Citrus Sinensis ID: 048578


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MLKQLVPNSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
cccccccccccHHHHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccEEHHHHHHHHHccccHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHcHHcccccccccHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccc
ccHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEHHHHHHHHHcHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccc
mlkqlvpnsqlthftnsanshknsntatkshhhlpllqkcTHLVQFKQVHAQIIKAsfdnrtisDTQLAKLIESLVNSSQIAYAHLVFNqiinpstfaFNTVIRGYAeaglghrgIQLYTQMigngldpdsftyPILLKACgdlrqvkgvHSLVVKSKDFNSVIHSLTRLITFYcnfgdvksAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMqmsgikpddVTLIAVLTACSHAGLIEKGKEIFYNMRrdykvepnvkhygCLVDLLCRARLLDEAYEVIRnmpmepnaVLWGSLLTACASADDGANVELAEIAMERLIklepfndgnyvLMSNIYAAKAQWDDAGKMRRLMKERnivknpgcsvieINDVVHEFmvgdgrhpcsEEIYSMLEYVAISLREECYAARMP
mlkqlvpnsqlthftnsanshknsNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSlvvkskdfnsVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTaminghvkqknYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERnivknpgcsvIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
MLKQLVPNSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
********************************HLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYA****
MLKQL**NSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
MLKQLVPNSQLTHFTNSAN**************LPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
MLKQLVPNSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKQLVPNSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query519 2.2.26 [Sep-21-2011]
Q9FJY7620 Pentatricopeptide repeat- yes no 0.921 0.770 0.399 1e-110
A8MQA3595 Pentatricopeptide repeat- no no 0.921 0.803 0.402 1e-107
Q9FIF7544 Putative pentatricopeptid no no 0.924 0.882 0.370 1e-100
Q9FI80646 Pentatricopeptide repeat- no no 0.917 0.736 0.363 3e-99
Q9SIL5534 Pentatricopeptide repeat- no no 0.899 0.874 0.349 6e-98
Q9FG16622 Pentatricopeptide repeat- no no 0.890 0.742 0.389 5e-95
Q9SJG6559 Pentatricopeptide repeat- no no 0.911 0.846 0.372 7e-95
Q9C6T2606 Pentatricopeptide repeat- no no 0.982 0.841 0.366 1e-93
Q8LK93603 Pentatricopeptide repeat- no no 0.907 0.781 0.360 2e-92
Q0WQW5638 Pentatricopeptide repeat- no no 0.940 0.764 0.363 3e-92
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function desciption
 Score =  399 bits (1025), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/516 (39%), Positives = 305/516 (59%), Gaps = 38/516 (7%)

Query: 37  LQKCTHLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPST 96
           LQ+C+   + KQ+HA+++K      + + T+      S  +S  + YA +VF+    P T
Sbjct: 21  LQRCSKQEELKQIHARMLKTGLMQDSYAITKFLSFCISSTSSDFLPYAQIVFDGFDRPDT 80

Query: 97  FAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDL---RQVKGVHSL 153
           F +N +IRG++ +    R + LY +M+ +    +++T+P LLKAC +L    +   +H+ 
Sbjct: 81  FLWNLMIRGFSCSDEPERSLLLYQRMLCSSAPHNAYTFPSLLKACSNLSAFEETTQIHAQ 140

Query: 154 VVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFD------------------------- 188
           + K   + + ++++  LI  Y   G+ K A LLFD                         
Sbjct: 141 ITKL-GYENDVYAVNSLINSYAVTGNFKLAHLLFDRIPEPDDVSWNSVIKGYVKAGKMDI 199

Query: 189 ------QMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACAN 242
                 +M EKN ++WT MI+G+V+    +E + LF +M++S VE + ++L + LSACA 
Sbjct: 200 ALTLFRKMAEKNAISWTTMISGYVQADMNKEALQLFHEMQNSDVEPDNVSLANALSACAQ 259

Query: 243 LGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSI 302
           LGA E GKW+H ++NK  I ++  LG  L DMYAKCG +EEAL VFK + +K+V  W ++
Sbjct: 260 LGALEQGKWIHSYLNKTRIRMDSVLGCVLIDMYAKCGEMEEALEVFKNIKKKSVQAWTAL 319

Query: 303 IGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYK 362
           I G A HG G EA+  F +MQ  GIKP+ +T  AVLTACS+ GL+E+GK IFY+M RDY 
Sbjct: 320 ISGYAYHGHGREAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYN 379

Query: 363 VEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAE 422
           ++P ++HYGC+VDLL RA LLDEA   I+ MP++PNAV+WG+LL AC       N+EL E
Sbjct: 380 LKPTIEHYGCIVDLLGRAGLLDEAKRFIQEMPLKPNAVIWGALLKACRIH---KNIELGE 436

Query: 423 IAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVV 482
              E LI ++P++ G YV  +NI+A   +WD A + RRLMKE+ + K PGCS I +    
Sbjct: 437 EIGEILIAIDPYHGGRYVHKANIHAMDKKWDKAAETRRLMKEQGVAKVPGCSTISLEGTT 496

Query: 483 HEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARM 518
           HEF+ GD  HP  E+I S    +   L E  Y   +
Sbjct: 497 HEFLAGDRSHPEIEKIQSKWRIMRRKLEENGYVPEL 532





Arabidopsis thaliana (taxid: 3702)
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q9FIF7|PP435_ARATH Putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E41 PE=3 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protein At2g20540 OS=Arabidopsis thaliana GN=PCMP-E78 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protein At1g31920 OS=Arabidopsis thaliana GN=PCMP-H11 PE=2 SV=1 Back     alignment and function description
>sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protein At2g02980 OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2 Back     alignment and function description
>sp|Q0WQW5|PPR85_ARATH Pentatricopeptide repeat-containing protein At1g59720, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H51 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query519
225425100 622 PREDICTED: pentatricopeptide repeat-cont 0.946 0.789 0.388 1e-113
147832325 622 hypothetical protein VITISV_030261 [Viti 0.946 0.789 0.386 1e-113
297738270574 unnamed protein product [Vitis vinifera] 0.913 0.825 0.394 1e-109
15239979 620 pentatricopeptide repeat-containing prot 0.921 0.770 0.399 1e-108
297738895580 unnamed protein product [Vitis vinifera] 0.842 0.753 0.439 1e-106
297797743 649 pentatricopeptide repeat-containing prot 0.909 0.727 0.396 1e-106
359476084541 PREDICTED: pentatricopeptide repeat-cont 0.907 0.870 0.378 1e-105
224134923 635 predicted protein [Populus trichocarpa] 0.921 0.752 0.372 1e-105
5262797 1495 putative protein (fragment) [Arabidopsis 0.921 0.319 0.402 1e-105
224138230617 predicted protein [Populus trichocarpa] 0.915 0.769 0.391 1e-105
>gi|225425100|ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  416 bits (1069), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/543 (38%), Positives = 330/543 (60%), Gaps = 52/543 (9%)

Query: 6   VPNSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQFKQVHAQIIKASFDNRTISD 65
            P SQL+  +N+A +             L LLQ+C+++ + +Q+H Q++K       I  
Sbjct: 7   TPTSQLSSESNAAQT-------------LHLLQRCSNMEELRQIHGQMLKTGLILDEIPA 53

Query: 66  TQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGN 125
           ++L     S  NS  +AYA  VF++I  P+TF +NT+IRGY+ +      + LY  M+ +
Sbjct: 54  SKLLAFCAS-PNSGSLAYARTVFDRIFRPNTFMWNTMIRGYSNSKEPEEALLLYHHMLYH 112

Query: 126 GLDPDSFTYPILLKACGD---LRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKS 182
            +  +++T+P LLKAC     L + + +H+ ++K   F S I++   L+  Y   GD+KS
Sbjct: 113 SVPHNAYTFPFLLKACSSMSALEETQQIHAHIIK-MGFGSEIYTTNSLLNVYSKSGDIKS 171

Query: 183 AQLLFDQ-------------------------------MTEKNVVTWTAMINGHVKQKNY 211
           A+LLFDQ                               M E+N+++WT+MI+G V     
Sbjct: 172 ARLLFDQVDQRDTVSWNSMIDGYTKCGEIEMAYEIFNHMPERNIISWTSMISGCVGAGKP 231

Query: 212 REGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAAL 271
           +E ++LF +M+ +G++++ + LVS L ACA+LG  + GKW+H ++ K+ I ++  LG  L
Sbjct: 232 KEALNLFHRMQTAGIKLDNVALVSTLQACADLGVLDQGKWIHAYIKKHEIEIDPILGCVL 291

Query: 272 TDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDD 331
            DMYAKCG +EEA+ VF+ + EK V  W ++I G AIHG G EA++ F +MQ +G++P+ 
Sbjct: 292 IDMYAKCGDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREALEWFMKMQTAGVEPNQ 351

Query: 332 VTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIR 391
           +T   +LTACSHAGL+ + K +F +M R +  +P+++HYGC+VDLL RA LL EA E+I 
Sbjct: 352 MTFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKEAEELIE 411

Query: 392 NMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQ 451
           NMP++PNA +WG+LL AC       N+EL +   + LI+++P + G Y+ +++I+AA  +
Sbjct: 412 NMPVKPNAAIWGALLNAC---HIHGNLELGKQIGKILIQVDPGHGGRYIHLASIHAAAGE 468

Query: 452 WDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLEYVAISLRE 511
           W+ A ++RR MKE+ + K PGCSVI +N   HEF+ GD  HP  +EI  MLE +   LRE
Sbjct: 469 WNQAARVRRQMKEQGVSKLPGCSVISVNGTAHEFLAGDESHPQIKEIDHMLEQIVERLRE 528

Query: 512 ECY 514
           E Y
Sbjct: 529 EGY 531




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147832325|emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738270|emb|CBI27471.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15239979|ref|NP_201453.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171133|sp|Q9FJY7.1|PP449_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g66520 gi|10177533|dbj|BAB10928.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332010841|gb|AED98224.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297738895|emb|CBI28140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797743|ref|XP_002866756.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312591|gb|EFH43015.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359476084|ref|XP_002282081.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134923|ref|XP_002327523.1| predicted protein [Populus trichocarpa] gi|222836077|gb|EEE74498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|5262797|emb|CAB45902.1| putative protein (fragment) [Arabidopsis thaliana] gi|7268904|emb|CAB79107.1| putative protein (fragment) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224138230|ref|XP_002322762.1| predicted protein [Populus trichocarpa] gi|222867392|gb|EEF04523.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query519
TAIR|locus:4010713895595 AT4G21065 "AT4G21065" [Arabido 0.921 0.803 0.406 1e-98
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.969 0.678 0.373 4e-90
TAIR|locus:2034456606 AT1G31920 [Arabidopsis thalian 0.982 0.841 0.368 6.5e-90
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.888 0.743 0.400 5.9e-89
TAIR|locus:2056740603 OTP85 "ORGANELLE TRANSCRIPT PR 0.957 0.824 0.354 1.4e-87
TAIR|locus:2025946638 CRR28 "CHLORORESPIRATORY REDUC 0.946 0.769 0.366 1.3e-86
TAIR|locus:2154389646 LPA66 "LOW PSII ACCUMULATION 6 0.815 0.654 0.386 5e-83
TAIR|locus:2057574583 AT2G33760 [Arabidopsis thalian 0.932 0.830 0.366 1.3e-82
TAIR|locus:2011892596 AT1G50270 "AT1G50270" [Arabido 0.936 0.815 0.357 3.6e-82
TAIR|locus:2077878685 AT3G08820 "AT3G08820" [Arabido 0.901 0.683 0.359 2.5e-81
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 980 (350.0 bits), Expect = 1.0e-98, P = 1.0e-98
 Identities = 205/504 (40%), Positives = 322/504 (63%)

Query:    34 LPLLQKCTHLVQ---------FKQVHAQIIKASFDNRTISDTQLAK-LI---ESLVNSSQ 80
             LP+++KC +L+Q          +Q+HA  I+      +ISD +L K LI    SL +   
Sbjct:    12 LPMVEKCINLLQTYGVSSITKLRQIHAFSIRHGV---SISDAELGKHLIFYLVSLPSPPP 68

Query:    81 IAYAHLVFNQIINP-STFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGL-DPDSFTYPILL 138
             ++YAH VF++I  P + F +NT+IRGYAE G       LY +M  +GL +PD+ TYP L+
Sbjct:    69 MSYAHKVFSKIEKPINVFIWNTLIRGYAEIGNSISAFSLYREMRVSGLVEPDTHTYPFLI 128

Query:   139 KAC---GDLRQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNV 195
             KA     D+R  + +HS+V++S  F S+I+    L+  Y N GDV SA  +FD+M EK++
Sbjct:   129 KAVTTMADVRLGETIHSVVIRS-GFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDL 187

Query:   196 VTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEF 255
             V W ++ING  +     E + L+ +M   G++ +  T+VS+LSACA +GA  LGK VH +
Sbjct:   188 VAWNSVINGFAENGKPEEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVY 247

Query:   256 VNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEA 315
             + K  +  N      L D+YA+CG +EEA  +F  +++KN  +W S+I GLA++G G+EA
Sbjct:   248 MIKVGLTRNLHSSNVLLDLYARCGRVEEAKTLFDEMVDKNSVSWTSLIVGLAVNGFGKEA 307

Query:   316 VKMFWQMQMS-GIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLV 374
             +++F  M+ + G+ P ++T + +L ACSH G++++G E F  MR +YK+EP ++H+GC+V
Sbjct:   308 IELFKYMESTEGLLPCEITFVGILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMV 367

Query:   375 DLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPF 434
             DLL RA  + +AYE I++MPM+PN V+W +LL AC    D    +LAE A  ++++LEP 
Sbjct:   368 DLLARAGQVKKAYEYIKSMPMQPNVVIWRTLLGACTVHGDS---DLAEFARIQILQLEPN 424

Query:   435 NDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEINDVVHEFMVGDGRHPC 494
             + G+YVL+SN+YA++ +W D  K+R+ M    + K PG S++E+ + VHEF++GD  HP 
Sbjct:   425 HSGDYVLLSNMYASEQRWSDVQKIRKQMLRDGVKKVPGHSLVEVGNRVHEFLMGDKSHPQ 484

Query:   495 SEEIYSMLEYVAISLREECYAARM 518
             S+ IY+ L+ +   LR E Y  ++
Sbjct:   485 SDAIYAKLKEMTGRLRSEGYVPQI 508




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034456 AT1G31920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056740 OTP85 "ORGANELLE TRANSCRIPT PROCESSING 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025946 CRR28 "CHLORORESPIRATORY REDUCTION28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057574 AT2G33760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011892 AT1G50270 "AT1G50270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077878 AT3G08820 "AT3G08820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT5G66520
pentatricopeptide (PPR) repeat-containing protein; pentatricopeptide (PPR) repeat-containing protein; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; EXPRESSED IN- 18 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Pentatricopeptide repeat (InterPro-IPR002885); BEST Arabidopsis thaliana protein match is- pentatricopeptide (PPR) repeat-containing protein (TAIR-AT5G06540.1); Has 14737 Blast hits to 5344 proteins in 184 species- Archae - 1; Bacteria - 4; Metazoa - 109; Fungi - 73; Plants - 14158; Viruses - 0; Other Eukaryo [...] (620 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G53270
seed maturation family protein; seed maturation family protein; FUNCTIONS IN- molecular_functio [...] (159 aa)
       0.990
PER65
peroxidase, putative; peroxidase, putative; FUNCTIONS IN- xylan 1,4-beta-xylosidase activity, p [...] (334 aa)
       0.940
ATFOLT1
ATFOLT1 (ARABIDOPSIS THALIANA FOLATE TRANSPORTER 1); binding / folic acid transporter; Encodes [...] (308 aa)
       0.744
ATOMT1
ATOMT1 (O-METHYLTRANSFERASE 1); caffeate O-methyltransferase/ myricetin 3'-O-methyltransferase/ [...] (363 aa)
       0.599
NDF4
NDF4 (NDH-DEPENDENT CYCLIC ELECTRON FLOW 1); electron carrier/ iron-sulfur cluster binding; enc [...] (204 aa)
       0.593
ATDFD
ATDFD (A. THALIANA DHFS-FPGS HOMOLOG D); tetrahydrofolylpolyglutamate synthase; A. THALIANA DHF [...] (492 aa)
       0.524
ATRAB8A
ATRAB8A; GTP binding; small GTP-binding protein (ara-3) (216 aa)
       0.508
FKBP13
FK506-binding protein 1 (FKBP13); FK506-binding protein 1 (FKBP13); FUNCTIONS IN- FK506 binding [...] (208 aa)
       0.505
AT4G28080
binding; binding; FUNCTIONS IN- binding; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 1 [...] (1834 aa)
       0.499
AT1G31920
pentatricopeptide (PPR) repeat-containing protein; pentatricopeptide (PPR) repeat-containing pr [...] (606 aa)
      0.480

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-98
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-95
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-56
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-44
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-26
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-15
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 7e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  316 bits (811), Expect = 1e-98
 Identities = 159/462 (34%), Positives = 257/462 (55%), Gaps = 16/462 (3%)

Query: 47  KQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQIINPSTFAFNTVIRGY 106
           +++H  ++K  F    +  +    LI+  ++      A  VF+++      ++  +I GY
Sbjct: 308 REMHGYVVKTGFA---VDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGY 364

Query: 107 AEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQV-KGV--HSLVVKSKDFNSV 163
            + GL  + ++ Y  M  + + PD  T   +L AC  L  +  GV  H L  + K   S 
Sbjct: 365 EKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAER-KGLISY 423

Query: 164 IHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYR--EGIDLFRKM 221
           +     LI  Y     +  A  +F  + EK+V++WT++I G   + N R  E +  FR+M
Sbjct: 424 VVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGL--RLNNRCFEALIFFRQM 481

Query: 222 RDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYI 281
             + ++ N +TL++ LSACA +GA   GK +H  V +  I  +  L  AL D+Y +CG +
Sbjct: 482 LLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRM 540

Query: 282 EEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTAC 341
             A   F    EK+V +WN ++ G   HG G  AV++F +M  SG+ PD+VT I++L AC
Sbjct: 541 NYAWNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCAC 599

Query: 342 SHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVL 401
           S +G++ +G E F++M   Y + PN+KHY C+VDLL RA  L EAY  I  MP+ P+  +
Sbjct: 600 SRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAV 659

Query: 402 WGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRL 461
           WG+LL AC       +VEL E+A + + +L+P + G Y+L+ N+YA   +WD+  ++R+ 
Sbjct: 660 WGALLNACRIHR---HVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKT 716

Query: 462 MKERNIVKNPGCSVIEINDVVHEFMVGDGRHPCSEEIYSMLE 503
           M+E  +  +PGCS +E+   VH F+  D  HP  +EI ++LE
Sbjct: 717 MRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLE 758


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 519
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.72
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.68
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.65
KOG2003840 consensus TPR repeat-containing protein [General f 99.65
KOG0547606 consensus Translocase of outer mitochondrial membr 99.65
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.63
KOG2076 895 consensus RNA polymerase III transcription factor 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.59
KOG1126638 consensus DNA-binding cell division cycle control 99.58
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.57
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.54
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.52
KOG2003840 consensus TPR repeat-containing protein [General f 99.52
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.52
KOG1126638 consensus DNA-binding cell division cycle control 99.51
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.49
KOG1915677 consensus Cell cycle control protein (crooked neck 99.48
KOG2076 895 consensus RNA polymerase III transcription factor 99.48
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.44
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.43
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.43
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.39
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.38
KOG0547606 consensus Translocase of outer mitochondrial membr 99.38
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.33
PRK12370553 invasion protein regulator; Provisional 99.32
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.32
PF1304150 PPR_2: PPR repeat family 99.31
KOG1129478 consensus TPR repeat-containing protein [General f 99.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.3
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
PF1304150 PPR_2: PPR repeat family 99.29
KOG1129478 consensus TPR repeat-containing protein [General f 99.27
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.27
PRK12370553 invasion protein regulator; Provisional 99.26
KOG2376652 consensus Signal recognition particle, subunit Srp 99.23
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.22
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.21
PRK11189296 lipoprotein NlpI; Provisional 99.17
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.16
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.14
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.13
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.13
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.13
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.12
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.11
PRK11189296 lipoprotein NlpI; Provisional 99.11
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.05
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.04
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.03
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.97
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.95
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.94
KOG1125579 consensus TPR repeat-containing protein [General f 98.92
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.87
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.87
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.87
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.84
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.83
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.83
PRK04841903 transcriptional regulator MalT; Provisional 98.83
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.81
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.8
PRK10370198 formate-dependent nitrite reductase complex subuni 98.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.77
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.76
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.75
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.75
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.7
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.7
PLN02789320 farnesyltranstransferase 98.69
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.68
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.68
KOG1125579 consensus TPR repeat-containing protein [General f 98.66
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.66
PRK15359144 type III secretion system chaperone protein SscB; 98.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.62
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.61
PRK15359144 type III secretion system chaperone protein SscB; 98.61
KOG1128777 consensus Uncharacterized conserved protein, conta 98.58
PRK04841 903 transcriptional regulator MalT; Provisional 98.57
PF1285434 PPR_1: PPR repeat 98.56
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.56
PF1285434 PPR_1: PPR repeat 98.55
PRK10370198 formate-dependent nitrite reductase complex subuni 98.55
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.54
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.54
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.53
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.53
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.49
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.47
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.45
PLN02789320 farnesyltranstransferase 98.4
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.4
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.39
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.35
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.3
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.29
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.27
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.27
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.25
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.23
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.22
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.2
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.17
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.14
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.11
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.1
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.09
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.07
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.02
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.99
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.92
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.9
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.89
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.86
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.85
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.84
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.81
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.8
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.79
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.79
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.78
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.78
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.73
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.72
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.71
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.7
KOG0553304 consensus TPR repeat-containing protein [General f 97.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.66
COG4700251 Uncharacterized protein conserved in bacteria cont 97.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.62
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.6
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.58
PF1337173 TPR_9: Tetratricopeptide repeat 97.58
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.56
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.56
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.53
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.51
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.5
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.49
COG3898531 Uncharacterized membrane-bound protein [Function u 97.48
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.47
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.47
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.45
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.44
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.43
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.4
PF1343134 TPR_17: Tetratricopeptide repeat 97.38
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.37
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.36
COG4700251 Uncharacterized protein conserved in bacteria cont 97.35
PRK15331165 chaperone protein SicA; Provisional 97.31
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.31
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.3
PF12688120 TPR_5: Tetratrico peptide repeat 97.29
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.27
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.25
PF12688120 TPR_5: Tetratrico peptide repeat 97.25
KOG20411189 consensus WD40 repeat protein [General function pr 97.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.24
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.24
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.22
PRK10803263 tol-pal system protein YbgF; Provisional 97.19
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.16
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.01
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.97
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.94
PRK11619 644 lytic murein transglycosylase; Provisional 96.89
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.87
PRK10803263 tol-pal system protein YbgF; Provisional 96.81
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.78
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.77
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.76
PF1342844 TPR_14: Tetratricopeptide repeat 96.69
PF1337173 TPR_9: Tetratricopeptide repeat 96.67
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.67
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.64
KOG20411189 consensus WD40 repeat protein [General function pr 96.64
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.64
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.42
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.42
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.41
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.39
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.23
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.19
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.16
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.11
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.01
PRK11906458 transcriptional regulator; Provisional 95.85
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.85
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.82
PRK15331165 chaperone protein SicA; Provisional 95.77
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.73
PF13512142 TPR_18: Tetratricopeptide repeat 95.73
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.7
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.68
KOG4555175 consensus TPR repeat-containing protein [Function 95.53
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.48
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.44
KOG1585308 consensus Protein required for fusion of vesicles 95.44
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.44
COG3898531 Uncharacterized membrane-bound protein [Function u 95.42
PRK11906458 transcriptional regulator; Provisional 95.29
KOG3941406 consensus Intermediate in Toll signal transduction 95.27
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.27
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.24
KOG3941406 consensus Intermediate in Toll signal transduction 95.21
KOG1258577 consensus mRNA processing protein [RNA processing 95.1
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.1
smart00299140 CLH Clathrin heavy chain repeat homology. 95.06
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.05
PF13512142 TPR_18: Tetratricopeptide repeat 95.04
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.89
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.8
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.77
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.66
KOG1586288 consensus Protein required for fusion of vesicles 94.57
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.36
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.21
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.19
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.11
KOG4555175 consensus TPR repeat-containing protein [Function 94.1
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.05
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.01
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.95
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.75
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.68
COG3629280 DnrI DNA-binding transcriptional activator of the 93.66
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.62
KOG4234271 consensus TPR repeat-containing protein [General f 93.59
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.56
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.55
PF1342844 TPR_14: Tetratricopeptide repeat 93.52
KOG1585308 consensus Protein required for fusion of vesicles 93.36
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.32
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.24
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.13
smart00299140 CLH Clathrin heavy chain repeat homology. 93.1
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.04
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.55
KOG4234271 consensus TPR repeat-containing protein [General f 92.51
PRK09687280 putative lyase; Provisional 92.49
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.42
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.24
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.9
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.71
COG3629280 DnrI DNA-binding transcriptional activator of the 91.33
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.32
KOG1258577 consensus mRNA processing protein [RNA processing 91.31
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.3
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.28
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.14
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.09
KOG3364149 consensus Membrane protein involved in organellar 90.76
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.76
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.6
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.57
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.49
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.44
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.42
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.33
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.11
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.74
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 89.42
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 89.3
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.16
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.94
PF13929292 mRNA_stabil: mRNA stabilisation 88.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.61
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 88.29
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 88.19
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.17
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.87
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.76
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 87.64
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.59
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.55
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 87.28
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.03
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 86.93
KOG4648 536 consensus Uncharacterized conserved protein, conta 86.81
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.01
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.8
COG2976207 Uncharacterized protein conserved in bacteria [Fun 85.7
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.55
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.38
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.83
KOG1550552 consensus Extracellular protein SEL-1 and related 84.75
PF1343134 TPR_17: Tetratricopeptide repeat 84.61
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 83.03
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.98
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.72
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.29
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.08
PF13762145 MNE1: Mitochondrial splicing apparatus component 81.9
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.89
PRK11619644 lytic murein transglycosylase; Provisional 81.3
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.11
PF09477116 Type_III_YscG: Bacterial type II secretion system 80.77
COG4455 273 ImpE Protein of avirulence locus involved in tempe 80.28
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 80.25
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.7e-76  Score=607.19  Aligned_cols=503  Identities=30%  Similarity=0.518  Sum_probs=482.9

Q ss_pred             chhhhhhhhhccccCCCCCCCCCcccHHHHHHhccCchHH---HHHHHHHHHhcCCCCchhHHHHHHHHHhhcCCCChHH
Q 048578            7 PNSQLTHFTNSANSHKNSNTATKSHHHLPLLQKCTHLVQF---KQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAY   83 (519)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~   83 (519)
                      +..++..|.....   ..+..||..||+.++.+|++.++.   .+++..|.+.|+.||..+++.|+++|++.   |++++
T Consensus       103 ~~~Al~~f~~m~~---~~~~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~g~~~~~~~~n~Li~~y~k~---g~~~~  176 (697)
T PLN03081        103 HREALELFEILEA---GCPFTLPASTYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHVKC---GMLID  176 (697)
T ss_pred             HHHHHHHHHHHHh---cCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCcchHHHHHHHHHHhcC---CCHHH
Confidence            3455555555432   234679999999999999766555   89999999999999999999999999999   99999


Q ss_pred             HHHHHhcCCCCCcchHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCcchHHHHHHHHcCccc---hHHHHHHHHHhCCC
Q 048578           84 AHLVFNQIINPSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDLRQ---VKGVHSLVVKSKDF  160 (519)
Q Consensus        84 A~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~---~~~~~~~~~~~~~~  160 (519)
                      |.++|++|.+||..+||.+|.+|++.|++++|+++|++|.+.|+.||..+|+.++.+|+..+.   ..+++..+.+.+ +
T Consensus       177 A~~lf~~m~~~~~~t~n~li~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g-~  255 (697)
T PLN03081        177 ARRLFDEMPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTG-V  255 (697)
T ss_pred             HHHHHhcCCCCCeeeHHHHHHHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhC-C
Confidence            999999999999999999999999999999999999999999999999999999999999988   677777888888 9


Q ss_pred             CCchhHHHHHHHHHHhcCChHHHHHHHhcCCCCchhHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHH
Q 048578          161 NSVIHSLTRLITFYCNFGDVKSAQLLFDQMTEKNVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLVSVLSAC  240 (519)
Q Consensus       161 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~  240 (519)
                      .++..++++|+++|++.|++++|.++|+.|..+|+.+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|
T Consensus       256 ~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~  335 (697)
T PLN03081        256 VGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIF  335 (697)
T ss_pred             CccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCChHHHHHHHHHHHHcCCCcchhHHHHHHHHHHhcCCHHHHHHHHhhcCCCChhhHHHHHHHHHHcCChHHHHHHHH
Q 048578          241 ANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEKNVCTWNSIIGGLAIHGCGEEAVKMFW  320 (519)
Q Consensus       241 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~  320 (519)
                      ++.|+++.|.+++..+.+.|++++..++++|+++|++.|++++|.++|++|.++|..+||+||.+|++.|+.++|+++|+
T Consensus       336 ~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~  415 (697)
T PLN03081        336 SRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFE  415 (697)
T ss_pred             HhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHcHHhcCCCCChhHHHHHHHHHHhcCChHHHHHHHHhCCCCCCHH
Q 048578          321 QMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAV  400 (519)
Q Consensus       321 ~m~~~g~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~p~~~  400 (519)
                      +|.+.|+.||..||+.++.+|++.|++++|.++|+.|.+++|+.|+..+|+.++++|++.|++++|.+++++|++.|+..
T Consensus       416 ~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~  495 (697)
T PLN03081        416 RMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVN  495 (697)
T ss_pred             HHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHH
Confidence            99999999999999999999999999999999999999878999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHccccCCCCHHHHHHHHHHHHhhCCCCCchHHHHHHHHHhcCCchHHHHHHHHHHhCCCccCCcccEEEECC
Q 048578          401 LWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNIVKNPGCSVIEIND  480 (519)
Q Consensus       401 ~~~~ll~~~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~  480 (519)
                      +|++++.+|..   +|+++.|..+++++.+.+|++...|..++.+|.+.|+|++|.+++++|+++|+++.|+++|+++.+
T Consensus       496 ~~~~Ll~a~~~---~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~  572 (697)
T PLN03081        496 MWAALLTACRI---HKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKK  572 (697)
T ss_pred             HHHHHHHHHHH---cCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECC
Confidence            99999999999   999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEEeCCCCCCChhHHHHHHHHHHHHHHhcccCCCCC
Q 048578          481 VVHEFMVGDGRHPCSEEIYSMLEYVAISLREECYAARMP  519 (519)
Q Consensus       481 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~  519 (519)
                      .++.|.++...||+.+++++.+.++...|++.||.|||.
T Consensus       573 ~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~gy~~~~~  611 (697)
T PLN03081        573 QDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEEN  611 (697)
T ss_pred             eEEEEccCCCCCccHHHHHHHHHHHHHHHHHcCCCCCcc
Confidence            999999999999999999999999999999999999973



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 58.7 bits (140), Expect = 3e-09
 Identities = 25/191 (13%), Positives = 60/191 (31%), Gaps = 7/191 (3%)

Query: 216 DLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMY 275
            L    R +     E  L  +L       + ++ +      ++  +    +   A     
Sbjct: 78  CLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCC 137

Query: 276 AKCGYIEEALRVFKIVLEK-------NVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIK 328
                +  A  +  +   +        +  +N+++ G A  G  +E V + + ++ +G+ 
Sbjct: 138 LLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLT 197

Query: 329 PDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLCRARLLDEAYE 388
           PD ++  A L             E          ++        L+    RA +L   ++
Sbjct: 198 PDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHK 257

Query: 389 VIRNMPMEPNA 399
           V     + P  
Sbjct: 258 VKPTFSLPPQL 268


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query519
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.66
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.58
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.56
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.56
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.54
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.53
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.5
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.46
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.43
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.38
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.38
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.37
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.35
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.3
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.3
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.27
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.19
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.17
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.11
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.05
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.97
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.96
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.93
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.92
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.9
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.88
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.86
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.86
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.84
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.82
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.78
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.77
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.76
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.71
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.71
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.68
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.66
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.66
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.65
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.61
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.6
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.58
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.55
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.53
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.53
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.51
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.5
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.5
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.5
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.5
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.5
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.48
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.48
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.48
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.48
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.47
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.46
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.45
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.44
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.4
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.37
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.36
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.33
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.32
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.31
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.3
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.3
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.3
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.28
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.27
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.27
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.23
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.21
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.21
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.2
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.2
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.18
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.18
3k9i_A117 BH0479 protein; putative protein binding protein, 98.17
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.16
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.16
3k9i_A117 BH0479 protein; putative protein binding protein, 98.09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.01
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.01
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.99
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.88
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.88
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.84
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.81
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.7
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.64
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.62
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.53
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.45
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.41
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 97.4
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.33
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.3
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.28
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.22
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.2
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.2
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.02
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.01
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.0
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.96
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.86
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.83
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.82
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.8
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.75
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.73
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.53
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.38
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.18
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.16
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.86
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.63
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.61
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.51
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.45
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.32
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.59
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.46
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.53
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.34
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.04
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.01
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.97
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.26
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.12
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.12
2uwj_G115 Type III export protein PSCG; virulence, chaperone 91.44
2p58_C116 Putative type III secretion protein YSCG; type III 91.21
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.19
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.8
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.4
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.12
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.75
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.61
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.52
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.79
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.52
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 87.44
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 87.37
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.04
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 85.54
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 85.28
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.19
2p58_C116 Putative type III secretion protein YSCG; type III 84.92
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 82.97
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 82.02
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.16
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=6e-37  Score=313.26  Aligned_cols=427  Identities=10%  Similarity=-0.008  Sum_probs=366.8

Q ss_pred             CCcccHHHHHHhcc---CchHHHHHHHHHHHhcCCCCchhHHHHHHHHHhhcCCCChHHHHHHHhcC--CCCCcchHHHH
Q 048578           28 TKSHHHLPLLQKCT---HLVQFKQVHAQIIKASFDNRTISDTQLAKLIESLVNSSQIAYAHLVFNQI--INPSTFAFNTV  102 (519)
Q Consensus        28 p~~~~~~~~l~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~A~~~~~~~--~~~~~~~~~~l  102 (519)
                      |+...|+.++..+.   ....+..+++.+.+  ..|+..++..++..|.+.   |++++|..+|+.+  ..++..+++.+
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~---g~~~~A~~~~~~~~~~~~~~~~~~~l  156 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCT---GDYARAKCLLTKEDLYNRSSACRYLA  156 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHT---TCHHHHHHHHHHTCGGGTCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHc---CcHHHHHHHHHHHhccccchhHHHHH
Confidence            56667777877764   45555777777774  456778889999999999   9999999999998  56888999999


Q ss_pred             HHHHHhcCChhHHHHHHHHHHhC---------------CCCCCcchHHHHHHHHcCccchHHHHHHHHHhCCCCCc-hhH
Q 048578          103 IRGYAEAGLGHRGIQLYTQMIGN---------------GLDPDSFTYPILLKACGDLRQVKGVHSLVVKSKDFNSV-IHS  166 (519)
Q Consensus       103 l~~~~~~g~~~~a~~~~~~m~~~---------------g~~p~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  166 (519)
                      +.+|.+.|++++|+++|+++...               |.+++..+|+.+..++.+.|+.+++.+.+.+.....|+ ...
T Consensus       157 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~  236 (597)
T 2xpi_A          157 AFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEA  236 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHH
Confidence            99999999999999999953221               22345779999999999999966666665543222332 222


Q ss_pred             H--------------------------------------HHHHHHHHhcCChHHHHHHHhcCCC--CchhHHHHHHHHHH
Q 048578          167 L--------------------------------------TRLITFYCNFGDVKSAQLLFDQMTE--KNVVTWTAMINGHV  206 (519)
Q Consensus       167 ~--------------------------------------~~l~~~~~~~g~~~~A~~~~~~~~~--~~~~~~~~li~~~~  206 (519)
                      +                                      +.++..|.+.|++++|.++|+++.+  ++..+|+.++.+|.
T Consensus       237 ~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~  316 (597)
T 2xpi_A          237 FDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLF  316 (597)
T ss_dssp             HHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHH
T ss_pred             HHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHH
Confidence            2                                      2235567788999999999999988  78999999999999


Q ss_pred             HcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCcchhHHHHHHHHHHhcCCHHHHHH
Q 048578          207 KQKNYREGIDLFRKMRDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALR  286 (519)
Q Consensus       207 ~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~  286 (519)
                      +.|++++|.++|+++.+.+ +.+..++..++.++.+.|++++|..+++.+.+.. +.+..++..++.+|.+.|++++|.+
T Consensus       317 ~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~  394 (597)
T 2xpi_A          317 VRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARR  394 (597)
T ss_dssp             HTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             HhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHH
Confidence            9999999999999999875 3377789999999999999999999999999765 6678899999999999999999999


Q ss_pred             HHhhcCC---CChhhHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHcHHhcCC
Q 048578          287 VFKIVLE---KNVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKV  363 (519)
Q Consensus       287 ~~~~~~~---~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~  363 (519)
                      +|+++.+   .+..+|+.++.++.+.|++++|+++|+++.+.+ +.+..++..++.+|.+.|++++|.++|+++.+.  .
T Consensus       395 ~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~  471 (597)
T 2xpi_A          395 YFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--F  471 (597)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--C
T ss_pred             HHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--C
Confidence            9998853   467899999999999999999999999999864 557789999999999999999999999999883  4


Q ss_pred             CCChhHHHHHHHHHHhcCChHHHHHHHHhC-------CCCCC--HHHHHHHHHHHccccCCCCHHHHHHHHHHHHhhCCC
Q 048578          364 EPNVKHYGCLVDLLCRARLLDEAYEVIRNM-------PMEPN--AVLWGSLLTACASADDGANVELAEIAMERLIKLEPF  434 (519)
Q Consensus       364 ~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~-------~~~p~--~~~~~~ll~~~~~~~~~~~~~~a~~~~~~~~~~~p~  434 (519)
                      +.+..+|+.++.+|.+.|++++|.++|+++       +..|+  ..+|..+..+|..   .|++++|.+.++++.+.+|+
T Consensus       472 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~---~g~~~~A~~~~~~~~~~~p~  548 (597)
T 2xpi_A          472 QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRK---LKMYDAAIDALNQGLLLSTN  548 (597)
T ss_dssp             CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHH---TTCHHHHHHHHHHHHHHSSC
T ss_pred             CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHH---hcCHHHHHHHHHHHHHhCCC
Confidence            557889999999999999999999999988       45787  7899999999999   99999999999999999999


Q ss_pred             CCchHHHHHHHHHhcCCchHHHHHHHHHHhCCC
Q 048578          435 NDGNYVLMSNIYAAKAQWDDAGKMRRLMKERNI  467 (519)
Q Consensus       435 ~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~  467 (519)
                      ++.+|..++.+|.+.|++++|.+.++++.+.+.
T Consensus       549 ~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p  581 (597)
T 2xpi_A          549 DANVHTAIALVYLHKKIPGLAITHLHESLAISP  581 (597)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             ChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCC
Confidence            999999999999999999999999999987543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 519
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.9 bits (89), Expect = 0.001
 Identities = 36/287 (12%), Positives = 78/287 (27%), Gaps = 8/287 (2%)

Query: 178 GDVKSAQLLFDQMTEK---NVVTWTAMINGHVKQKNYREGIDLFRKMRDSGVEVNELTLV 234
           GD ++A+    Q+  +   N      + + H + +                         
Sbjct: 13  GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYS 71

Query: 235 SVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLEK 294
           ++ +     G  +     +    +      D        + A              +   
Sbjct: 72  NLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN 131

Query: 295 NVCTWNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIF 354
                     G  +   G         ++    +P+     + L    +A    +     
Sbjct: 132 PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNA--QGEIWLAI 189

Query: 355 YNMRRDYKVEPN-VKHYGCLVDLLCRARLLDEAYEVIRNMPMEPNAVLWGSLLTACASAD 413
           ++  +   ++PN +  Y  L ++L  AR+ D A                     AC   +
Sbjct: 190 HHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYE 249

Query: 414 DGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAGKMRR 460
            G  ++LA     R I+L+P     Y  ++N    K    +A     
Sbjct: 250 QG-LIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYN 295


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query519
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.61
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.26
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.19
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.16
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.14
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.14
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.13
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.1
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.07
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.92
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.71
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.68
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.62
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.6
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.45
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.44
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.43
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.31
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.15
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.14
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.13
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.06
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.03
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.99
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.91
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.89
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.73
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.61
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.6
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.57
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.51
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.49
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.41
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.29
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.29
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.02
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.89
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.93
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.79
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.25
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.0
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.04
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.92
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.1
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 82.44
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1.7e-20  Score=177.76  Aligned_cols=352  Identities=12%  Similarity=0.010  Sum_probs=185.6

Q ss_pred             HHHHHHhhcCCCChHHHHHHHhcCCC---CCcchHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCcchHHHHHHHHcCc
Q 048578           68 LAKLIESLVNSSQIAYAHLVFNQIIN---PSTFAFNTVIRGYAEAGLGHRGIQLYTQMIGNGLDPDSFTYPILLKACGDL  144 (519)
Q Consensus        68 ll~~~~~~~~~~~~~~A~~~~~~~~~---~~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~  144 (519)
                      +...+.+.   |++++|.+.|+++.+   .+..++..+...|.+.|++++|+..|++..+..  |+              
T Consensus         5 la~~~~~~---G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~--p~--------------   65 (388)
T d1w3ba_           5 LAHREYQA---GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN--PL--------------   65 (388)
T ss_dssp             HHHHHHHH---TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TT--------------
T ss_pred             HHHHHHHc---CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--CC--------------
Confidence            34455666   889999988888732   346678888888888899999999888887631  22              


Q ss_pred             cchHHHHHHHHHhCCCCCchhHHHHHHHHHHhcCChHHHHHHHhcCCC---CchhHHHHHHHHHHHcCChhHHHHHHHHH
Q 048578          145 RQVKGVHSLVVKSKDFNSVIHSLTRLITFYCNFGDVKSAQLLFDQMTE---KNVVTWTAMINGHVKQKNYREGIDLFRKM  221 (519)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~~~~~~a~~~~~~m  221 (519)
                                        +..++..+..+|.+.|++++|...+.....   .+...+..........+....+.......
T Consensus        66 ------------------~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  127 (388)
T d1w3ba_          66 ------------------LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSA  127 (388)
T ss_dssp             ------------------CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHH
T ss_pred             ------------------CHHHHHHHHHHhhhhccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                              233444455555555555555555555433   22223333333333444444444433333


Q ss_pred             HhCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCcchhHHHHHHHHHHhcCCHHHHHHHHhhcCC---CChhh
Q 048578          222 RDSGVEVNELTLVSVLSACANLGASELGKWVHEFVNKNCIILNDKLGAALTDMYAKCGYIEEALRVFKIVLE---KNVCT  298 (519)
Q Consensus       222 ~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~---~~~~~  298 (519)
                      .... .................+....+...+....... +.+...+..+...+...|++++|...+++..+   .+..+
T Consensus       128 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~  205 (388)
T d1w3ba_         128 LQYN-PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDA  205 (388)
T ss_dssp             HHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             cccc-cccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHH
Confidence            3322 1222223333333444444444444444444432 33344445555555555555555555554422   23344


Q ss_pred             HHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHcHHhcCCCCChhHHHHHHHHHH
Q 048578          299 WNSIIGGLAIHGCGEEAVKMFWQMQMSGIKPDDVTLIAVLTACSHAGLIEKGKEIFYNMRRDYKVEPNVKHYGCLVDLLC  378 (519)
Q Consensus       299 ~~~l~~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~  378 (519)
                      |..+...+...|++++|...+++....+ ..+...+..+..++.+.|++++|...|++..+  ..+.+..++..+...+.
T Consensus       206 ~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~  282 (388)
T d1w3ba_         206 YINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALK  282 (388)
T ss_dssp             HHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHH
T ss_pred             HHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHH
Confidence            5555555555555555555555554432 23344455555555555555555555555554  12233445555555555


Q ss_pred             hcCChHHHHHHHHhC--CCCCCHHHHHHHHHHHccccCCCCHHHHHHHHHHHHhhCCCCCchHHHHHHHHHhcCCchHHH
Q 048578          379 RARLLDEAYEVIRNM--PMEPNAVLWGSLLTACASADDGANVELAEIAMERLIKLEPFNDGNYVLMSNIYAAKAQWDDAG  456 (519)
Q Consensus       379 ~~~~~~~A~~~~~~~--~~~p~~~~~~~ll~~~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~  456 (519)
                      ..|++++|.+.++..  ..+.+...+..+...+..   .|++++|...++++++..|+++.++..++.+|.+.|++++|.
T Consensus       283 ~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~---~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~  359 (388)
T d1w3ba_         283 EKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE---QGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL  359 (388)
T ss_dssp             HHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHT---TTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHH
T ss_pred             HcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHH---CCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHH
Confidence            555555555555554  212234444455555555   555555555555555555555555555555555555555555


Q ss_pred             HHHHHHHh
Q 048578          457 KMRRLMKE  464 (519)
Q Consensus       457 ~~~~~m~~  464 (519)
                      +.|++..+
T Consensus       360 ~~~~~al~  367 (388)
T d1w3ba_         360 MHYKEAIR  367 (388)
T ss_dssp             HHHHHHHT
T ss_pred             HHHHHHHH
Confidence            55555543



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure