Citrus Sinensis ID: 048764


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MSNTTSANPSKPNKKRKTNPNPETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ
cccccccccccHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccccccHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHcccccccHHHHHHHHHccccccccccccccccEEEEEEEEcccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHccHHHcc
msnttsanpskpnkkrktnpnpetnFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLcsnsatdpslkdsalRHGFRVFDQMlsnnvipneaLVTSVARLAASKKDSDYAFELIKRMNNefnvvprlrtydpalfCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWfsgqkvngvscdlglVKNAVLkngggwhglgwigqgkwvvkrgsvdesgkccscgnqlacvdidDAETERFAQSVAALAMEQEVKANFSESQ
msnttsanpskpnkkrktnpnpeTNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLkvsagtgrVEKVYQYLQKlrstvrcvnEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGggwhglgwigqGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ
MSNTTSAnpskpnkkrktnpnpETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNgggwhglgwigqgKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ
*************************FLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQ*V*****************
*************************FLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLK**GGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAME*E*******S*
*******************PNPETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ
********************NPETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKAN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNTTSANPSKPNKKRKTNPNPETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFxxxxxxxxxxxxxxxxxxxxxSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
F4JKB6 576 Proteinaceous RNase P 3 O yes no 0.925 0.473 0.536 2e-85
Q680B9 528 Proteinaceous RNase P 2 O no no 0.966 0.539 0.547 1e-81
Q66GI4 572 Proteinaceous RNase P 1, no no 0.983 0.506 0.432 2e-53
>sp|F4JKB6|PRRP3_ARATH Proteinaceous RNase P 3 OS=Arabidopsis thaliana GN=PRORP3 PE=1 SV=1 Back     alignment and function desciption
 Score =  315 bits (807), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 161/300 (53%), Positives = 210/300 (70%), Gaps = 27/300 (9%)

Query: 23  ETNFLISLQSCTKSKDLATAISLYESAL-SLNFRLSLHHFNALLYLCSNSATDPSLKDSA 81
           E + LI+L SC+K KDL+ A++LY++A+ S + RL+  HF +LLYLCS   +DPSL+  A
Sbjct: 89  EKSLLINLHSCSKRKDLSAALALYDAAITSSDIRLNQQHFQSLLYLCSAFISDPSLQTVA 148

Query: 82  LRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNV-VPRLRTY 140
           +  GF++FD+M+S+ + PNE+ VT+VARLAA+K D DYAF+L+K +     V VPRLRTY
Sbjct: 149 IDRGFQIFDRMVSSGISPNESSVTAVARLAAAKGDGDYAFKLVKDLVAVGGVSVPRLRTY 208

Query: 141 DPALFCFCENLEAQKAYE-------------EQEITALLKVSAGTGRVEKVYQYLQKLRS 187
            PAL CFC+ LEA+K YE             E EI+ALLKVSA TGR  KVY+YLQKLR 
Sbjct: 209 APALLCFCDTLEAEKGYEVEDHMDASGIVLEEAEISALLKVSAATGRENKVYRYLQKLRE 268

Query: 188 TVRCVNEETGKIIEDWFSGQKV-----NGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWV 242
            V CV+EET K IE+WF G K      NG+  D+ L++ AVLKNGGGWHGLGW+G+GKW+
Sbjct: 269 CVGCVSEETSKAIEEWFYGVKASEVSDNGIGSDIELLRAAVLKNGGGWHGLGWVGEGKWI 328

Query: 243 VKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVK-------ANFSESQ 295
           VK+G+V  +GKC SC   LACVD ++ ETE F  S+  LAME++ K       A+FSE Q
Sbjct: 329 VKKGNVSSAGKCLSCDEHLACVDTNEVETEDFVNSLVTLAMERKAKMNSCEPMADFSEFQ 388




Endonuclease RNase P responsible for the 5' maturation of tRNA precursors. Also involved in the maturation of mRNA and small nucleolar RNA (snoRNA).
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: 6EC: .EC: 5
>sp|Q680B9|PRRP2_ARATH Proteinaceous RNase P 2 OS=Arabidopsis thaliana GN=PRORP2 PE=1 SV=1 Back     alignment and function description
>sp|Q66GI4|PRRP1_ARATH Proteinaceous RNase P 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PRORP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
224080794 557 predicted protein [Populus trichocarpa] 0.972 0.515 0.615 1e-100
356547141 550 PREDICTED: pentatricopeptide repeat-cont 0.962 0.516 0.614 5e-97
356543574 530 PREDICTED: pentatricopeptide repeat-cont 0.932 0.518 0.609 1e-95
255576329 561 multidrug resistance pump, putative [Ric 0.993 0.522 0.586 1e-95
224132016 557 predicted protein [Populus trichocarpa] 0.972 0.515 0.619 8e-95
224103055 482 predicted protein [Populus trichocarpa] 0.935 0.572 0.606 2e-94
297799862 517 predicted protein [Arabidopsis lyrata su 0.976 0.557 0.542 5e-90
449480803 538 PREDICTED: proteinaceous RNase P 3-like 0.969 0.531 0.537 8e-88
449466671 538 PREDICTED: proteinaceous RNase P 3-like 0.969 0.531 0.537 2e-87
359486225 551 PREDICTED: pentatricopeptide repeat-cont 0.922 0.493 0.553 2e-85
>gi|224080794|ref|XP_002306233.1| predicted protein [Populus trichocarpa] gi|222849197|gb|EEE86744.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/302 (61%), Positives = 224/302 (74%), Gaps = 15/302 (4%)

Query: 7   ANPSKPNKKRKTNPNPETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLY 66
           A+P+   KK K+N  PE+ F  +L   +KSKDL +AISLY++A+S N RL+ H+FN LLY
Sbjct: 2   ASPAN-KKKPKSNQTPESQFSYNLNFYSKSKDLHSAISLYDTAISQNTRLNQHNFNTLLY 60

Query: 67  LCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKR 126
           LCS S  DPS KD +L++GFRVFD M+SN + PNEA +T+VARLAA+K D DYAF+L+K 
Sbjct: 61  LCSISLNDPSTKDLSLQYGFRVFDHMVSNGIKPNEASITAVARLAAAKGDGDYAFDLVKN 120

Query: 127 MNNEFNVVPRLRTYDPALFCFCENLEAQKAYE-------------EQEITALLKVSAGTG 173
           +   +N +PRLRTYDPALFC+CE LE  KAYE             E EI ALLKVS  T 
Sbjct: 121 IG-VYNELPRLRTYDPALFCYCEKLEGDKAYEVEEHMRRIGVGLEEGEIAALLKVSVETR 179

Query: 174 RVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGL 233
           R E+VY+YLQKLR  VRCV EET K+IE WF   + NGV  D+GLV+ AV +NGGGWHGL
Sbjct: 180 REERVYEYLQKLRKMVRCVREETAKVIEHWFEVFEGNGVELDVGLVREAVSRNGGGWHGL 239

Query: 234 GWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSE 293
           GWIG+ KWVV+RGSV+  GKCC CG QL  VDIDD ETERFA+SVA LAME+EVKANFSE
Sbjct: 240 GWIGKEKWVVRRGSVNAGGKCCCCGEQLVSVDIDDDETERFAESVAGLAMEREVKANFSE 299

Query: 294 SQ 295
            Q
Sbjct: 300 FQ 301




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356547141|ref|XP_003541975.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356543574|ref|XP_003540235.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|255576329|ref|XP_002529057.1| multidrug resistance pump, putative [Ricinus communis] gi|223531469|gb|EEF33301.1| multidrug resistance pump, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224132016|ref|XP_002328164.1| predicted protein [Populus trichocarpa] gi|222837679|gb|EEE76044.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103055|ref|XP_002312906.1| predicted protein [Populus trichocarpa] gi|222849314|gb|EEE86861.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297799862|ref|XP_002867815.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313651|gb|EFH44074.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449480803|ref|XP_004156000.1| PREDICTED: proteinaceous RNase P 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449466671|ref|XP_004151049.1| PREDICTED: proteinaceous RNase P 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359486225|ref|XP_003633416.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2141662 576 PRORP3 "AT4G21900" [Arabidopsi 0.813 0.416 0.476 2.1e-52
TAIR|locus:2059824 528 PRORP2 "proteinaceous RNase P 0.813 0.454 0.484 2.1e-52
TAIR|locus:2045432 572 PRORP1 "proteinaceous RNase P 0.894 0.461 0.415 2e-49
TAIR|locus:2175178156 AT5G60430 [Arabidopsis thalian 0.261 0.493 0.441 3e-14
TAIR|locus:2141662 PRORP3 "AT4G21900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 543 (196.2 bits), Expect = 2.1e-52, P = 2.1e-52
 Identities = 122/256 (47%), Positives = 162/256 (63%)

Query:    23 ETNFLISLQSCTKSKDLATAISLYESAL-SLNFRLSLHHFNALLYLCSNSATDPSLKDSA 81
             E + LI+L SC+K KDL+ A++LY++A+ S + RL+  HF +LLYLCS   +DPSL+  A
Sbjct:    89 EKSLLINLHSCSKRKDLSAALALYDAAITSSDIRLNQQHFQSLLYLCSAFISDPSLQTVA 148

Query:    82 LRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNV-VPRLRTY 140
             +  GF++FD+M+S+ + PNE+ VT+VARLAA+K D DYAF+L+K +     V VPRLRTY
Sbjct:   149 IDRGFQIFDRMVSSGISPNESSVTAVARLAAAKGDGDYAFKLVKDLVAVGGVSVPRLRTY 208

Query:   141 DPALFCFCENLEAQKAYE-------------EQEITALLKVSAGTGRVEKVYQYLQKLRS 187
              PAL CFC+ LEA+K YE             E EI+ALLKVSA TGR  KVY+YLQKLR 
Sbjct:   209 APALLCFCDTLEAEKGYEVEDHMDASGIVLEEAEISALLKVSAATGRENKVYRYLQKLRE 268

Query:   188 TVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNXXXXXXXXXXXXXKWVVKRGS 247
              V CV+EET K IE+WF G K + VS D G+  +  L                WV +   
Sbjct:   269 CVGCVSEETSKAIEEWFYGVKASEVS-DNGIGSDIELLRAAVLKNGGGWHGLGWVGEGKW 327

Query:   248 VDESGKCCSCGNQLAC 263
             + + G   S G  L+C
Sbjct:   328 IVKKGNVSSAGKCLSC 343


GO:0005215 "transporter activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0016020 "membrane" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=IDA
GO:0001682 "tRNA 5'-leader removal" evidence=IDA
GO:0004526 "ribonuclease P activity" evidence=IDA
GO:0006397 "mRNA processing" evidence=IMP
GO:0043144 "snoRNA processing" evidence=IMP
TAIR|locus:2059824 PRORP2 "proteinaceous RNase P 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045432 PRORP1 "proteinaceous RNase P 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175178 AT5G60430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.97
PLN03218 1060 maturation of RBCL 1; Provisional 99.97
PLN03218 1060 maturation of RBCL 1; Provisional 99.97
PLN03077857 Protein ECB2; Provisional 99.97
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN03077 857 Protein ECB2; Provisional 99.95
PF1304150 PPR_2: PPR repeat family 99.59
PF1304150 PPR_2: PPR repeat family 99.46
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.41
PRK11788389 tetratricopeptide repeat protein; Provisional 99.28
PRK11788389 tetratricopeptide repeat protein; Provisional 99.18
PF1285434 PPR_1: PPR repeat 99.14
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.03
PF1285434 PPR_1: PPR repeat 98.76
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.66
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.62
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.61
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.56
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.54
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.51
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.5
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.46
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.41
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.39
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.23
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.18
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.13
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.11
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.1
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.99
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.96
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.95
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.66
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.6
PRK12370553 invasion protein regulator; Provisional 97.6
PRK12370553 invasion protein regulator; Provisional 97.57
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.51
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.5
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.5
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.48
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.46
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.43
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.33
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.33
PRK14574 822 hmsH outer membrane protein; Provisional 97.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.21
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.21
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.13
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.09
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.04
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.01
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.98
PRK11189296 lipoprotein NlpI; Provisional 96.95
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 96.94
PRK14574 822 hmsH outer membrane protein; Provisional 96.9
KOG1126638 consensus DNA-binding cell division cycle control 96.9
KOG2076 895 consensus RNA polymerase III transcription factor 96.87
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.86
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.85
PRK15359144 type III secretion system chaperone protein SscB; 96.77
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.74
KOG3941406 consensus Intermediate in Toll signal transduction 96.65
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.59
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.57
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 96.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.54
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.52
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.51
PRK10370198 formate-dependent nitrite reductase complex subuni 96.5
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.45
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.43
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.34
PRK11189296 lipoprotein NlpI; Provisional 96.23
cd05804355 StaR_like StaR_like; a well-conserved protein foun 96.14
KOG3941406 consensus Intermediate in Toll signal transduction 96.0
KOG1129478 consensus TPR repeat-containing protein [General f 95.95
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 95.87
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.79
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.71
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.7
KOG1914656 consensus mRNA cleavage and polyadenylation factor 95.61
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 95.56
PRK15359144 type III secretion system chaperone protein SscB; 95.51
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 95.5
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.38
KOG4340459 consensus Uncharacterized conserved protein [Funct 95.38
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.35
PRK10370198 formate-dependent nitrite reductase complex subuni 95.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.09
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.08
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 95.08
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.06
smart00299140 CLH Clathrin heavy chain repeat homology. 95.0
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.97
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 94.81
KOG2003840 consensus TPR repeat-containing protein [General f 94.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.69
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.65
KOG2076 895 consensus RNA polymerase III transcription factor 94.63
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 94.62
KOG0547606 consensus Translocase of outer mitochondrial membr 94.58
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.18
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.12
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 94.07
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.02
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 93.98
KOG1129478 consensus TPR repeat-containing protein [General f 93.94
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.89
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 93.77
PRK02603172 photosystem I assembly protein Ycf3; Provisional 93.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 93.75
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 93.71
KOG2003840 consensus TPR repeat-containing protein [General f 93.7
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 93.66
PF12688120 TPR_5: Tetratrico peptide repeat 93.64
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 93.62
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 92.88
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 92.86
KOG1915 677 consensus Cell cycle control protein (crooked neck 92.72
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.53
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 92.44
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.37
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 92.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 92.04
KOG4570418 consensus Uncharacterized conserved protein [Funct 91.96
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 91.68
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 91.65
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 91.33
KOG3616 1636 consensus Selective LIM binding factor [Transcript 91.06
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 91.03
CHL00033168 ycf3 photosystem I assembly protein Ycf3 91.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 90.97
COG4783484 Putative Zn-dependent protease, contains TPR repea 90.93
KOG1126638 consensus DNA-binding cell division cycle control 90.89
PRK10803263 tol-pal system protein YbgF; Provisional 90.72
KOG1914656 consensus mRNA cleavage and polyadenylation factor 90.65
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 90.63
KOG1915677 consensus Cell cycle control protein (crooked neck 90.55
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.54
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 90.49
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 90.36
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 90.22
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 90.2
PF13929292 mRNA_stabil: mRNA stabilisation 89.58
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 89.42
PF12688120 TPR_5: Tetratrico peptide repeat 89.34
KOG3616 1636 consensus Selective LIM binding factor [Transcript 89.26
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 88.83
PRK04841 903 transcriptional regulator MalT; Provisional 88.51
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.26
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 88.24
KOG2376 652 consensus Signal recognition particle, subunit Srp 88.15
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 87.98
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 87.7
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.55
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 86.94
KOG2047 835 consensus mRNA splicing factor [RNA processing and 86.9
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 86.63
smart00299140 CLH Clathrin heavy chain repeat homology. 86.23
KOG0553304 consensus TPR repeat-containing protein [General f 86.11
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 86.08
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 85.73
KOG3785557 consensus Uncharacterized conserved protein [Funct 85.51
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 85.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 85.13
KOG0547606 consensus Translocase of outer mitochondrial membr 84.92
PRK10803263 tol-pal system protein YbgF; Provisional 84.83
KOG1128777 consensus Uncharacterized conserved protein, conta 84.76
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 84.7
PRK04841903 transcriptional regulator MalT; Provisional 84.59
PRK14720 906 transcript cleavage factor/unknown domain fusion p 84.42
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 84.22
COG3629280 DnrI DNA-binding transcriptional activator of the 83.88
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 83.61
KOG2376652 consensus Signal recognition particle, subunit Srp 83.58
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.47
KOG2297412 consensus Predicted translation factor, contains W 83.28
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.18
KOG0495913 consensus HAT repeat protein [RNA processing and m 82.48
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 82.41
COG3629280 DnrI DNA-binding transcriptional activator of the 81.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 81.59
KOG1125579 consensus TPR repeat-containing protein [General f 81.44
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 81.19
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 81.0
KOG4340 459 consensus Uncharacterized conserved protein [Funct 80.73
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 80.63
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=99.97  E-value=1.2e-30  Score=258.68  Aligned_cols=237  Identities=15%  Similarity=0.139  Sum_probs=155.8

Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCHHhHHHHHHHHHcCCC-C--------------------------CCc
Q 048764           25 NFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSAT-D--------------------------PSL   77 (295)
Q Consensus        25 t~~~li~~~~~~g~~~~A~~lf~~m~~~g~~pd~~ty~~ll~~~~~~~~-~--------------------------~~~   77 (295)
                      +||++|.+|++.|+.++|+.+|++|.+.|+.||..||+++|++|.+.+. +                          .+.
T Consensus       292 t~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~  371 (697)
T PLN03081        292 AWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYS  371 (697)
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHH
Confidence            9999999999999999999999999999999999999999997765543 1                          023


Q ss_pred             chHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHhhhhcCCCCCcccHHHHHHHHHhcCCHHHhh
Q 048764           78 KDSALRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAY  157 (295)
Q Consensus        78 ~~~~~~~a~~lf~~M~~~g~~pd~~ty~~li~~~~~~g~~~~A~~l~~~M~~~~gi~P~~~ty~~ll~~~~~~g~~~~A~  157 (295)
                      ++|.+++|.++|++|.+    ||.+|||+||.+|+++|+.++|+++|++|. ..|+.||.+||+++|.+|++.|++++|.
T Consensus       372 k~G~~~~A~~vf~~m~~----~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~-~~g~~Pd~~T~~~ll~a~~~~g~~~~a~  446 (697)
T PLN03081        372 KWGRMEDARNVFDRMPR----KNLISWNALIAGYGNHGRGTKAVEMFERMI-AEGVAPNHVTFLAVLSACRYSGLSEQGW  446 (697)
T ss_pred             HCCCHHHHHHHHHhCCC----CCeeeHHHHHHHHHHcCCHHHHHHHHHHHH-HhCCCCCHHHHHHHHHHHhcCCcHHHHH
Confidence            45556666666665543    555556666666666666666666666665 5555566666666666666555555555


Q ss_pred             c--------------HHHHHHHHHHHHhcCCHHHHHHHHHHHHHcccCCChhHH--------------------------
Q 048764          158 E--------------EQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETG--------------------------  197 (295)
Q Consensus       158 ~--------------e~~y~~ll~~~~~~g~~~~a~~ll~~m~~~~~~p~~~t~--------------------------  197 (295)
                      +              ..+|++||++|++.|++++|++++++|   +..|+..+|                          
T Consensus       447 ~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~---~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~  523 (697)
T PLN03081        447 EIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRA---PFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGM  523 (697)
T ss_pred             HHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHC---CCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHhCC
Confidence            5              012555555555555555555555543   234444444                          


Q ss_pred             --------HHHHHHHhccccCCccc-chhHHHHHHHhcCCc-cccCCCccccceEEeeee--------------------
Q 048764          198 --------KIIEDWFSGQKVNGVSC-DLGLVKNAVLKNGGG-WHGLGWIGQGKWVVKRGS--------------------  247 (295)
Q Consensus       198 --------~~l~~~~~~~~~g~~~~-~~~~v~~~~~~~g~~-~~~~~w~~~~~w~~~~~~--------------------  247 (295)
                              ..+.+.|..    .++| ++..+++.|.+.|.. .+|.+|+..++.++.+..                    
T Consensus       524 ~p~~~~~y~~L~~~y~~----~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~  599 (697)
T PLN03081        524 GPEKLNNYVVLLNLYNS----SGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMK  599 (697)
T ss_pred             CCCCCcchHHHHHHHHh----CCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHHHHHH
Confidence                    444444433    5678 477899999998875 688999999888877653                    


Q ss_pred             -eCCCCCcCcCCCeeeEeeCChHHHHHHH
Q 048764          248 -VDESGKCCSCGNQLACVDIDDAETERFA  275 (295)
Q Consensus       248 -v~~~g~C~~c~~~l~~~~l~~~e~~~~~  275 (295)
                       +...|+++.  ......|++++|++..+
T Consensus       600 ~~~~~gy~~~--~~~~~~~~~~~~~~~~~  626 (697)
T PLN03081        600 EISEYGYVAE--ENELLPDVDEDEEKVSG  626 (697)
T ss_pred             HHHHcCCCCC--cchhhccccHHHHHHHH
Confidence             344677763  34445788888887653



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG2297 consensus Predicted translation factor, contains W2 domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 3e-52
4g23_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 1e-49
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 201 bits (512), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 117/284 (41%), Positives = 165/284 (58%), Gaps = 20/284 (7%) Query: 30 LQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCS--NSATDPSLKDSALRHGFR 87 L C+K D+ A+ LY+ A +LS +H+N LLY+CS +AT+ S + L GF Sbjct: 33 LDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESS-PNPGLSRGFD 91 Query: 88 VFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCF 147 +F QM+ + V+PNEA T+ ARLA +K D + AF+++K+M F + PRLR+Y PALF F Sbjct: 92 IFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMK-AFGIQPRLRSYGPALFGF 150 Query: 148 CENLEAQKAYE-------------EQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNE 194 C +A KAYE E E+ ALLKVS T +KVY+ LQ+LR VR V++ Sbjct: 151 CRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSK 210 Query: 195 ETGKIIEDWFSGQ---KVNGVSCDLGLVKNAVLKNXXXXXXXXXXXXXKWVVKRGSVDES 251 T +IE+WF + K D+ +++AV+ KW VKR +DE+ Sbjct: 211 STFDMIEEWFKSEVATKTGVKKWDVKKIRDAVVSGGGGWHGQGWLGTGKWNVKRTEMDEN 270 Query: 252 GKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ 295 G C C +L C+DI+ ETE FA S+ LA E+EVKANF++ Q Sbjct: 271 GVCKCCKEKLVCIDINPVETETFAASLTRLACEREVKANFNQFQ 314
>pdb|4G23|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 40.6 bits (94), Expect = 6e-04
 Identities = 35/231 (15%), Positives = 60/231 (25%), Gaps = 82/231 (35%)

Query: 86  FRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALF 145
            R+F  +LS      E     V +        +Y F L+  +  E     R  +    ++
Sbjct: 65  LRLFWTLLSK---QEEM----VQKFVEEVLRINYKF-LMSPIKTE----QRQPSMMTRMY 112

Query: 146 CFCENLEAQKAYEEQEITALLKVSAGTGRVEKVYQ---YLQKLRSTVRCVNEETGKIIED 202
               +    + Y + ++ A   VS    R++   +    L +LR                
Sbjct: 113 IEQRD----RLYNDNQVFAKYNVS----RLQPYLKLRQALLELRPA-------------- 150

Query: 203 WFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWV----------VKRGSVDE-- 250
                            KN ++       G+   G GK            V+     +  
Sbjct: 151 -----------------KNVLI------DGVL--GSGKTWVALDVCLSYKVQCKMDFKIF 185

Query: 251 ---SGKCCSCGNQLA-----CVDIDDAETERFAQSVAALAMEQEVKANFSE 293
                 C S    L         ID   T R   S         ++A    
Sbjct: 186 WLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRR 236


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.88
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.77
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.47
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.45
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.94
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.9
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.86
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.83
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.82
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.77
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.73
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.68
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.64
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.61
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.6
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.6
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.59
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.55
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.54
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.54
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.51
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.5
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.48
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.42
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.42
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.41
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.39
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.36
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.34
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.31
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.29
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.29
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.26
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.25
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.24
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.23
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.23
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.19
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.18
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.16
3u4t_A272 TPR repeat-containing protein; structural genomics 98.15
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.11
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.03
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.03
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.99
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.99
3u4t_A272 TPR repeat-containing protein; structural genomics 97.93
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.89
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.78
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.76
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.75
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.72
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.72
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.71
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.67
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.63
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.63
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.61
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.61
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.55
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.52
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.49
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.46
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.43
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.42
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.4
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.38
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.38
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.38
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.31
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.31
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.28
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.24
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.23
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.23
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.19
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.19
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.19
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.16
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.15
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.08
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.08
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.04
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.01
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.99
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.98
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.89
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.88
3k9i_A117 BH0479 protein; putative protein binding protein, 96.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.83
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.8
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.8
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.8
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.72
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.7
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.69
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.68
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.66
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.62
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.6
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.57
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.54
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.5
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.39
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.39
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.37
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.32
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.31
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.3
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.29
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.28
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.27
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.23
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.2
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.19
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.13
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 95.99
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.99
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 95.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.95
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.89
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 95.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 95.65
3k9i_A117 BH0479 protein; putative protein binding protein, 95.59
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.58
4g1t_A472 Interferon-induced protein with tetratricopeptide 95.35
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.25
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.21
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.02
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 94.95
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 94.82
2l6j_A111 TPR repeat-containing protein associated with HSP; 94.77
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.71
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.59
2l6j_A111 TPR repeat-containing protein associated with HSP; 94.54
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.46
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.31
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.22
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.16
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 93.82
2kat_A115 Uncharacterized protein; NESG, structure, structur 93.79
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.69
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.25
1klx_A138 Cysteine rich protein B; structural genomics, heli 93.16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 93.14
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 92.8
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 92.69
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.67
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.65
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 91.93
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 91.89
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 91.72
3qww_A433 SET and MYND domain-containing protein 2; methyltr 91.63
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 91.54
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 91.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.23
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 91.08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 90.95
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 89.83
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 89.2
1klx_A138 Cysteine rich protein B; structural genomics, heli 87.95
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 87.92
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 87.65
1pc2_A152 Mitochondria fission protein; unknown function; NM 87.38
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 86.64
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.21
1pc2_A152 Mitochondria fission protein; unknown function; NM 84.65
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 83.48
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 81.2
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 80.25
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 80.12
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=8.1e-56  Score=421.19  Aligned_cols=292  Identities=45%  Similarity=0.787  Sum_probs=262.6

Q ss_pred             CCCCCCCCChhhhhcCCCCcHhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCHHhHHHHHHHHHcCCC-CCCcchHH
Q 048764            3 NTTSANPSKPNKKRKTNPNPETNFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSAT-DPSLKDSA   81 (295)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~p~~t~~~li~~~~~~g~~~~A~~lf~~m~~~g~~pd~~ty~~ll~~~~~~~~-~~~~~~~~   81 (295)
                      .+++..+.++.+++....+|+..++.+|++|+|.|++++|+++|++|++.|++||.+|||+||++|+..+. ....+.+.
T Consensus         6 ~s~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~   85 (501)
T 4g26_A            6 ASPSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPG   85 (501)
T ss_dssp             ------------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHH
T ss_pred             cchHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcch
Confidence            35667777888888888889999999999999999999999999999999999999999999999987663 34566778


Q ss_pred             HHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHhhhhcCCCCCcccHHHHHHHHHhcCCHHHhhc---
Q 048764           82 LRHGFRVFDQMLSNNVIPNEALVTSVARLAASKKDSDYAFELIKRMNNEFNVVPRLRTYDPALFCFCENLEAQKAYE---  158 (295)
Q Consensus        82 ~~~a~~lf~~M~~~g~~pd~~ty~~li~~~~~~g~~~~A~~l~~~M~~~~gi~P~~~ty~~ll~~~~~~g~~~~A~~---  158 (295)
                      +++|.++|++|...|+.||.+|||+||++|++.|++++|+++|++|. ..|+.||.+|||+||.+|++.|++++|.+   
T Consensus        86 l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~-~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~  164 (501)
T 4g26_A           86 LSRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMK-AFGIQPRLRSYGPALFGFCRKGDADKAYEVDA  164 (501)
T ss_dssp             HHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHH-HTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHH-HcCCCCccceehHHHHHHHHCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999 99999999999999999999999999999   


Q ss_pred             ----------HHHHHHHHHHHHhcCCHHHHHHHHHHHHHcccCCChhHHHHHHHHHhc---cccCCcccchhHHHHHHHh
Q 048764          159 ----------EQEITALLKVSAGTGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSG---QKVNGVSCDLGLVKNAVLK  225 (295)
Q Consensus       159 ----------e~~y~~ll~~~~~~g~~~~a~~ll~~m~~~~~~p~~~t~~~l~~~~~~---~~~g~~~~~~~~v~~~~~~  225 (295)
                                ..+|++||++|++.|++++|+++|++|++.++.|+..|+.+|+.||++   ...|...|++..+.+.+..
T Consensus       165 ~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~~a~~~g~~~~d~~~~~~~~~~  244 (501)
T 4g26_A          165 HMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSEVATKTGVKKWDVKKIRDAVVS  244 (501)
T ss_dssp             HHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSHHHHTCCBSCCCHHHHHHHHHH
T ss_pred             HHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcCcchhhhhhhhhhhhhhhhHhc
Confidence                      445999999999999999999999999999999999999999999998   6678889999999999999


Q ss_pred             cCCccccCCCccccceEEeeeeeCCCCCcCcCCCeeeEeeCChHHHHHHHHHHHHHHHhHHHhhccCcCC
Q 048764          226 NGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGNQLACVDIDDAETERFAQSVAALAMEQEVKANFSESQ  295 (295)
Q Consensus       226 ~g~~~~~~~w~~~~~w~~~~~~v~~~g~C~~c~~~l~~~~l~~~e~~~~~~~i~~~~~~~~~~~~~~~f~  295 (295)
                      .|++|++++|++.++|.+..+.|+..|.|+.|+.+|.+|+|+++|++.|++.|.++|++++++.+|++||
T Consensus       245 ~g~~~~~~~~~~~~~w~v~~t~v~~~G~C~~c~~~L~~i~l~~~e~~~l~~~i~~~~~~~~~~~~~~~F~  314 (501)
T 4g26_A          245 GGGGWHGQGWLGTGKWNVKRTEMDENGVCKCCKEKLVCIDINPVETETFAASLTRLACEREVKANFNQFQ  314 (501)
T ss_dssp             HTSSCCCSCCCBCSCEEEEEECBCTTSBBTTTCCBCCCCCCCHHHHHHHHHHHHHHHHHHSCHHHHHHHH
T ss_pred             cCcccccccccccCceeEEeeecccCCCccchhhhhccccCCHHHHHHHHHHHHHHHHccchHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999998885



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.25
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.19
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.16
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.03
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.27
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.21
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.18
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.06
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.94
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.92
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.9
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.56
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.43
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.25
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.14
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.02
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.01
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.91
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.58
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 95.56
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.48
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.42
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.32
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.99
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 94.95
d1hz4a_366 Transcription factor MalT domain III {Escherichia 94.92
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 94.76
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 94.46
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 93.28
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 92.8
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 92.65
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 92.12
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 91.79
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 91.04
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 86.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 84.44
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 84.23
d1ug3a1193 Eukaryotic initiation factor eIF4G {Human (Homo sa 82.75
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 82.15
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 81.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 81.54
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.25  E-value=2.7e-05  Score=66.31  Aligned_cols=165  Identities=13%  Similarity=0.111  Sum_probs=114.9

Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCHHhHHHHHHHHHcCCCCCCcchHHHHHHHHHHHHHHhCCCCCCHHHH
Q 048764           25 NFLISLQSCTKSKDLATAISLYESALSLNFRLSLHHFNALLYLCSNSATDPSLKDSALRHGFRVFDQMLSNNVIPNEALV  104 (295)
Q Consensus        25 t~~~li~~~~~~g~~~~A~~lf~~m~~~g~~pd~~ty~~ll~~~~~~~~~~~~~~~~~~~a~~lf~~M~~~g~~pd~~ty  104 (295)
                      .+..+-..+...+++++|...+++..+.. +-+...|..+-..+...+.        +++|...|+.....+. .+..++
T Consensus       171 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~--------~~~A~~~~~~~~~~~~-~~~~~~  240 (388)
T d1w3ba_         171 AWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARI--------FDRAVAAYLRALSLSP-NHAVVH  240 (388)
T ss_dssp             HHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTC--------TTHHHHHHHHHHHHCT-TCHHHH
T ss_pred             HHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhcccc--------HHHHHHHHHHhHHHhh-hHHHHH
Confidence            66777778888888888888888876542 2345566666665555443        7788888888776432 456677


Q ss_pred             HHHHHHHHcCCCHHHHHHHHHHhhhhcCCCCC-cccHHHHHHHHHhcCCHHHhhc------------HHHHHHHHHHHHh
Q 048764          105 TSVARLAASKKDSDYAFELIKRMNNEFNVVPR-LRTYDPALFCFCENLEAQKAYE------------EQEITALLKVSAG  171 (295)
Q Consensus       105 ~~li~~~~~~g~~~~A~~l~~~M~~~~gi~P~-~~ty~~ll~~~~~~g~~~~A~~------------e~~y~~ll~~~~~  171 (295)
                      ..+...+.+.|++++|...|++.. ..  .|+ ..+|..+...|...|+.++|..            ...+..+...+..
T Consensus       241 ~~l~~~~~~~~~~~~A~~~~~~al-~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~  317 (388)
T d1w3ba_         241 GNLACVYYEQGLIDLAIDTYRRAI-EL--QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE  317 (388)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHH-HT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHH-Hh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHH
Confidence            778888888888888888888876 43  344 4567777788888888888877            2236677777888


Q ss_pred             cCCHHHHHHHHHHHHHcccCCCh-hHHHHHHHHH
Q 048764          172 TGRVEKVYQYLQKLRSTVRCVNE-ETGKIIEDWF  204 (295)
Q Consensus       172 ~g~~~~a~~ll~~m~~~~~~p~~-~t~~~l~~~~  204 (295)
                      .|++++|...+++..+  ..|+. ..+..+-..+
T Consensus       318 ~~~~~~A~~~~~~al~--~~p~~~~~~~~la~~~  349 (388)
T d1w3ba_         318 QGNIEEAVRLYRKALE--VFPEFAAAHSNLASVL  349 (388)
T ss_dssp             TTCHHHHHHHHHHHTT--SCTTCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHH
Confidence            8888888888888655  34543 3444444444



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure