Citrus Sinensis ID: 048617

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MSPEPGPKPIQSSGSIKIINPPASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPEEGEFCTEEAEEYADSSAADKALFVKRHYWKWRRAMRELRID
cccccccccccccccccccccHHHHHHHHHEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHcccEEEEcccccEEEEEEEEEEEEEccccEEEEcEEEccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccEEEEEEEEEEEEEccccccccEEEEcccccccccccccEEEEEEEEEEEccHHHHccc
cccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHccccEcccccccEEEEEEEEEEEEccccEEEEEEEEEcccccEcccccccHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHccc
mspepgpkpiqssgsikiinppaSILAAFSVLCLFtcskpynttstlkipfltfpsnprrflkipimsrtnhqlhhhsfatpqslsdwlkprlpsdsfaswgvkpgtknvhNLWLelsdgetcladaippvrtvNVVTVRIIGKDNQILVESHqelsdgsvrnrcrplaekmksnetpEEAVIRAVKEELGSilndsitvrivpgsyskkldernslsypglparyVLHSVDAfvdglpeegefcTEEAEEYADSSAADKALFVKRHYWKWRRAMRELRID
mspepgpkpiqssgsiKIINPPASILAAFSVLCLFTCSKPYnttstlkipfltfpsnPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKdnqilveshqelsdgsvrnrCRPLaekmksnetpeeAVIRAVKEElgsilndsitvrivpgsyskkldernSLSYPGLPARYVLHSVDAFVDGLPEEGEFCTEEAEeyadssaadkalFVKRHYWKWRRAMRELRID
MSPEPGPKPIQSSGSIKIINPPASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIppvrtvnvvtvriiGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPeegefcteeaeeyadssaadKALFVKRHYWKWRRAMRELRID
***************IKIINPPASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFAT**SLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILV*******************************VIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPEEGEFCTEE***Y****AADKALFVKRHYWKWRRAM******
****************KIINPPASILAAFSVLCLFTCSKPY***STLKIPFLTFPSNPRRFL*********************SLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILVESHQE********************ETPEEAVIRAVKEELGSILNDSITVRIVPG************SYPGLPARYVLHSVDAFVDGLPEEGEFCT*************KALFVKRHYWKWRRAMR*****
***********SSGSIKIINPPASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPEEGEF***********SAADKALFVKRHYWKWRRAMRELRID
******PKPI*SSGSIKIINPPASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPEEGEFC************ADKALFVKRHYWKWRRAMRELR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPEPGPKPIQSSGSIKIINPPASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPEEGEFCTEEAEEYADSSAADKALFVKRHYWKWRRAMRELRID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
255566896278 conserved hypothetical protein [Ricinus 0.782 0.791 0.731 3e-85
359490753292 PREDICTED: uncharacterized protein LOC10 0.879 0.845 0.664 6e-84
224134953216 predicted protein [Populus trichocarpa] 0.722 0.939 0.690 7e-79
297808463295 hypothetical protein ARALYDRAFT_489310 [ 0.861 0.820 0.625 1e-75
357464217293 hypothetical protein MTR_3g092810 [Medic 0.943 0.904 0.569 4e-74
356509151292 PREDICTED: uncharacterized protein LOC10 0.871 0.839 0.549 6e-73
15238541300 uncharacterized protein [Arabidopsis tha 0.871 0.816 0.618 1e-72
449456435294 PREDICTED: uncharacterized protein LOC10 0.786 0.751 0.608 1e-72
449497388294 PREDICTED: uncharacterized protein LOC10 0.786 0.751 0.608 3e-72
356516158291 PREDICTED: uncharacterized protein LOC10 0.871 0.841 0.551 1e-71
>gi|255566896|ref|XP_002524431.1| conserved hypothetical protein [Ricinus communis] gi|223536315|gb|EEF37966.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 192/227 (84%), Gaps = 7/227 (3%)

Query: 48  KIPFLTFPSNPRRFLKIPIMSRTNHQLHHHSFATPQSLSDWLKPRLPSDSFASWGVKPGT 107
           +IPF+  PSN RRFLK+P MS + +   +H FATPQSLSDWLKPRLPSDSFASWGVKPGT
Sbjct: 50  RIPFICLPSNRRRFLKVPAMSISKN---NHPFATPQSLSDWLKPRLPSDSFASWGVKPGT 106

Query: 108 KNVHNLWLELSDGETCLADAIPPVRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRP 167
           KNV NLWLELS+GET LAD+ PP+RTV+VVTVR+IG+ N +LVESHQELSDGSVRNRCRP
Sbjct: 107 KNVQNLWLELSEGETSLADSTPPIRTVSVVTVRVIGEKNTVLVESHQELSDGSVRNRCRP 166

Query: 168 LAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYV 227
           L+EKMK NETPE AV RA+KEELGSILND   VRIV GSY +K++ERNSLSYPGLPARYV
Sbjct: 167 LSEKMKPNETPEAAVFRAIKEELGSILNDDANVRIVDGSYKEKIEERNSLSYPGLPARYV 226

Query: 228 LHSVDAFVDGLPEEGEFCTEEAEEYADSS---AADKALFVKRHYWKW 271
           L+S+D  VDGLP + EF TEE EEY+DS     ADKA+ V++H+WKW
Sbjct: 227 LYSMDVIVDGLPND-EFSTEEVEEYSDSEDKRTADKAVSVRKHFWKW 272

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359490753|ref|XP_003634156.1| PREDICTED: uncharacterized protein LOC100854009 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134953|ref|XP_002321946.1| predicted protein [Populus trichocarpa] gi|224134957|ref|XP_002321947.1| predicted protein [Populus trichocarpa] gi|222868942|gb|EEF06073.1| predicted protein [Populus trichocarpa] gi|222868943|gb|EEF06074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297808463|ref|XP_002872115.1| hypothetical protein ARALYDRAFT_489310 [Arabidopsis lyrata subsp. lyrata] gi|297317952|gb|EFH48374.1| hypothetical protein ARALYDRAFT_489310 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357464217|ref|XP_003602390.1| hypothetical protein MTR_3g092810 [Medicago truncatula] gi|355491438|gb|AES72641.1| hypothetical protein MTR_3g092810 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356509151|ref|XP_003523315.1| PREDICTED: uncharacterized protein LOC100783319 [Glycine max] Back     alignment and taxonomy information
>gi|15238541|ref|NP_197834.1| uncharacterized protein [Arabidopsis thaliana] gi|9758534|dbj|BAB08929.1| unnamed protein product [Arabidopsis thaliana] gi|17065180|gb|AAL32744.1| Unknown protein [Arabidopsis thaliana] gi|20259932|gb|AAM13313.1| unknown protein [Arabidopsis thaliana] gi|332005930|gb|AED93313.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449456435|ref|XP_004145955.1| PREDICTED: uncharacterized protein LOC101208896 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449497388|ref|XP_004160388.1| PREDICTED: uncharacterized protein LOC101231604 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356516158|ref|XP_003526763.1| PREDICTED: uncharacterized protein LOC100804392 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
TAIR|locus:2184002300 AT5G24460 [Arabidopsis thalian 0.875 0.82 0.526 7.9e-62
TAIR|locus:2184002 AT5G24460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 632 (227.5 bits), Expect = 7.9e-62, P = 7.9e-62
 Identities = 139/264 (52%), Positives = 171/264 (64%)

Query:    22 PASILAAFSVLCLFTCSKPYNTTSTLKIPFLTFPSNPRRFLKIPIMSRTNHQLHHHS--F 79
             P   LAA S+L L++  KP  +    +    +FP NPRR   I  MSR +      +  F
Sbjct:    33 PDIFLAAVSLLFLWSSPKPLVSLPPNRF---SFPLNPRR-RSITAMSRRSPPPPPPTQRF 88

Query:    80 ATPQSLSDWLKPRLPSDSFASWGVKPGTKNVHNLWLELSDGETCLADAXXXXXXXXXXXX 139
             A PQSLSDWL+ RLPSDSFA+WGVKPGTKNVHNLWLELSDGET LAD+            
Sbjct:    89 ANPQSLSDWLESRLPSDSFAAWGVKPGTKNVHNLWLELSDGETSLADSTPPVRTVNVVTV 148

Query:   140 XXIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILN---D 196
               IGK+ +ILVE+HQELSDGS+R R RPL+EKMK  E+P+EAV RA+KEELGSI N   D
Sbjct:   149 RVIGKNGRILVEAHQELSDGSIRERFRPLSEKMKPEESPDEAVFRAIKEELGSIFNGDGD 208

Query:   197 SI--TVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPXXXXXXXX------- 247
             +I   ++I+PG+Y+++++ERNSLSYPGLPARY LHSV+A V+GLP               
Sbjct:   209 NIGQRIKILPGTYNRRVEERNSLSYPGLPARYALHSVNATVEGLPEQDFCTEEKEYEGGD 268

Query:   248 XXXXXXXXXXXXKALFVKRHYWKW 271
                          A+ VKRHYWKW
Sbjct:   269 STKDSVETLAAGNAVTVKRHYWKW 292


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.134   0.409    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      281       247   0.00078  114 3  11 22  0.45    33
                                                     32  0.46    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  617 (66 KB)
  Total size of DFA:  204 KB (2114 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  22.45u 0.08s 22.53t   Elapsed:  00:00:02
  Total cpu time:  22.45u 0.08s 22.53t   Elapsed:  00:00:03
  Start:  Sat May 11 10:16:34 2013   End:  Sat May 11 10:16:37 2013
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005618 "cell wall" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037167001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (407 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
cd03427137 cd03427, MTH1, MutT homolog-1 (MTH1) is a member o 0.002
>gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information 
 Score = 37.2 bits (87), Expect = 0.002
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 171 KMKSNETPEEAVIRAVKEELGSILND 196
           K++  ETPEE  IR +KEE G  +++
Sbjct: 34  KVEPGETPEECAIRELKEETGLTIDN 59

MTH1, the mammalian counterpart of MutT, hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates, thereby preventing the incorporation of such oxygen radicals during replication. This is an important step in the repair mechanism in genomic and mitochondrial DNA. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity, and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. MTH1 is predominantly localized in the cytoplasm and mitochondria. Structurally, this enzyme adopts a similar fold to MutT despite low sequence similarity outside the conserved nudix motif. The most distinctive structural difference between MutT and MTH1 is the presence of a beta-hairpin, which is absent in MutT. This results in a much deeper and narrower substrate binding pocket. Mechanistically, MTH1 contains dual specificity for nucleotides that contain 2-OH-adenine bases and those that contain 8-oxo-guanine bases. Length = 137

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.67
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.63
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.63
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.62
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.61
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.6
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.58
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.57
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.57
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.56
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.56
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.56
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.55
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.55
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.54
PLN02325144 nudix hydrolase 99.52
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.52
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.52
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.51
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.5
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.5
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.5
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.49
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.48
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.48
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.47
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.46
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.46
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.46
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.46
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.45
PRK08999 312 hypothetical protein; Provisional 99.45
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.45
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.43
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.43
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.41
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.41
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.41
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.4
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.4
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.39
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.39
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.38
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.38
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.38
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.38
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.37
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.37
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.36
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.35
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.34
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.33
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.32
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.3
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.29
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.28
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.27
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.25
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.23
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.23
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.23
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.2
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.2
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.19
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.17
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.16
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 99.15
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.13
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.1
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 99.06
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.99
PLN03143291 nudix hydrolase; Provisional 98.98
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 98.94
PRK10707190 putative NUDIX hydrolase; Provisional 98.9
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 98.9
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 98.89
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 98.74
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.55
PLN02791 770 Nudix hydrolase homolog 98.51
PLN02709222 nudix hydrolase 98.49
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 98.44
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.36
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 98.31
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 98.26
PLN02552247 isopentenyl-diphosphate delta-isomerase 98.01
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 97.84
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 97.69
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 97.25
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 97.18
PLN02839372 nudix hydrolase 96.24
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 96.14
PRK10880350 adenine DNA glycosylase; Provisional 94.5
KOG4195275 consensus Transient receptor potential-related cha 94.18
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 92.95
TIGR01084275 mutY A/G-specific adenine glycosylase. This equiva 92.63
COG4112203 Predicted phosphoesterase (MutT family) [General f 91.81
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 86.96
PRK13910289 DNA glycosylase MutY; Provisional 84.42
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information 
Probab=99.67  E-value=5.8e-16  Score=122.49  Aligned_cols=92  Identities=22%  Similarity=0.264  Sum_probs=67.8

Q ss_pred             eeEEEEEEEEEEecCCcEEEEeecccCCCcccccCCCCCcccCCCCCHHHHHHHHHHHHhCccccCCceEEeeCCCcccc
Q 048617          131 VRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKK  210 (281)
Q Consensus       131 ~R~V~Vvva~I~~~~GriLIe~RqefpgG~vR~RWEfPGGKvepGEt~eeAl~REi~EELGi~v~~~~~V~Vl~gsy~~~  210 (281)
                      ++.|++++++| +++|+||+.+|+  .+|..++.|+|||||+++|||+++|+.||++||+|+.+.....+          
T Consensus         1 ~~~~~~~~~ii-~~~~~vLL~~R~--~~~~~~g~w~~PgG~ve~gE~~~~a~~RE~~EE~Gl~~~~~~~~----------   67 (135)
T PRK10546          1 MKMIDVVAAII-ERDGKILLAQRP--AHSDQAGLWEFAGGKVEPGESQPQALIRELREELGIEATVGEYV----------   67 (135)
T ss_pred             CCeEEEEEEEE-ecCCEEEEEEcc--CCCCCCCcEECCcccCCCCCCHHHHHHHHHHHHHCCccccceeE----------
Confidence            34577777766 567899999997  56667899999999999999999999999999999997643221          


Q ss_pred             cccccCCCCCCCccEEEEEEEEEEe-cCCC
Q 048617          211 LDERNSLSYPGLPARYVLHSVDAFV-DGLP  239 (281)
Q Consensus       211 ~e~r~S~SYPGL~vryvLh~v~a~V-~GlP  239 (281)
                        ....|.+.+..  +.++.+.+.. .|.+
T Consensus        68 --~~~~~~~~~~~--~~~~~~~~~~~~~~~   93 (135)
T PRK10546         68 --ASHQREVSGRR--IHLHAWHVPDFHGEL   93 (135)
T ss_pred             --EEEEEecCCcE--EEEEEEEEEEecCcc
Confidence              12234455554  6677776654 3443

>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 8e-06
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 1e-05
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 5e-05
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 5e-05
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 1e-04
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 3e-04
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 7e-04
3f13_A163 Putative nudix hydrolase family member; structural 9e-04
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 Back     alignment and structure
 Score = 43.8 bits (104), Expect = 8e-06
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 17/72 (23%)

Query: 127 AIPPVRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLA---E----KMKSNETPE 179
            I     + VV    + KD +ILV           R     LA   E    K+++ ETPE
Sbjct: 15  KIRKGHWIPVVAG-FLRKDGKILVGQ---------RPENNSLAGQWEFPGGKIENGETPE 64

Query: 180 EAVIRAVKEELG 191
           EA+ R + EELG
Sbjct: 65  EALARELNEELG 76
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.69
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.68
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.67
3grn_A153 MUTT related protein; structural genomics, hydrola 99.66
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.66
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.66
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.64
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.64
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.63
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.62
3exq_A161 Nudix family hydrolase; protein structure initiati 99.62
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.62
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.62
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.6
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.6
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.6
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.59
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.59
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.59
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.57
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.57
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.57
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.55
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.55
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.55
3f13_A163 Putative nudix hydrolase family member; structural 99.55
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.54
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.53
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.52
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.52
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.52
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.52
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.5
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.5
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.5
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.49
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.48
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.47
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.46
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.46
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.45
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.45
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.45
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.45
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.43
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.42
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.41
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.41
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.39
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.39
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.39
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.39
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.38
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.36
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.36
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.35
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.35
2fb1_A226 Conserved hypothetical protein; structural genomic 99.34
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.32
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.31
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.29
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.27
2fml_A273 MUTT/nudix family protein; structural genomics, PS 99.25
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.23
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.22
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 99.17
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.12
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.12
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.02
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.02
3bho_A208 Cleavage and polyadenylation specificity factor su 99.01
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.98
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 98.92
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.74
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 98.68
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 98.33
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.13
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
Probab=99.69  E-value=8.8e-17  Score=125.39  Aligned_cols=93  Identities=16%  Similarity=0.180  Sum_probs=67.7

Q ss_pred             eeEEEEEEEEEEecCCcEEEEeecccCCCc--ccccCCCCCcccCCCCCHHHHHHHHHHHHhCccccCCceEEeeCCCcc
Q 048617          131 VRTVNVVTVRIIGKDNQILVESHQELSDGS--VRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYS  208 (281)
Q Consensus       131 ~R~V~Vvva~I~~~~GriLIe~RqefpgG~--vR~RWEfPGGKvepGEt~eeAl~REi~EELGi~v~~~~~V~Vl~gsy~  208 (281)
                      ++.+.+|+++|.+ +|+||+.+|.  .++.  ..+.|.||||++++|||+++|+.||++||+|+.+.....+        
T Consensus         3 ~~~~~~v~~vi~~-~~~vLL~~r~--~~~~~~~~g~w~lPgG~ve~gE~~~~aa~REl~EE~Gl~~~~~~~~--------   71 (140)
T 3gwy_A            3 LKSIEVVAAVIRL-GEKYLCVQRG--QTKFSYTSFRYEFPGGKVEEGESLQEALQREIMEEMDYVIEVGEKL--------   71 (140)
T ss_dssp             CSCEEEEEEEEEE-TTEEEEEEC-----------CCEECSEEECCTTCCHHHHHHHHHHHHHCCCEEEEEEE--------
T ss_pred             ceEEEEEEEEEEe-CCEEEEEEec--CCCCCCCCCeEECCCccCCCCCCHHHHHHHHHHHhhCcEEEeceEE--------
Confidence            4567788888877 8899999997  4454  6789999999999999999999999999999998733221        


Q ss_pred             cccccccCCCCCCCccEEEEEEEEEEe-cCCCC
Q 048617          209 KKLDERNSLSYPGLPARYVLHSVDAFV-DGLPE  240 (281)
Q Consensus       209 ~~~e~r~S~SYPGL~vryvLh~v~a~V-~GlPe  240 (281)
                          ....+.|++..  +.++.|.|.+ .|.|.
T Consensus        72 ----~~~~~~~~~~~--~~~~~f~~~~~~~~~~   98 (140)
T 3gwy_A           72 ----LTVHHTYPDFE--ITMHAFLCHPVGQRYV   98 (140)
T ss_dssp             ----EEEECCCSSCC--EEEEEEEEEECCSCCC
T ss_pred             ----EEEEEEeCCce--EEEEEEEEEecCCccc
Confidence                12345677665  7788888876 44443
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1ryaa_160 d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD 0.002
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: GDP-mannose mannosyl hydrolase NudD
domain: GDP-mannose mannosyl hydrolase NudD
species: Escherichia coli [TaxId: 562]

 Score = 36.4 bits (83), Expect = 0.002
 Identities = 20/125 (16%), Positives = 43/125 (34%), Gaps = 11/125 (8%)

Query: 131 VRTVNVVTVRII--GKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKE 188
           VR+  +V++  I      + L+    + ++   +        +++ +ET E A  R    
Sbjct: 13  VRSTPLVSLDFIVENSRGEFLL---GKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMA 69

Query: 189 ELGSILNDSITVRIVPGSYSKKLDERNSLSYPGLPARYVLHSVDAFVDGLPEEGEFCTEE 248
           ELG      + + I  G +          ++ G         +        EE     E+
Sbjct: 70  ELG------LRLPITAGQFYGVWQHFYDDNFSGTDFTTHYVVLGFRFRVSEEELLLPDEQ 123

Query: 249 AEEYA 253
            ++Y 
Sbjct: 124 HDDYR 128

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.82
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.71
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.67
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.6
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.6
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.59
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.59
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.57
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.57
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.57
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.5
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.49
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.44
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.42
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.4
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.38
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.36
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.35
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 99.33
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.31
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.27
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.26
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.22
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.16
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.06
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.01
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 98.93
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.75
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 98.44
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 98.32
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Nucleoside triphosphate pyrophosphorylase (MutT)
species: Escherichia coli [TaxId: 562]

Probab=99.82  E-value=9e-21  Score=146.63  Aligned_cols=94  Identities=22%  Similarity=0.301  Sum_probs=77.7

Q ss_pred             eeEEEEEEEEEEecCCcEEEEeecccCCCcccccCCCCCcccCCCCCHHHHHHHHHHHHhCccccCCceEEeeCCCcccc
Q 048617          131 VRTVNVVTVRIIGKDNQILVESHQELSDGSVRNRCRPLAEKMKSNETPEEAVIRAVKEELGSILNDSITVRIVPGSYSKK  210 (281)
Q Consensus       131 ~R~V~Vvva~I~~~~GriLIe~RqefpgG~vR~RWEfPGGKvepGEt~eeAl~REi~EELGi~v~~~~~V~Vl~gsy~~~  210 (281)
                      |+.|+|++++|++++|++|+.+|.  .++...+.|.|||||+++|||+++|+.||++||+|+.+.....           
T Consensus         1 Mk~i~vav~ii~~~~~~vLl~~R~--~~~~~~g~W~~PgG~ve~gEs~~~a~~RE~~EE~gl~~~~~~~-----------   67 (129)
T d1puna_           1 MKKLQIAVGIIRNENNEIFITRRA--ADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSL-----------   67 (129)
T ss_dssp             CEEEEEEEEECBCTTSCEEEBCCC--SSCSCTTCCBCSCCSCTTTSCTTHHHHHHHHHTTCSCCCCCCC-----------
T ss_pred             CCccEEEEEEEEECCCEEEEEEec--CCCCCCCcEECCcceecCCCchhHHHHHHHHHHhCCcccccee-----------
Confidence            567999999999999999999997  6677889999999999999999999999999999999873322           


Q ss_pred             cccccCCCCCCCccEEEEEEEEEEe-cCCCC
Q 048617          211 LDERNSLSYPGLPARYVLHSVDAFV-DGLPE  240 (281)
Q Consensus       211 ~e~r~S~SYPGL~vryvLh~v~a~V-~GlPe  240 (281)
                       .....+.|++..  +.+|.+.|.. +|.|.
T Consensus        68 -~~~~~~~~~~~~--~~~~~~~~~~~~~~~~   95 (129)
T d1puna_          68 -FEKLEYEFPDRH--ITLWFWLVERWEGEPW   95 (129)
T ss_dssp             -SEEEEEECSSEE--EEEEEEECCCCSSCCC
T ss_pred             -eeEEeecccccc--eeEEEEEEeeccCcCC
Confidence             223456677655  8888888873 77665
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure