Citrus Sinensis ID: 048509

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSVNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKSEYVESQANRKRKIGFKLSRMVKG
cccccEEEEEcccccccHHHHHHHHccccEEEEEccccccHHHHHHHHHccccEEEEEEEcHHccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHcccccccHHHHHHHHHHHHcccccccccccc
ccccccHHHHcccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHcccEEEEEEcHHHHccccccccccccHEEEEcccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHHcccc
msvnlspqicesklkpiylipllrnlggeKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHragpraragqnghcftllpkdeDKLLYMFQVKRFKKLLQqadhdscpvhsipsssieslrpiyksEYVESQANRKRKIGFKLSRMVKG
msvnlspqicesklkpiYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHragpraragqNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQAdhdscpvhsipsssieslrpIYKSEyvesqanrkrkigfklsrmvkg
MSVNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKSEYVESQANRKRKIGFKLSRMVKG
********ICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQA***********************************************
**VNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLL**************************************************
MSVNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKSEYVESQANRKRKIGFKLSRMVKG
*SVNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKSEYVESQAN***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANSPKTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKSEYVESQANRKRKIGFKLSRMVKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
Q7FGZ2522 DEAD-box ATP-dependent RN yes no 0.857 0.275 0.401 2e-29
Q0DWT8521 DEAD-box ATP-dependent RN yes no 0.857 0.276 0.385 8e-27
Q8N8A6666 ATP-dependent RNA helicas yes no 0.833 0.210 0.264 2e-09
Q6DRI7652 ATP-dependent RNA helicas yes no 0.821 0.211 0.298 1e-08
Q6P9R1639 ATP-dependent RNA helicas yes no 0.779 0.205 0.284 7e-08
A6QRQ7485 ATP-dependent rRNA helica N/A no 0.523 0.181 0.286 4e-06
P26802687 Probable ATP-dependent RN no no 0.892 0.218 0.268 7e-06
Q29S22457 Probable ATP-dependent RN no no 0.529 0.194 0.268 1e-05
A3LP87445 ATP-dependent RNA helicas yes no 0.75 0.283 0.25 1e-05
Q9H0S4455 Probable ATP-dependent RN no no 0.529 0.195 0.268 1e-05
>sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 105/197 (53%), Gaps = 53/197 (26%)

Query: 9   ICESKLKPIYLIPLLRNLGGEKFIVFASSVANS--------------------------- 41
           ICE+ +KP+YL+ LL++  GEK I+F SSV  +                           
Sbjct: 316 ICETGMKPVYLVALLKSWEGEKCIIFTSSVETTRRLCKLLNFFGDPKIKAKEYSGGLNQS 375

Query: 42  --PKTLKAFRGKGHMQVLVCSDAMTSGMDV---------ERAAYIKTYIHRAGPRARAGQ 90
              K LKAFR KG +QVLV SDA+T GMDV         +   + KT+IHRAG  ARAGQ
Sbjct: 376 LRSKELKAFR-KGDIQVLVASDALTRGMDVKGVTNVINYDMPPFAKTFIHRAGRTARAGQ 434

Query: 91  NGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYK------ 144
            G CFTLL   E        V+RF KLL++   DSCP++ IP +S++S+R  Y       
Sbjct: 435 AGRCFTLLSNHE--------VRRFSKLLEKVGSDSCPIYPIPPTSLDSIRATYTPALEKL 486

Query: 145 SEYVESQANRKRKIGFK 161
            E VES+A +K +  F+
Sbjct: 487 KELVESEAPKKGRQAFR 503

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1 Back     alignment and function description
>sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3 Back     alignment and function description
>sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 Back     alignment and function description
>sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=2 SV=1 Back     alignment and function description
>sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 Back     alignment and function description
>sp|P26802|DDX51_DROME Probable ATP-dependent RNA helicase Dbp73D OS=Drosophila melanogaster GN=Dbp73D PE=2 SV=3 Back     alignment and function description
>sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 Back     alignment and function description
>sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 Back     alignment and function description
>sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
224077862 518 predicted protein [Populus trichocarpa] 0.898 0.291 0.490 1e-39
225443938 516 PREDICTED: DEAD-box ATP-dependent RNA he 0.869 0.282 0.507 1e-39
449433605 517 PREDICTED: DEAD-box ATP-dependent RNA he 0.839 0.272 0.525 2e-39
255584180 469 dead box ATP-dependent RNA helicase, put 0.708 0.253 0.5 4e-30
5281020 474 ATP-dependent RNA helicase like protein 0.857 0.303 0.401 7e-28
240255886 522 RNA helicase 1 [Arabidopsis thaliana] gi 0.857 0.275 0.401 8e-28
297804642 522 hypothetical protein ARALYDRAFT_493299 [ 0.857 0.275 0.401 1e-27
3445416 450 DEAD box-like RNA helicase [Arabidopsis 0.857 0.32 0.395 5e-26
356526389 617 PREDICTED: LOW QUALITY PROTEIN: DEAD-box 0.761 0.207 0.428 5e-26
125541460 499 hypothetical protein OsI_09277 [Oryza sa 0.857 0.288 0.385 1e-25
>gi|224077862|ref|XP_002305441.1| predicted protein [Populus trichocarpa] gi|222848405|gb|EEE85952.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 123/204 (60%), Gaps = 53/204 (25%)

Query: 9   ICESKLKPIYLIPLLRNLGGEKFIVFASSVANS--------------------------- 41
           IC SKLKP+YL+ +L++LGGEK IVF SSV ++                           
Sbjct: 317 ICVSKLKPLYLVAVLQHLGGEKCIVFTSSVESTHRLCTLLNFFGDLKVKIKEYSGLQRQS 376

Query: 42  --PKTLKAFRGKGHMQVLVCSDAMTSGMDVERA---------AYIKTYIHRAGPRARAGQ 90
              KTLKAFR +G +QVLV SDAMT GMD+E           AY+KTY+HRAG  ARAGQ
Sbjct: 377 VRSKTLKAFR-EGEIQVLVSSDAMTRGMDIEGVRNIINYDMPAYVKTYVHRAGRTARAGQ 435

Query: 91  NGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKS----- 145
            G C TLL   E        VKRFKKLLQ+AD+DSCP++SIPSSS++SL P Y S     
Sbjct: 436 TGRCITLLRTHE--------VKRFKKLLQKADNDSCPIYSIPSSSVKSLHPFYLSALEKL 487

Query: 146 -EYVESQANRKRKIGFKLSRMVKG 168
            E V+S+ +RK K+G K SR+ KG
Sbjct: 488 KETVQSETSRKGKVGIKFSRVSKG 511

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225443938|ref|XP_002279094.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1 [Vitis vinifera] gi|297740757|emb|CBI30939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449433605|ref|XP_004134588.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1-like [Cucumis sativus] gi|449490565|ref|XP_004158642.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255584180|ref|XP_002532829.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223527420|gb|EEF29559.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|5281020|emb|CAB45993.1| ATP-dependent RNA helicase like protein [Arabidopsis thaliana] gi|7268333|emb|CAB78627.1| ATP-dependent RNA helicase like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240255886|ref|NP_193320.6| RNA helicase 1 [Arabidopsis thaliana] gi|334302879|sp|Q7FGZ2.3|RH1_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 1 gi|332658259|gb|AEE83659.1| RNA helicase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297804642|ref|XP_002870205.1| hypothetical protein ARALYDRAFT_493299 [Arabidopsis lyrata subsp. lyrata] gi|297316041|gb|EFH46464.1| hypothetical protein ARALYDRAFT_493299 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3445416|emb|CAA72041.1| DEAD box-like RNA helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356526389|ref|XP_003531800.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|125541460|gb|EAY87855.1| hypothetical protein OsI_09277 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
TAIR|locus:2130839522 RH1 "RNA helicase 1" [Arabidop 0.654 0.210 0.462 5.4e-28
UNIPROTKB|F1MGC9546 DDX51 "Uncharacterized protein 0.880 0.271 0.296 8.1e-11
UNIPROTKB|E2R5R1631 DDX51 "Uncharacterized protein 0.863 0.229 0.301 2e-09
UNIPROTKB|Q8N8A6666 DDX51 "ATP-dependent RNA helic 0.773 0.195 0.302 4.5e-09
RGD|1309580635 Ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.886 0.234 0.271 5.3e-09
ZFIN|ZDB-GENE-040927-28652 ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.821 0.211 0.292 5.6e-09
MGI|MGI:1916913639 Ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.779 0.205 0.290 3e-08
FB|FBgn0004556687 Dbp73D "Dead box protein 73D" 0.613 0.149 0.330 7.6e-07
TIGR_CMR|SO_3783 535 SO_3783 "ATP-dependent RNA hel 0.648 0.203 0.274 3.7e-06
UNIPROTKB|E1BUI4676 DDX51 "Uncharacterized protein 0.797 0.198 0.268 1.1e-05
TAIR|locus:2130839 RH1 "RNA helicase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 5.4e-28, Sum P(2) = 5.4e-28
 Identities = 62/134 (46%), Positives = 80/134 (59%)

Query:    43 KTLKAFRGKGHMQVLVCSDAMTSGMDVERAA---------YIKTYIHRAGPRARAGQNGH 93
             K LKAFR KG +QVLV SDA+T GMDV+            + KT+IHRAG  ARAGQ G 
Sbjct:   379 KELKAFR-KGDIQVLVASDALTRGMDVKGVTNVINYDMPPFAKTFIHRAGRTARAGQAGR 437

Query:    94 CFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYK------SEY 147
             CFTLL   E        V+RF KLL++   DSCP++ IP +S++S+R  Y        E 
Sbjct:   438 CFTLLSNHE--------VRRFSKLLEKVGSDSCPIYPIPPTSLDSIRATYTPALEKLKEL 489

Query:   148 VESQANRKRKIGFK 161
             VES+A +K +  F+
Sbjct:   490 VESEAPKKGRQAFR 503
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0017151 "DEAD/H-box RNA helicase binding" evidence=TAS
UNIPROTKB|F1MGC9 DDX51 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5R1 DDX51 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8A6 DDX51 "ATP-dependent RNA helicase DDX51" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309580 Ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-28 ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1916913 Ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0004556 Dbp73D "Dead box protein 73D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3783 SO_3783 "ATP-dependent RNA helicase, DEAD box family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUI4 DDX51 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-08
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 9e-06
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 6e-04
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 0.001
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.002
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 0.002
smart0049082 smart00490, HELICc, helicase superfamily c-termina 0.004
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 52.1 bits (125), Expect = 2e-08
 Identities = 29/134 (21%), Positives = 59/134 (44%), Gaps = 23/134 (17%)

Query: 43  KTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYI---------KTYIHRAGPRARAGQNGH 93
           + L+ F+  G ++VLV +D    G+D+   +++         + Y+HR G   RAG+ G 
Sbjct: 314 RALEKFK-DGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGV 372

Query: 94  CFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSI------ESLRPIYKSEY 147
             + + ++E+       VK+ K++ ++ +        +P          ++ RP  + E 
Sbjct: 373 AISFVTEEEE-------VKKLKRIEKRLERKLPSAVLLPLDEPEDAKLLKTTRPGLEEES 425

Query: 148 VESQANRKRKIGFK 161
             S   +K K   K
Sbjct: 426 DISDEIKKLKSSKK 439

Length = 513
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.95
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.94
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.94
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.93
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.93
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.93
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.92
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.92
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.91
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.91
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.9
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.9
PTZ00110545 helicase; Provisional 99.89
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.89
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.89
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.89
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.89
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.88
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.88
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.88
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.88
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.88
KOG0347 731 consensus RNA helicase [RNA processing and modific 99.87
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.87
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.86
KOG0346569 consensus RNA helicase [RNA processing and modific 99.85
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.85
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.83
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.82
PTZ00424401 helicase 45; Provisional 99.82
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.82
KOG0327397 consensus Translation initiation factor 4F, helica 99.81
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.8
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.76
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.76
KOG4284 980 consensus DEAD box protein [Transcription] 99.72
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.72
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.72
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.72
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.71
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.68
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.63
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.62
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.61
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.6
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.6
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.58
PHA02653675 RNA helicase NPH-II; Provisional 99.57
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.56
PRK13767 876 ATP-dependent helicase; Provisional 99.55
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.55
PRK04914 956 ATP-dependent helicase HepA; Validated 99.54
PRK10689 1147 transcription-repair coupling factor; Provisional 99.54
PRK05298652 excinuclease ABC subunit B; Provisional 99.54
KOG0354 746 consensus DEAD-box like helicase [General function 99.51
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.51
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.5
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.5
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.49
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.49
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.47
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.46
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.45
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.45
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.41
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.4
PRK02362 737 ski2-like helicase; Provisional 99.39
PRK13766 773 Hef nuclease; Provisional 99.37
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.35
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.35
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.31
PRK00254 720 ski2-like helicase; Provisional 99.3
PRK01172 674 ski2-like helicase; Provisional 99.25
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.23
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.17
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.16
PHA02558501 uvsW UvsW helicase; Provisional 99.15
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.15
PRK09401 1176 reverse gyrase; Reviewed 99.09
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.09
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.09
PRK14701 1638 reverse gyrase; Provisional 99.08
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.06
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.05
COG1202 830 Superfamily II helicase, archaea-specific [General 99.04
smart0049082 HELICc helicase superfamily c-terminal domain. 98.98
PRK05580679 primosome assembly protein PriA; Validated 98.96
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 98.92
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.91
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.88
PRK09694 878 helicase Cas3; Provisional 98.84
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.77
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.71
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.71
COG1204 766 Superfamily II helicase [General function predicti 98.7
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.68
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 98.64
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.51
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.35
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.29
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 98.27
KOG0353 695 consensus ATP-dependent DNA helicase [General func 98.18
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.18
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.14
COG1205 851 Distinct helicase family with a unique C-terminal 98.13
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.03
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.96
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 97.81
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.73
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.69
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.68
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.67
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.55
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.55
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.53
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 97.43
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.4
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.09
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 97.04
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 96.93
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.78
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 96.56
COG4096 875 HsdR Type I site-specific restriction-modification 96.53
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 96.45
CHL00122 870 secA preprotein translocase subunit SecA; Validate 96.41
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 96.35
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 95.99
PRK14873665 primosome assembly protein PriA; Provisional 95.96
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 95.66
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 95.58
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 95.29
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.11
KOG1123776 consensus RNA polymerase II transcription initiati 95.1
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 94.81
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 94.13
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 93.97
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 93.79
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 93.71
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 93.66
PF13871278 Helicase_C_4: Helicase_C-like 93.56
smart00491142 HELICc2 helicase superfamily c-terminal domain. 93.31
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 92.08
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 90.11
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 87.49
KOG0387 923 consensus Transcription-coupled repair protein CSB 84.96
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 84.66
COG4889 1518 Predicted helicase [General function prediction on 80.87
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 80.8
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 80.39
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 80.32
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=99.95  E-value=4.1e-28  Score=201.10  Aligned_cols=133  Identities=28%  Similarity=0.489  Sum_probs=121.5

Q ss_pred             eEEEEEEcCCCCHHHHHHHHHhccCCCcEEEEcCCcchH--------------------------HHHHHHHHhCCCccE
Q 048509            3 VNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANS--------------------------PKTLKAFRGKGHMQV   56 (168)
Q Consensus         3 l~~~~~~~~~~~K~~~L~~ll~~~~~~~~iIF~~t~~~~--------------------------~~~~~~F~~~~~~~i   56 (168)
                      ++|+|++++..+|...|+.+|++...+++||||+|+.++                          ..++++|+ +|..+|
T Consensus       275 lkQ~ylfv~~k~K~~yLV~ll~e~~g~s~iVF~~t~~tt~~la~~L~~lg~~a~~LhGqmsq~~Rlg~l~~Fk-~~~r~i  353 (476)
T KOG0330|consen  275 LKQTYLFVPGKDKDTYLVYLLNELAGNSVIVFCNTCNTTRFLALLLRNLGFQAIPLHGQMSQSKRLGALNKFK-AGARSI  353 (476)
T ss_pred             hhhheEeccccccchhHHHHHHhhcCCcEEEEEeccchHHHHHHHHHhcCcceecccchhhHHHHHHHHHHHh-ccCCcE
Confidence            689999999999999999999999889999999999999                          78899999 999999


Q ss_pred             EEEccccccCCCcCCC---------CChhhHHhhhcccccCCCcceEEEEeeCCchhHHHHHHHHHHHHHHHHhCCCCCC
Q 048509           57 LVCSDAMTSGMDVERA---------AYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCP  127 (168)
Q Consensus        57 LvaTdv~~rGlDi~~v---------~~~~~yihr~GR~gR~g~~g~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~  127 (168)
                      ||||||++||+|+|.|         .+..+||||+|||||+|++|.+|+|++.-|        ...+.+|+..+.. ..+
T Consensus       354 Lv~TDVaSRGLDip~Vd~VVNyDiP~~skDYIHRvGRtaRaGrsG~~ItlVtqyD--------ve~~qrIE~~~gk-kl~  424 (476)
T KOG0330|consen  354 LVCTDVASRGLDIPHVDVVVNYDIPTHSKDYIHRVGRTARAGRSGKAITLVTQYD--------VELVQRIEHALGK-KLP  424 (476)
T ss_pred             EEecchhcccCCCCCceEEEecCCCCcHHHHHHHcccccccCCCcceEEEEehhh--------hHHHHHHHHHHhc-CCC
Confidence            9999999999999999         668999999999999999999999999988        8889999888776 777


Q ss_pred             CcCCChhhHhhhhhhhhh
Q 048509          128 VHSIPSSSIESLRPIYKS  145 (168)
Q Consensus       128 ~~~~~~~~~~~~~~~~~~  145 (168)
                      .++++.+..-.+.+....
T Consensus       425 ~~~~~~~~~~~l~erv~e  442 (476)
T KOG0330|consen  425 EYKVDKNEVMSLNERVAE  442 (476)
T ss_pred             ccCcchHHHHHHHHHHHH
Confidence            788888777677666655

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 7e-04
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure 
Iteration: 1

 Score = 40.0 bits (92), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 10/74 (13%)
Query: 43  KTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYI---------KTYIHRAGPRARAGQNGH 93
           K    FR +G ++ LVCSD +T G+D++    +         +TY+HR G   R G  G 
Sbjct: 299 KVFHEFR-QGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGL 357
Query: 94  CFTLLPKDEDKLLY 107
              L+  ++   LY
Sbjct: 358 AINLINWNDRFNLY 371

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 6e-09
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 8e-09
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-07
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-07
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-06
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-06
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-06
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-06
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 3e-06
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-06
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 6e-06
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 8e-06
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-05
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-05
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-05
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-05
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 4e-05
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 9e-05
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 9e-05
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 9e-05
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-04
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-04
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 7e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score = 52.9 bits (127), Expect = 6e-09
 Identities = 30/140 (21%), Positives = 54/140 (38%), Gaps = 18/140 (12%)

Query: 43  KTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYI---------KTYIHRAGPRARAGQNGH 93
             +K F+ K    +LVC+D    GMD      +           YIHR G  AR+G+ G 
Sbjct: 383 SLVKRFK-KDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGS 441

Query: 94  CFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSCPVHSIPSSSIESLRPIYKS------EY 147
               + KDE   +   +++  K ++        P   I S  +E++    +         
Sbjct: 442 SVLFICKDELPFVR--ELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISL 499

Query: 148 VESQANRKRKIGFKLSRMVK 167
           + S  +  ++  F   R++ 
Sbjct: 500 ISSYRSCIKEYRFSERRILP 519
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.92
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.91
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.91
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.91
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.9
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.89
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.8
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.83
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.83
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.83
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.82
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.8
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.79
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.79
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.79
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.76
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.75
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.75
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.75
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.74
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.73
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.73
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.69
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.69
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.68
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.68
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.66
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.63
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.63
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.62
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.62
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.62
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.61
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.6
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.59
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.58
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.58
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.57
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.56
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.55
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.55
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.54
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.53
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.52
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.52
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.49
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.49
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.47
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.46
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.45
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.45
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.45
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.38
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.38
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.35
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.34
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.33
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.32
3h1t_A590 Type I site-specific restriction-modification syst 99.29
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.29
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.28
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.26
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.23
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.14
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 98.9
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.76
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.62
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.1
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 96.23
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 84.8
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
Probab=99.92  E-value=1.3e-24  Score=161.86  Aligned_cols=113  Identities=19%  Similarity=0.352  Sum_probs=103.7

Q ss_pred             ceEEEEEEcCCCCHHHHHHHHHhccCCCcEEEEcCCcchH--------------------------HHHHHHHHhCCCcc
Q 048509            2 SVNLSPQICESKLKPIYLIPLLRNLGGEKFIVFASSVANS--------------------------PKTLKAFRGKGHMQ   55 (168)
Q Consensus         2 ~l~~~~~~~~~~~K~~~L~~ll~~~~~~~~iIF~~t~~~~--------------------------~~~~~~F~~~~~~~   55 (168)
                      +|+|+|+.++.++|...|..+|......++||||+++..+                          ..++++|+ +|+.+
T Consensus         9 ~i~~~~~~~~~~~K~~~L~~ll~~~~~~~~lVF~~~~~~~~~l~~~L~~~~~~~~~~hg~~~~~~r~~~~~~f~-~g~~~   87 (163)
T 2hjv_A            9 NIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFK-RGEYR   87 (163)
T ss_dssp             CEEEEEEECCGGGHHHHHHHHHHHHCCSSEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHH-TTSCS
T ss_pred             cceEEEEECChHHHHHHHHHHHHhcCCCcEEEEECCHHHHHHHHHHHHHcCCcEEEEeCCCCHHHHHHHHHHHH-cCCCe
Confidence            5899999999999999999999988888999999999988                          78899999 99999


Q ss_pred             EEEEccccccCCCcCCC---------CChhhHHhhhcccccCCCcceEEEEeeCCchhHHHHHHHHHHHHHHHHhCC
Q 048509           56 VLVCSDAMTSGMDVERA---------AYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADH  123 (168)
Q Consensus        56 iLvaTdv~~rGlDi~~v---------~~~~~yihr~GR~gR~g~~g~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~  123 (168)
                      ||||||++++|+|+|++         .++.+|+||+||+||.|+.|.+++|+++.+        ...+..+.+.++.
T Consensus        88 vlv~T~~~~~Gld~~~~~~Vi~~~~p~~~~~~~qr~GR~~R~g~~g~~~~~~~~~~--------~~~~~~i~~~~~~  156 (163)
T 2hjv_A           88 YLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFE--------KRFLADIEEYIGF  156 (163)
T ss_dssp             EEEECGGGTTTCCCSCCSEEEESSCCSSHHHHHHHTTTSSCTTCCEEEEEEECGGG--------HHHHHHHHHHHTS
T ss_pred             EEEECChhhcCCchhcCCEEEEeCCCCCHHHHHHhccccCcCCCCceEEEEecHHH--------HHHHHHHHHHHCC
Confidence            99999999999999998         568999999999999999999999999988        6667777776654
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 4e-05
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 8e-05
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 9e-05
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

 Score = 40.3 bits (93), Expect = 4e-05
 Identities = 17/79 (21%), Positives = 24/79 (30%), Gaps = 11/79 (13%)

Query: 43  KTLKAFRGKGHMQVLVCSDAMTSGMDVERAAYI---------KTYIHRAGPRARAGQNGH 93
             L  F  +G   VLV +     G+DV     +            I R G   R    G 
Sbjct: 210 LILDEFA-RGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGRHMP-GR 267

Query: 94  CFTLLPKDEDKLLYMFQVK 112
              L+ K      Y +  +
Sbjct: 268 VIILMAKGTRDEAYYWSSR 286
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.96
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.95
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.95
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.93
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.8
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.8
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.8
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.73
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.68
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.63
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.62
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.57
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.47
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.46
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.23
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.96
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.8
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.35
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.32
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.94
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 92.29
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.96  E-value=1e-29  Score=188.97  Aligned_cols=123  Identities=22%  Similarity=0.409  Sum_probs=104.4

Q ss_pred             eEEEEEEcCC-CCHHHHHHHHHhccCCCcEEEEcCCcchH--------------------------HHHHHHHHhCCCcc
Q 048509            3 VNLSPQICES-KLKPIYLIPLLRNLGGEKFIVFASSVANS--------------------------PKTLKAFRGKGHMQ   55 (168)
Q Consensus         3 l~~~~~~~~~-~~K~~~L~~ll~~~~~~~~iIF~~t~~~~--------------------------~~~~~~F~~~~~~~   55 (168)
                      |+|+|+.|+. +.|++.|.++++.....++||||+|+..+                          ..+++.|+ .++.+
T Consensus         1 I~q~~~~v~~~e~K~~~L~~ll~~~~~~k~iIF~~s~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~l~~f~-~~~~~   79 (162)
T d1fuka_           1 IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFR-SGSSR   79 (162)
T ss_dssp             CEEEEEEEESGGGHHHHHHHHHHHTTCSCEEEEESSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHH-TTSCS
T ss_pred             CEEEEEEeCCcHHHHHHHHHHHHhCCCCcEEEEEEEEchHHHHHHHHhhcCceEEEeccCCchhhHHHHHHHHh-hcccc
Confidence            6899999975 55999999999999889999999999999                          88999999 99999


Q ss_pred             EEEEccccccCCCcCCC---------CChhhHHhhhcccccCCCcceEEEEeeCCchhHHHHHHHHHHHHHHHHhCCCCC
Q 048509           56 VLVCSDAMTSGMDVERA---------AYIKTYIHRAGPRARAGQNGHCFTLLPKDEDKLLYMFQVKRFKKLLQQADHDSC  126 (168)
Q Consensus        56 iLvaTdv~~rGlDi~~v---------~~~~~yihr~GR~gR~g~~g~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  126 (168)
                      ||||||+++||+|+|+|         .+++.|+||+||+||+|+.|.|++|+++.|        ...+..+.+.++.   
T Consensus        80 iLv~Tdv~~rGiDi~~v~~VI~~d~P~~~~~yihR~GR~gR~g~~g~~i~~~~~~d--------~~~~~~i~~~~~~---  148 (162)
T d1fuka_          80 ILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNED--------VGAMRELEKFYST---  148 (162)
T ss_dssp             EEEEEGGGTTTCCCCSCSEEEESSCCSSGGGGGGSSCSCC-----CEEEEEEETTT--------HHHHHHHHHHSSC---
T ss_pred             eeeccccccccccCCCceEEEEeccchhHHHHHhhccccccCCCccEEEEEcCHHH--------HHHHHHHHHHHcC---
Confidence            99999999999999999         778999999999999999999999999999        6777788777764   


Q ss_pred             CCcCCChhhHh
Q 048509          127 PVHSIPSSSIE  137 (168)
Q Consensus       127 ~~~~~~~~~~~  137 (168)
                      +..++|.++.+
T Consensus       149 ~~~~ip~~~~~  159 (162)
T d1fuka_         149 QIEELPSDIAT  159 (162)
T ss_dssp             CCEECCSCCTT
T ss_pred             cCCCCChHHHH
Confidence            45567765543
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure