Citrus Sinensis ID: 048235


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQSPAPVVNLTGTPLYSSI
ccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHcccHHHcccccccccccc
ccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccc
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMrslpkkkfktgtlerwdprlepdIVVYNAVLNACVRRKQWEGAFWVLQQLkqqgqkpsattYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLwregktdeAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICkvankplvVSYTGLIQACLDSGNIQNAAYIFNQMknfcspnlvtCNIMVKAYLEHGLFEEAMKLFQEMAEDSNhinreydkkglvipdiYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLAradritppalIKERFCnrlenkdygsaisclvshpvsgspefsRNAWLKFFKENSQHFGQDTLIQLLHEASsslttrngspypvLQNLISSCKDflrtqspapvvnltgtplyssi
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIdsmrslpkkkfktgtlerwdprlepdIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEhlaradritppalIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTqspapvvnltgtplyssi
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQSPAPVVNLTGTPLYSSI
******TVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHE***********PYPVLQNLISSCKDFLRT******************
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQ**********TP*****
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQL********ATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQSPAPVVNLTGTPLYSSI
*SSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQSPAPVVNLTGTPL**S*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQSPAPVVNLTGTPLYSSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query455 2.2.26 [Sep-21-2011]
Q9SA761006 Pentatricopeptide repeat- yes no 0.951 0.430 0.644 1e-180
Q9FJW6798 Pentatricopeptide repeat- no no 0.912 0.520 0.406 3e-90
Q6NQ83619 Pentatricopeptide repeat- no no 0.696 0.512 0.209 3e-24
Q9LPX2644 Pentatricopeptide repeat- no no 0.687 0.486 0.231 1e-23
Q9S7R4482 Pentatricopeptide repeat- no no 0.6 0.566 0.227 4e-23
Q3EDF8598 Pentatricopeptide repeat- no no 0.652 0.496 0.234 5e-23
P0C7Q7602 Putative pentatricopeptid no no 0.602 0.455 0.232 5e-23
Q9SR00602 Pentatricopeptide repeat- no no 0.545 0.411 0.260 1e-22
Q9M302659 Pentatricopeptide repeat- no no 0.663 0.458 0.223 2e-22
Q9ASZ8621 Pentatricopeptide repeat- no no 0.685 0.502 0.242 2e-22
>sp|Q9SA76|PPR64_ARATH Pentatricopeptide repeat-containing protein At1g30610, chloroplastic OS=Arabidopsis thaliana GN=EMB2279 PE=2 SV=1 Back     alignment and function desciption
 Score =  631 bits (1628), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/473 (64%), Positives = 362/473 (76%), Gaps = 40/473 (8%)

Query: 1    MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVY 60
            +SSYPD VAYRSIAVTLGQAGHIKELF VID+MRS PKKKFK  TLE+WDPRLEPD+VVY
Sbjct: 537  ISSYPDMVAYRSIAVTLGQAGHIKELFYVIDTMRSPPKKKFKPTTLEKWDPRLEPDVVVY 596

Query: 61   NAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQK 120
            NAVLNACV+RKQWEGAFWVLQQLKQ+GQKPS  TYGL+MEVMLAC KYNLV+EFFRK+QK
Sbjct: 597  NAVLNACVQRKQWEGAFWVLQQLKQRGQKPSPVTYGLIMEVMLACEKYNLVHEFFRKMQK 656

Query: 121  SYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEA 180
            S IPNALAY+VLVNTLW+EGK+DEAV  VEDME RGIVGSAALYYDLARCLCSAG+C E 
Sbjct: 657  SSIPNALAYRVLVNTLWKEGKSDEAVHTVEDMESRGIVGSAALYYDLARCLCSAGRCNEG 716

Query: 181  L----------------------------MQMDKICKVANKPLVVSYTGLIQACLDSGNI 212
            L                             Q+ KIC+VANKPLVV+YTGLIQAC+DSGNI
Sbjct: 717  LNMVNFVNPVVLKLIENLIYKADLVHTIQFQLKKICRVANKPLVVTYTGLIQACVDSGNI 776

Query: 213  QNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGL 272
            +NAAYIF+QMK  CSPNLVTCNIM+KAYL+ GLFEEA +LFQ+M+ED NHI    D +  
Sbjct: 777  KNAAYIFDQMKKVCSPNLVTCNIMLKAYLQGGLFEEARELFQKMSEDGNHIKNSSDFESR 836

Query: 273  VIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLE 332
            V+PD YTFNTMLD CA +++WDD    Y+ ML HG HFNAKRHLRM+L+ASRAGK E++E
Sbjct: 837  VLPDTYTFNTMLDTCAEQEKWDDFGYAYREMLRHGYHFNAKRHLRMVLEASRAGKEEVME 896

Query: 333  ITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPE------FSRNAW 386
             TWEH+ R++RI P  LIKERF  +LE  D+ SAIS L    ++G  E      FS +AW
Sbjct: 897  ATWEHMRRSNRIPPSPLIKERFFRKLEKGDHISAISSLAD--LNGKIEETELRAFSTSAW 954

Query: 387  LKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQS 439
             +        F QD++++L+ + +  L +R+ S   VL NL+SSCKD+L+T++
Sbjct: 955  SRVL----SRFEQDSVLRLMDDVNRRLGSRSESSDSVLGNLLSSCKDYLKTRT 1003




May play a role in embryogenesis.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJW6|PP451_ARATH Pentatricopeptide repeat-containing protein At5g67570, chloroplastic OS=Arabidopsis thaliana GN=DG1 PE=1 SV=2 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 Back     alignment and function description
>sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 Back     alignment and function description
>sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query455
255586263 856 pentatricopeptide repeat-containing prot 0.953 0.507 0.748 0.0
356541058 893 PREDICTED: pentatricopeptide repeat-cont 0.953 0.486 0.698 0.0
225444167 846 PREDICTED: pentatricopeptide repeat-cont 0.958 0.515 0.735 0.0
297740901 647 unnamed protein product [Vitis vinifera] 0.958 0.673 0.735 0.0
224061585 642 predicted protein [Populus trichocarpa] 0.978 0.693 0.668 0.0
334182963 978 pentatricopeptide repeat-containing prot 0.951 0.442 0.683 0.0
297846000 913 EMB2279 [Arabidopsis lyrata subsp. lyrat 0.960 0.478 0.668 0.0
147821457 1032 hypothetical protein VITISV_035448 [Viti 0.958 0.422 0.677 1e-180
449435940 902 PREDICTED: pentatricopeptide repeat-cont 0.956 0.482 0.687 1e-179
449530674477 PREDICTED: pentatricopeptide repeat-cont 0.956 0.911 0.687 1e-178
>gi|255586263|ref|XP_002533784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526285|gb|EEF28597.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/438 (74%), Positives = 370/438 (84%), Gaps = 4/438 (0%)

Query: 1   MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVY 60
           MSSYPD VAY  IAVTLGQAGH+++LFDVIDSMRS PKKKFK   + +WDPRLEPDIVVY
Sbjct: 400 MSSYPDLVAYHCIAVTLGQAGHMEQLFDVIDSMRSPPKKKFKMAAVHKWDPRLEPDIVVY 459

Query: 61  NAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQK 120
           NAVLNACV+RKQWEGAFWVLQQLKQQG +PS TTYGL+MEVM ACGKYNLV+EFFRKVQK
Sbjct: 460 NAVLNACVQRKQWEGAFWVLQQLKQQGLQPSTTTYGLIMEVMFACGKYNLVHEFFRKVQK 519

Query: 121 SYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEA 180
           S IPNAL YKVLVNTLWREGKTDEAV AVE+MERRGIVG AALYYDLARCLCSAG+C+EA
Sbjct: 520 SSIPNALVYKVLVNTLWREGKTDEAVLAVEEMERRGIVGFAALYYDLARCLCSAGRCQEA 579

Query: 181 LMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAY 240
           L+Q++KIC+VANKPLVV+YTGLIQACLDSGNI NA YIFNQMK+FCSPNLVT N+M+KAY
Sbjct: 580 LLQIEKICRVANKPLVVTYTGLIQACLDSGNIHNAVYIFNQMKHFCSPNLVTFNVMLKAY 639

Query: 241 LEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVY 300
            EHGLFE+A +LF +M EDSNHI   +D K  VIPDIYTFNTMLDAC +EK WDD E VY
Sbjct: 640 FEHGLFEDAKELFHKMTEDSNHIRGNHDYKVRVIPDIYTFNTMLDACISEKSWDDFEYVY 699

Query: 301 KRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLEN 360
           +RMLHHG HFN KRHLRMILDASRAGKVE LE+TW+HLARADRI PP LIKERF   LE 
Sbjct: 700 RRMLHHGFHFNGKRHLRMILDASRAGKVEPLEMTWKHLARADRIPPPNLIKERFRIMLEK 759

Query: 361 KDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASSSLTTRNGSP 420
            D  SA++C+ ++P+  SP F + AWL  FKEN++   +DTLIQL HE S  +      P
Sbjct: 760 DDCKSALACITTNPMGESPAFHKVAWLNLFKENAEQIRRDTLIQLKHEVSMLVN----PP 815

Query: 421 YPVLQNLISSCKDFLRTQ 438
            PVLQNL++SC DFL +Q
Sbjct: 816 DPVLQNLLASCNDFLNSQ 833




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356541058|ref|XP_003539000.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225444167|ref|XP_002268516.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740901|emb|CBI31083.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061585|ref|XP_002300553.1| predicted protein [Populus trichocarpa] gi|222847811|gb|EEE85358.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334182963|ref|NP_001185117.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332193129|gb|AEE31250.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297846000|ref|XP_002890881.1| EMB2279 [Arabidopsis lyrata subsp. lyrata] gi|297336723|gb|EFH67140.1| EMB2279 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147821457|emb|CAN72260.1| hypothetical protein VITISV_035448 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449435940|ref|XP_004135752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449530674|ref|XP_004172319.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query455
TAIR|locus:22046291006 EMB2279 "EMBRYO DEFECTIVE 2279 0.540 0.244 0.65 9.1e-84
TAIR|locus:1009023134644 AT1G12775 [Arabidopsis thalian 0.685 0.484 0.236 1.7e-20
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.694 0.510 0.220 2e-20
TAIR|locus:2084978602 AT3G04760 [Arabidopsis thalian 0.630 0.476 0.249 2.5e-20
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.615 0.444 0.223 3.6e-20
TAIR|locus:2015218590 AT1G63070 [Arabidopsis thalian 0.668 0.515 0.229 5.3e-20
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.613 0.454 0.229 5.8e-20
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.635 0.458 0.219 1e-19
TAIR|locus:2195047621 AT1G12620 [Arabidopsis thalian 0.683 0.500 0.247 2.9e-19
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.690 0.492 0.233 3e-19
TAIR|locus:2204629 EMB2279 "EMBRYO DEFECTIVE 2279" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 839 (300.4 bits), Expect = 9.1e-84, P = 9.1e-84
 Identities = 169/260 (65%), Positives = 202/260 (77%)

Query:     1 MSSYPDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVY 60
             +SSYPD VAYRSIAVTLGQAGHIKELF VID+MRS PKKKFK  TLE+WDPRLEPD+VVY
Sbjct:   537 ISSYPDMVAYRSIAVTLGQAGHIKELFYVIDTMRSPPKKKFKPTTLEKWDPRLEPDVVVY 596

Query:    61 NAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQK 120
             NAVLNACV+RKQWEGAFWVLQQLKQ+GQKPS  TYGL+MEVMLAC KYNLV+EFFRK+QK
Sbjct:   597 NAVLNACVQRKQWEGAFWVLQQLKQRGQKPSPVTYGLIMEVMLACEKYNLVHEFFRKMQK 656

Query:   121 SYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCEEA 180
             S IPNALAY+VLVNTLW+EGK+DEAV  VEDME RGIVGSAALYYDLARCLCSAG+C E 
Sbjct:   657 SSIPNALAYRVLVNTLWKEGKSDEAVHTVEDMESRGIVGSAALYYDLARCLCSAGRCNEG 716

Query:   181 LMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFC----SPNLVTCNIM 236
             L  ++ +      P+V+    LI+  +   ++ +      Q+K  C     P +VT   +
Sbjct:   717 LNMVNFV-----NPVVLK---LIENLIYKADLVHTIQF--QLKKICRVANKPLVVTYTGL 766

Query:   237 VKAYLEHGLFEEAMKLFQEM 256
             ++A ++ G  + A  +F +M
Sbjct:   767 IQACVDSGNIKNAAYIFDQM 786


GO:0009507 "chloroplast" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS;TAS
GO:0010098 "suspensor development" evidence=IMP
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084978 AT3G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015218 AT1G63070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195047 AT1G12620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-06
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 81.5 bits (201), Expect = 3e-16
 Identities = 56/263 (21%), Positives = 108/263 (41%), Gaps = 25/263 (9%)

Query: 5   PDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVL 64
           PD V + ++    GQ+G +   FDV+  M++                 ++PD +   A++
Sbjct: 540 PDRVVFNALISACGQSGAVDRAFDVLAEMKAETHP-------------IDPDHITVGALM 586

Query: 65  NACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYN------LVYEFFRKV 118
            AC    Q + A  V Q + +   K +   Y + +    +C +         +Y+  +K 
Sbjct: 587 KACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVN---SCSQKGDWDFALSIYDDMKK- 642

Query: 119 QKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSAGKCE 178
            K   P+ + +  LV+     G  D+A   ++D  ++GI      Y  L     +A   +
Sbjct: 643 -KGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWK 701

Query: 179 EALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNF-CSPNLVTCNIMV 237
           +AL   + I  +  +P V +   LI A  +   +  A  + ++MK     PN +T +I++
Sbjct: 702 KALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILL 761

Query: 238 KAYLEHGLFEEAMKLFQEMAEDS 260
            A       +  + L  +  ED 
Sbjct: 762 VASERKDDADVGLDLLSQAKEDG 784


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 455
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.76
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.72
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.71
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.68
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.68
KOG2076 895 consensus RNA polymerase III transcription factor 99.68
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.65
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.65
KOG1126638 consensus DNA-binding cell division cycle control 99.65
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.64
KOG2076 895 consensus RNA polymerase III transcription factor 99.64
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.61
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.57
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.56
KOG1126638 consensus DNA-binding cell division cycle control 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
KOG1915677 consensus Cell cycle control protein (crooked neck 99.52
PRK12370553 invasion protein regulator; Provisional 99.52
KOG0547606 consensus Translocase of outer mitochondrial membr 99.51
KOG2003 840 consensus TPR repeat-containing protein [General f 99.51
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.49
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.48
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.47
PRK12370553 invasion protein regulator; Provisional 99.47
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.46
KOG2003 840 consensus TPR repeat-containing protein [General f 99.46
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.46
KOG1129478 consensus TPR repeat-containing protein [General f 99.45
KOG1129478 consensus TPR repeat-containing protein [General f 99.42
PF1304150 PPR_2: PPR repeat family 99.41
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.39
KOG1915677 consensus Cell cycle control protein (crooked neck 99.38
KOG0547606 consensus Translocase of outer mitochondrial membr 99.37
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.36
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
PF1304150 PPR_2: PPR repeat family 99.3
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.3
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.28
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.28
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.27
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.27
PRK11189296 lipoprotein NlpI; Provisional 99.25
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.22
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.22
PRK11189296 lipoprotein NlpI; Provisional 99.22
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.18
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.17
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.15
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.14
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.12
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.09
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.08
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.04
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.02
KOG1125579 consensus TPR repeat-containing protein [General f 99.02
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.0
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.98
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.97
KOG2376652 consensus Signal recognition particle, subunit Srp 98.95
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.94
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.93
KOG1125579 consensus TPR repeat-containing protein [General f 98.93
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.93
PF1285434 PPR_1: PPR repeat 98.92
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.89
PLN02789320 farnesyltranstransferase 98.88
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.86
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.85
PLN02789320 farnesyltranstransferase 98.84
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.82
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.82
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.81
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.8
PRK04841903 transcriptional regulator MalT; Provisional 98.75
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.74
KOG1128777 consensus Uncharacterized conserved protein, conta 98.74
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.74
PF1285434 PPR_1: PPR repeat 98.72
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.71
PRK04841903 transcriptional regulator MalT; Provisional 98.71
KOG1128777 consensus Uncharacterized conserved protein, conta 98.7
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.69
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.68
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.68
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.68
PRK10370198 formate-dependent nitrite reductase complex subuni 98.68
PRK10370198 formate-dependent nitrite reductase complex subuni 98.66
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.65
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.63
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.59
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.58
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.57
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
PRK15359144 type III secretion system chaperone protein SscB; 98.49
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.49
PRK15359144 type III secretion system chaperone protein SscB; 98.46
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.43
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.43
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.4
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.39
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.36
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.32
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.31
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.27
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.26
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.18
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.16
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.16
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.14
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.14
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.11
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.1
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.02
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.01
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.99
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.97
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.95
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.95
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.93
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.91
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.88
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.85
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.83
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.81
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.8
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.8
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.79
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.79
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.79
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.79
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.77
COG3898531 Uncharacterized membrane-bound protein [Function u 97.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.75
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.74
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.73
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.71
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.7
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.67
KOG0553304 consensus TPR repeat-containing protein [General f 97.63
PF12688120 TPR_5: Tetratrico peptide repeat 97.62
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.61
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.55
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.53
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.51
KOG0553304 consensus TPR repeat-containing protein [General f 97.48
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.45
PF12688120 TPR_5: Tetratrico peptide repeat 97.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.36
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.34
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.33
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.33
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.29
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.29
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.28
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.28
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.27
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.27
PF1343134 TPR_17: Tetratricopeptide repeat 97.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.25
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.23
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.21
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.21
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.18
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.16
PRK10803263 tol-pal system protein YbgF; Provisional 97.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.13
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.13
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.12
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.1
COG4700251 Uncharacterized protein conserved in bacteria cont 97.06
KOG20411189 consensus WD40 repeat protein [General function pr 97.01
PRK10803263 tol-pal system protein YbgF; Provisional 96.97
COG4700251 Uncharacterized protein conserved in bacteria cont 96.96
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.91
PF1337173 TPR_9: Tetratricopeptide repeat 96.91
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.83
KOG1258577 consensus mRNA processing protein [RNA processing 96.79
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.78
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.76
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.7
PRK15331165 chaperone protein SicA; Provisional 96.65
PF1337173 TPR_9: Tetratricopeptide repeat 96.63
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.51
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.44
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.42
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.4
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.38
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.37
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.35
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.33
PRK11906458 transcriptional regulator; Provisional 96.32
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.17
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.17
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.16
PRK15331165 chaperone protein SicA; Provisional 96.1
COG3898531 Uncharacterized membrane-bound protein [Function u 96.09
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.9
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.82
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.8
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.78
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 95.76
PF13512142 TPR_18: Tetratricopeptide repeat 95.73
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.71
smart00299140 CLH Clathrin heavy chain repeat homology. 95.69
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.66
KOG3941406 consensus Intermediate in Toll signal transduction 95.65
KOG4555175 consensus TPR repeat-containing protein [Function 95.64
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.53
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.5
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.4
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.31
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.29
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.29
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.27
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.24
KOG1585308 consensus Protein required for fusion of vesicles 95.15
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.12
KOG1585308 consensus Protein required for fusion of vesicles 95.12
KOG3941 406 consensus Intermediate in Toll signal transduction 95.09
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.07
KOG4555175 consensus TPR repeat-containing protein [Function 95.04
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.01
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.99
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.78
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.78
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.77
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.71
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.7
COG3629280 DnrI DNA-binding transcriptional activator of the 94.64
PF1342844 TPR_14: Tetratricopeptide repeat 94.62
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.55
smart00299140 CLH Clathrin heavy chain repeat homology. 94.44
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.44
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.44
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.42
PF1342844 TPR_14: Tetratricopeptide repeat 94.26
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.25
PF13512142 TPR_18: Tetratricopeptide repeat 94.03
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.87
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.82
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.8
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.43
COG1747 711 Uncharacterized N-terminal domain of the transcrip 93.28
COG3629280 DnrI DNA-binding transcriptional activator of the 93.27
KOG1941518 consensus Acetylcholine receptor-associated protei 93.2
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 93.19
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.88
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.75
COG4455273 ImpE Protein of avirulence locus involved in tempe 92.63
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 92.52
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.5
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.38
PF1343134 TPR_17: Tetratricopeptide repeat 92.07
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.07
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.94
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.93
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.72
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.71
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.6
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.53
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.37
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.75
PRK11906458 transcriptional regulator; Provisional 90.33
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.28
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.63
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.34
KOG1550552 consensus Extracellular protein SEL-1 and related 89.24
KOG1586288 consensus Protein required for fusion of vesicles 89.14
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.35
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.35
KOG4570418 consensus Uncharacterized conserved protein [Funct 87.9
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 87.45
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 86.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.43
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.42
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.31
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.1
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 85.82
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.68
KOG1258577 consensus mRNA processing protein [RNA processing 85.46
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.15
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 84.2
COG4455273 ImpE Protein of avirulence locus involved in tempe 84.19
COG5159421 RPN6 26S proteasome regulatory complex component [ 84.1
PRK09687280 putative lyase; Provisional 84.0
PF13929292 mRNA_stabil: mRNA stabilisation 83.77
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.69
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.53
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.25
PF13929292 mRNA_stabil: mRNA stabilisation 83.2
COG3947361 Response regulator containing CheY-like receiver a 81.55
KOG4234271 consensus TPR repeat-containing protein [General f 81.48
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.23
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 80.79
COG3947361 Response regulator containing CheY-like receiver a 80.05
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-61  Score=494.13  Aligned_cols=422  Identities=15%  Similarity=0.186  Sum_probs=355.7

Q ss_pred             CCHhhHHHHHHHHHhcCChhHHHHHHHHhhcCCccccccccccccCCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHH
Q 048235            5 PDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLK   84 (455)
Q Consensus         5 p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~   84 (455)
                      ||..+||++|.+|++.|++++|+++|++|..               .+..||..+|+.+|.+|++.|+++.|.+++..|.
T Consensus       251 ~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~---------------~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~  315 (857)
T PLN03077        251 RDCISWNAMISGYFENGECLEGLELFFTMRE---------------LSVDPDLMTITSVISACELLGDERLGREMHGYVV  315 (857)
T ss_pred             CCcchhHHHHHHHHhCCCHHHHHHHHHHHHH---------------cCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHH
Confidence            4444444444444444444444444444443               5677788888888888888888888888888888


Q ss_pred             HcCCCCCHhhHHHHHHHHHHcCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHH
Q 048235           85 QQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALY  164 (455)
Q Consensus        85 ~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~  164 (455)
                      +.|+.||..+|++++.+|+++|+++.|.++|++|..   +|..+|+++|.+|++.|++++|+++|++|.+.|+.||..||
T Consensus       316 ~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~---~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~  392 (857)
T PLN03077        316 KTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMET---KDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITI  392 (857)
T ss_pred             HhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCC---CCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeH
Confidence            888888888888888888888888888888888864   68889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcC
Q 048235          165 YDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHG  244 (455)
Q Consensus       165 ~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~~  244 (455)
                      +.++.+|++.|+++.|.++++.|.+.|+.|+..+|+.|+.+|++.|++++|.++|++|.+   +|..+|+.+|.+|++.|
T Consensus       393 ~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~---~d~vs~~~mi~~~~~~g  469 (857)
T PLN03077        393 ASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPE---KDVISWTSIIAGLRLNN  469 (857)
T ss_pred             HHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCC---CCeeeHHHHHHHHHHCC
Confidence            999999999999999999999999999999999999999999999999999999999875   78889999999999999


Q ss_pred             ChhHHHHHHHHHHhcccccchh------------------------------------------------------hccC
Q 048235          245 LFEEAMKLFQEMAEDSNHINRE------------------------------------------------------YDKK  270 (455)
Q Consensus       245 ~~~~a~~~~~~m~~~~~~~~~~------------------------------------------------------~~~~  270 (455)
                      +.++|..+|++|.. +..|+..                                                      ..+ 
T Consensus       470 ~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f-  547 (857)
T PLN03077        470 RCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQF-  547 (857)
T ss_pred             CHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHH-
Confidence            99999999999875 3444430                                                      001 


Q ss_pred             CCCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhcCCCCChHh-
Q 048235          271 GLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRMILDASRAGKVELLEITWEHLARADRITPPAL-  349 (455)
Q Consensus       271 ~~~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~-  349 (455)
                      ....||..+|+++|.+|++.|+.++|.++|++|.+.|+.||..||+.++.+|.+.|++++|.++|+.|.+..+..|+.. 
T Consensus       548 ~~~~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~  627 (857)
T PLN03077        548 NSHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKH  627 (857)
T ss_pred             HhcCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHH
Confidence            1127899999999999999999999999999999999999999999999999999999999999999997666666643 


Q ss_pred             HHHHHHHHhhccchHHHHHHhhhcCCCCCccccHHHHHHHHhhhcccCCcc-hHHHHHHHhccccccccCCCchhHHHHH
Q 048235          350 IKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQD-TLIQLLHEASSSLTTRNGSPYPVLQNLI  428 (455)
Q Consensus       350 ~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~p~~~~~~~~l~~~~  428 (455)
                      +..++..+.+.|++++|.+++++|+..|+.    .+|..|+.  +|+.+++ +.++.+.+.+.+++|+++..|..|+++|
T Consensus       628 y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~----~~~~aLl~--ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~y  701 (857)
T PLN03077        628 YACVVDLLGRAGKLTEAYNFINKMPITPDP----AVWGALLN--ACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLY  701 (857)
T ss_pred             HHHHHHHHHhCCCHHHHHHHHHHCCCCCCH----HHHHHHHH--HHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHH
Confidence            333334445999999999999999977754    99999999  5777777 8888899999999999999999999999


Q ss_pred             HhHHhhhhccCC---cccccCCCCcccCCC
Q 048235          429 SSCKDFLRTQSP---APVVNLTGTPLYSSI  455 (455)
Q Consensus       429 ~~~~~~~~a~~~---~~~~~~~~~~~~~~~  455 (455)
                      +..|+|++|..+   |++.+++|+||+|||
T Consensus       702 a~~g~~~~a~~vr~~M~~~g~~k~~g~s~i  731 (857)
T PLN03077        702 ADAGKWDEVARVRKTMRENGLTVDPGCSWV  731 (857)
T ss_pred             HHCCChHHHHHHHHHHHHcCCCCCCCccEE
Confidence            999999988877   789999999999997



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 78.4 bits (192), Expect = 2e-15
 Identities = 75/490 (15%), Positives = 139/490 (28%), Gaps = 140/490 (28%)

Query: 34  RSLPKKKFKTGTLERWDPRLEPDIVVY------------NAVLNACVRRKQWEGAFWV-- 79
           R  P  K +   L    P    ++++             +  L+  V+ K     FW+  
Sbjct: 133 RLQPYLKLRQA-LLELRP--AKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNL 189

Query: 80  ------------LQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEFFRK--VQKSYIPN 125
                       LQ+L  Q      +       + L   + + +    R+    K Y  N
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKL---RIHSIQAELRRLLKSKPY-EN 245

Query: 126 AL-------------AY----KVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYD-- 166
            L             A+    K+L+ T  R  +  + +SA           S  L  D  
Sbjct: 246 CLLVLLNVQNAKAWNAFNLSCKILLTT--RFKQVTDFLSAATTTHISLDHHSMTLTPDEV 303

Query: 167 ---LARCL-CSAGKC-EEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQ 221
              L + L C       E              P  +S   +I   +  G           
Sbjct: 304 KSLLLKYLDCRPQDLPREV-------LTTN--PRRLS---IIAESIRDGL--------AT 343

Query: 222 MKNFCSPNLVTCNIMVKAYLEHGLFEEAMKLFQEMA--EDSNHINRE------YDKKGLV 273
             N+   N      ++++ L      E  K+F  ++    S HI         +D     
Sbjct: 344 WDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSD 403

Query: 274 IPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHL-------RMILDASRAG 326
           +  +   N +      EK+  +  +         ++   K  L       R I+D     
Sbjct: 404 VMVV--VNKLHKYSLVEKQPKESTISI-----PSIYLELKVKLENEYALHRSIVDHYNIP 456

Query: 327 KV----ELLEITWE---------HLARADRITPPALIKERFCN-R-LENK--DYGSAISC 369
           K     +L+    +         HL   +      L +  F + R LE K     +A + 
Sbjct: 457 KTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNA 516

Query: 370 LVSHPVSGSPEFSR-NAWLKFFKENSQHFGQ--DTLIQLLHEASSSLTTRNGSPYPVLQN 426
                 S      +   +  +  +N   + +  + ++  L +   +L             
Sbjct: 517 ----SGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENL------------- 559

Query: 427 LISSCKDFLR 436
           + S   D LR
Sbjct: 560 ICSKYTDLLR 569


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query455
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.85
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.84
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.82
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.76
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.75
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.73
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.72
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.72
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.7
3u4t_A272 TPR repeat-containing protein; structural genomics 99.7
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.69
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.69
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.69
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.69
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.68
3u4t_A272 TPR repeat-containing protein; structural genomics 99.68
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.68
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.67
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.64
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.63
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.62
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.62
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.61
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.61
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.59
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.59
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.58
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.54
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.53
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.53
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.5
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.48
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.46
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.45
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.43
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.36
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.36
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.36
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.33
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.31
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.31
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.3
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.29
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.2
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.18
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.18
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.17
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.12
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.1
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.1
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.05
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.04
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.04
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.03
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.01
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.0
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.99
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.97
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.95
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.89
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.86
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.83
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.82
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.77
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.77
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.76
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.76
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.74
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.74
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.72
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.71
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.71
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.7
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.7
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.69
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.67
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.67
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.66
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.66
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.65
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.64
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.64
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.64
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.63
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.57
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.55
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.53
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.52
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.5
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.47
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.46
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.45
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.44
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.43
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.42
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.42
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.42
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.35
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.35
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.32
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.24
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.18
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.17
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.16
3k9i_A117 BH0479 protein; putative protein binding protein, 98.14
3k9i_A117 BH0479 protein; putative protein binding protein, 98.12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.09
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.99
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.98
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.98
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.96
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.95
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.84
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.78
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.77
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.76
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.76
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.74
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.72
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.72
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.68
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.6
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.52
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.5
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.26
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.21
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.83
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.79
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.77
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.76
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.72
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.68
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.64
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.58
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.38
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.35
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.27
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.24
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.18
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.14
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.07
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.03
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.95
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.94
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.91
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.35
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.22
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.44
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 94.24
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.02
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.92
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.87
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.74
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.38
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.2
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.72
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.46
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.33
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.27
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.21
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.01
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.62
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 91.61
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.05
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 90.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.68
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 88.51
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 87.11
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.1
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 85.4
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 83.77
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 83.18
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 83.02
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 82.18
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.09
2p58_C116 Putative type III secretion protein YSCG; type III 82.0
3eiq_C358 Programmed cell death protein 4; PDCD4, anti-oncog 81.58
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.2e-35  Score=290.49  Aligned_cols=402  Identities=12%  Similarity=-0.019  Sum_probs=317.4

Q ss_pred             CCHhhHHHHHHHHHhcCChhHHHHHHHHhhcCCccccccccccccCCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHH
Q 048235            5 PDTVAYRSIAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLK   84 (455)
Q Consensus         5 p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~   84 (455)
                      |++..|+.++..|.+.|++++|+.+|+++...                 .|+..++..++.+|.+.|++++|..+|+++.
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~-----------------~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  144 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDI-----------------TGNPNDAFWLAQVYCCTGDYARAKCLLTKED  144 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH-----------------HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhh-----------------CCCchHHHHHHHHHHHcCcHHHHHHHHHHHh
Confidence            67788999999999999999999999999742                 4566677777777777777777777777664


Q ss_pred             HcCCCCCHhhHHHHHHHHHHcCChhHHHHHHHHHHhcC----------------CCCHHHHHHHHHHHHhcCChHHHHHH
Q 048235           85 QQGQKPSATTYGLVMEVMLACGKYNLVYEFFRKVQKSY----------------IPNALAYKVLVNTLWREGKTDEAVSA  148 (455)
Q Consensus        85 ~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~----------------~~~~~~~~~li~~~~~~g~~~~a~~~  148 (455)
                      ..  +++..+++.++.+|.+.|++++|.++|+++....                +.+..+|+.++.+|.+.|++++|.++
T Consensus       145 ~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~  222 (597)
T 2xpi_A          145 LY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKEC  222 (597)
T ss_dssp             GG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             cc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHH
Confidence            32  4566677777777777777777777776432221                12456677777777777777777777


Q ss_pred             HHHHHHCCC----------------------------------------------------------------------C
Q 048235          149 VEDMERRGI----------------------------------------------------------------------V  158 (455)
Q Consensus       149 ~~~m~~~~~----------------------------------------------------------------------~  158 (455)
                      |++|.+.+.                                                                      +
T Consensus       223 ~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~  302 (597)
T 2xpi_A          223 YKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLE  302 (597)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGG
T ss_pred             HHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCC
Confidence            776654321                                                                      2


Q ss_pred             CCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCHHHHHHHHH
Q 048235          159 GSAALYYDLARCLCSAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVK  238 (455)
Q Consensus       159 ~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~li~  238 (455)
                      ++..+++.++..|.+.|++++|..+|+++.+.+.. +..+++.++.+|.+.|++++|..+|+++....+.+..+|+.++.
T Consensus       303 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~  381 (597)
T 2xpi_A          303 KSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGI  381 (597)
T ss_dssp             GCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHH
Confidence            56777888888889999999999999998877643 67788888999999999999999999888767788999999999


Q ss_pred             HHHhcCChhHHHHHHHHHHhcccccchhhccCCCCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHH
Q 048235          239 AYLEHGLFEEAMKLFQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFNAKRHLRM  318 (455)
Q Consensus       239 ~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~~~~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l  318 (455)
                      .|.+.|++++|.++|+++.+..             +.+..+|+.++.+|.+.|++++|.++|+++.+.+. .+..++..+
T Consensus       382 ~~~~~g~~~~A~~~~~~~~~~~-------------~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l  447 (597)
T 2xpi_A          382 YYLCVNKISEARRYFSKSSTMD-------------PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQ-GTHLPYLFL  447 (597)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHC-------------TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTT-TCSHHHHHH
T ss_pred             HHHHhccHHHHHHHHHHHHHhC-------------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-cchHHHHHH
Confidence            9999999999999999998854             23688999999999999999999999999998542 367789999


Q ss_pred             HHHHHhcCChHHHHHHHHHHhhcCCCCChHhHHHHHHHHhhccchHHHHHHhhhcCCC----C-CccccHHHHHHHHhhh
Q 048235          319 ILDASRAGKVELLEITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVS----G-SPEFSRNAWLKFFKEN  393 (455)
Q Consensus       319 l~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~----~-~~~~~~~~~~~l~~~~  393 (455)
                      ...|.+.|++++|.++|+++.+..+..+. .+..+...+.+.|++++|+++++++...    + .+......|..+...+
T Consensus       448 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~-~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~  526 (597)
T 2xpi_A          448 GMQHMQLGNILLANEYLQSSYALFQYDPL-LLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAY  526 (597)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHCCCCHH-HHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCChH-HHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHH
Confidence            99999999999999999999988766443 3444555556999999999999977432    1 1111147899999987


Q ss_pred             cccCCcchHHHHHHHhccccccccCCCchhHHHHHHhHHhhhhccCCcc
Q 048235          394 SQHFGQDTLIQLLHEASSSLTTRNGSPYPVLQNLISSCKDFLRTQSPAP  442 (455)
Q Consensus       394 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~  442 (455)
                      ...++.+++.+.+.+.+. .+|+++.++..++.+|...|+|++|....+
T Consensus       527 ~~~g~~~~A~~~~~~~~~-~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~  574 (597)
T 2xpi_A          527 RKLKMYDAAIDALNQGLL-LSTNDANVHTAIALVYLHKKIPGLAITHLH  574 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHH-HSSCCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHhcCHHHHHHHHHHHHH-hCCCChHHHHHHHHHHHHhCCHHHHHHHHH
Confidence            788888788887777666 889999999999999999999999887754



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 455
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 50.1 bits (118), Expect = 3e-07
 Identities = 26/201 (12%), Positives = 58/201 (28%), Gaps = 2/201 (0%)

Query: 55  PDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSATTYGLVMEVMLACGKYNLVYEF 114
           P+  V  + L      +          +            Y  +  V+     ++     
Sbjct: 166 PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA 225

Query: 115 FRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLCSA 174
           + +       +A+ +  L    + +G  D A+                 Y +LA  L   
Sbjct: 226 YLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-HFPDAYCNLANALKEK 284

Query: 175 GKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCN 234
           G   EA    +   ++           L     + GNI+ A  ++ +            +
Sbjct: 285 GSVAEAEDCYNTALRLCPTHADSLNN-LANIKREQGNIEEAVRLYRKALEVFPEFAAAHS 343

Query: 235 IMVKAYLEHGLFEEAMKLFQE 255
            +     + G  +EA+  ++E
Sbjct: 344 NLASVLQQQGKLQEALMHYKE 364


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query455
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.66
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.38
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.38
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.33
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.31
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.27
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.2
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.19
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.18
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.17
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.72
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.53
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.47
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.38
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.37
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.31
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.23
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.19
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.13
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.04
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.02
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.0
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.96
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.93
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.91
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.88
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.86
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.75
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.7
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.68
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.67
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.57
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.57
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.15
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.1
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.82
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.77
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.89
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.45
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.3
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.9
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.76
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.13
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.56
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.73
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=1.9e-23  Score=191.81  Aligned_cols=383  Identities=14%  Similarity=0.040  Sum_probs=317.9

Q ss_pred             HHHHHHhcCChhHHHHHHHHhhcCCccccccccccccCCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCH
Q 048235           13 IAVTLGQAGHIKELFDVIDSMRSLPKKKFKTGTLERWDPRLEPDIVVYNAVLNACVRRKQWEGAFWVLQQLKQQGQKPSA   92 (455)
Q Consensus        13 li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~   92 (455)
                      +...+.+.|++++|++.|+++.+.                .+-+..++..+...|.+.|++++|...|++..+..+. +.
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~----------------~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~   67 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQ----------------EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LA   67 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHH----------------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHh----------------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CH
Confidence            345677899999999999999852                2456889999999999999999999999999987544 67


Q ss_pred             hhHHHHHHHHHHcCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q 048235           93 TTYGLVMEVMLACGKYNLVYEFFRKVQKSYIPNALAYKVLVNTLWREGKTDEAVSAVEDMERRGIVGSAALYYDLARCLC  172 (455)
Q Consensus        93 ~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~l~~~~~  172 (455)
                      .++..+..++.+.|++++|...+.......+.+...+..........+....+.............. ............
T Consensus        68 ~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  146 (388)
T d1w3ba_          68 EAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL-YCVRSDLGNLLK  146 (388)
T ss_dssp             HHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC-THHHHHHHHHHH
T ss_pred             HHHHHHHHHhhhhcccccccccccccccccccccccccccccccccccccccccccccccccccccc-cccccccccccc
Confidence            8899999999999999999999999998888788888888888888888888887777766665333 334455666677


Q ss_pred             hcCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcCChhHHHHH
Q 048235          173 SAGKCEEALMQMDKICKVANKPLVVSYTGLIQACLDSGNIQNAAYIFNQMKNFCSPNLVTCNIMVKAYLEHGLFEEAMKL  252 (455)
Q Consensus       173 ~~g~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~  252 (455)
                      ..+....+...+......... +...+..+...+...|+++.|...++...+..+.+...|..+...+...|++++|...
T Consensus       147 ~~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~  225 (388)
T d1w3ba_         147 ALGRLEEAKACYLKAIETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA  225 (388)
T ss_dssp             TTSCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHH
T ss_pred             ccchhhhhHHHHHHhhccCcc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHH
Confidence            888999999888888776533 6778888999999999999999999999877777889999999999999999999999


Q ss_pred             HHHHHhcccccchhhccCCCCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCC-HHHHHHHHHHHHhcCChHHH
Q 048235          253 FQEMAEDSNHINREYDKKGLVIPDIYTFNTMLDACAAEKRWDDLELVYKRMLHHGLHFN-AKRHLRMILDASRAGKVELL  331 (455)
Q Consensus       253 ~~~m~~~~~~~~~~~~~~~~~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~-~~~~~~ll~~~~~~g~~~~a  331 (455)
                      +++....+             ..+...+..+...+.+.|++++|...|+++.+.  .|+ ..++..+...+...|++++|
T Consensus       226 ~~~~~~~~-------------~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A  290 (388)
T d1w3ba_         226 YLRALSLS-------------PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEA  290 (388)
T ss_dssp             HHHHHHHC-------------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHH
T ss_pred             HHHhHHHh-------------hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHH
Confidence            99998864             346778888999999999999999999999984  343 56788888899999999999


Q ss_pred             HHHHHHHhhcCCCCChHhHHHHHHHHhhccchHHHHHHhhhcCCCCCccccHHHHHHHHhhhcccCCcchHHHHHHHhcc
Q 048235          332 EITWEHLARADRITPPALIKERFCNRLENKDYGSAISCLVSHPVSGSPEFSRNAWLKFFKENSQHFGQDTLIQLLHEASS  411 (455)
Q Consensus       332 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  411 (455)
                      .+.++......+..+. ....+.....+.|++++|+..+++.....+.  +..+|..+...+...++.+++.+.+.+.+.
T Consensus       291 ~~~~~~~~~~~~~~~~-~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~--~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         291 EDCYNTALRLCPTHAD-SLNNLANIKREQGNIEEAVRLYRKALEVFPE--FAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHHHHHHCTTCHH-HHHHHHHHHHTTTCHHHHHHHHHHHTTSCTT--CHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHHhhhccCCccch-hhhHHHHHHHHCCCHHHHHHHHHHHHHhCCC--CHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            9999999887765543 2333444455899999999999987643332  347788888877888888888888877666


Q ss_pred             ccccccCCCchhHHHHHHhHHh
Q 048235          412 SLTTRNGSPYPVLQNLISSCKD  433 (455)
Q Consensus       412 ~~~p~~~~~~~~l~~~~~~~~~  433 (455)
                       ++|+++.++..||.+|.+.||
T Consensus       368 -l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         368 -ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             -TCTTCHHHHHHHHHHHHHTCC
T ss_pred             -hCCCCHHHHHHHHHHHHHcCC
Confidence             999999999999999998875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure