 70 (72)
T 2cqq_A 5 SSGAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-G-RSVTDVTTKAKQLKDSV-TCSPGMVSGPS 70 (72)
T ss_dssp CCCCCCCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHH-T-SCHHHHHHHHHHHHHSC-CCCSCCCSCSC
T ss_pred CCCCCCCCHHHHHHHHHHHHHCCCCCCcHHHHHHHHh-C-CCHHHHHHHHHHHHHhc-CccCCCCCCCC
Confidence 3446679999999999999999999999999999998 8 99999999999999997 68999999884
|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 104 | ||||
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 6e-13 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-11 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 3e-05 |
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: DnaJ homolog subfamily C member 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.3 bits (136), Expect = 6e-13
Identities = 13/57 (22%), Positives = 22/57 (38%), Gaps = 3/57 (5%)
Query: 11 WSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESG 67
W+ E+ ++ P RWE +A +G +S DV L + + G
Sbjct: 4 WTEEDLSQLTRSMVKFPGGTPGRWEKIAHELG--RSVTDVTTKAKQLKDSV-TCSPG 57
|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.9 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.87 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.65 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.15 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.13 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.12 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.0 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.99 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.97 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.9 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.89 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.79 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.74 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 98.65 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 98.59 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 98.53 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.2 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.84 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.75 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 95.86 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 94.29 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 92.93 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 86.0 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 85.66 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 85.23 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 85.05 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 81.51 |
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Radialis species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.90 E-value=6.2e-24 Score=132.17 Aligned_cols=62 Identities=53% Similarity=0.877 Sum_probs=60.3
Q ss_pred CCCCHHHHHHHHHHHhhcCCCCCchHHHHHHHcCCCCCHHHHHHHHHHHHHhhhhhcCCCCCC
Q 048152 9 CGWSWEENKLFELALAVVDEQDPHRWEVVAAMVGGTKSAEDVQKHYVILLEDLQFIESGKLDH 71 (104)
Q Consensus 9 ~~WT~eE~k~fE~ALa~~p~~~pdRWekIA~~vpg~KS~~eV~~ryk~L~~dV~~IEsG~v~~ 71 (104)
++||.+|+++|..|++.|+.+.+++|.+||..||| ||..||+.||+.|++||+.||+|+||+
T Consensus 2 ~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~g-Rt~~qc~~r~~~L~~dik~iesg~vpf 63 (63)
T d2cjja1 2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEG-RTPEEVKKHYEILVEDIKYIESGKVPF 63 (63)
T ss_dssp CSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTT-CCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred cCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCC-CCHHHHHHHHHHHHHHhhccccCCCCC
Confidence 57999999999999999999999999999999999 999999999999999999999999985
|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|