Psyllid ID: psy10009

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MFREQDSPSPGNDRLLGLFPHDLSKYETAKIVSRKLVYRGYYFRREKETCNKKIMWKCTSYSRTKCHSRIHTFDGHIIFNSDKHNHLPHTMESDLHPSSEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE
cccccccccccccccccccccccccHHHHHHHHHEEEEEEEEEEEccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccHHHHHHccccEEEEcccccHHHHHHHHccccccccccccccEEEEEcccHHHHHHHHHccccccccccccccccccccccccEEEccccHHHHHHHHHccccccccccccccccccccc
ccccccccccccccHcccccccccHHHHHHHHHHHHEEccEEEEEcccccccEEEEEcccccccEccccEEEcccEEEccccccccccccHHHHccccccccEEcccccccccccccccHHHcccHHHHHHHccHHHHHHHHHHHHccccccccHHEEEEEEcccHHHHHHHHHccccHHHcccccHHHHHcccHHHccEEEcccHHHHHHHHHHHccHHHccccccccHHHHcc
mfreqdspspgndrllglfphdlskyetaKIVSRKLVYRGYYFRREKETCNKKIMwkctsysrtkchsrihtfdghiifnsdkhnhlphtmesdlhpsseptlalpsgsesndchdnpadkkksTIMKTYSKLSLTKNIRLNLQNitkplngndinnfevWEGLNIVKTGRvmlgatnpadsapgtvrgdLCIQvgrnimhgsdsVESAKKEIALWFTEKEvigwtnaseswiye
mfreqdspspgndrllglfphdlskyetakivsrklvyrgyyfrreketcnkkimwkCTSYSRTKCHSRIHTFDGHIIFNSDKHNHLPHTMESDLHPSSEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKNIRLNLQNitkplngndinnFEVWEGLNIVKTGRVMLGAtnpadsapgtvrGDLCIQVGRNIMHGSDSVESAKKEIALWFtekevigwtnaseswiye
MFREQDSPSPGNDRLLGLFPHDLSKYETAKIVSRKLVYRGYYFRREKETCNKKIMWKCTSYSRTKCHSRIHTFDGHIIFNSDKHNHLPHTMESDLHPSSEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE
**************LLGLFPHDLSKYETAKIVSRKLVYRGYYFRREKETCNKKIMWKCTSYSRTKCHSRIHTFDGHIIFNS***********************************************TYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWI**
***************LGLFPHDLSKYETAKIVSRKLVYRGYYFRR*********M**CTSY***************IIFNSDKH***********HPSSEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE
**********GNDRLLGLFPHDLSKYETAKIVSRKLVYRGYYFRREKETCNKKIMWKCTSYSRTKCHSRIHTFDGHIIFNSDKHNHLPHT****************************ADKKKSTIMKTYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE
************DRLLGLFPHDLSKYETAKIVSRKLVYRGYYFRREKETCNKKIMWKCTSYSRTKCHSRIHTFDGHIIFNSDKHNHLPHTMESDLHPSSEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFREQDSPSPGNDRLLGLFPHDLSKYETAKIVSRKLVYRGYYFRREKETCNKKIMWKCTSYSRTKCHSRIHTFDGHIIFNSDKHNHLPHTMESDLHPSSEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKNIRLNLQNITKPLNGNDINNFEVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
P08879153 Nucleoside diphosphate ki no N/A 0.323 0.496 0.789 1e-31
Q6XI71150 Nucleoside diphosphate ki N/A N/A 0.323 0.506 0.789 1e-31
P27950151 Nucleoside diphosphate ki N/A N/A 0.323 0.503 0.75 4e-30
P52175152 Nucleoside diphosphate ki yes N/A 0.323 0.5 0.736 2e-29
P52174152 Nucleoside diphosphate ki yes N/A 0.323 0.5 0.736 3e-29
Q5RC56152 Nucleoside diphosphate ki yes N/A 0.323 0.5 0.736 3e-29
P15531152 Nucleoside diphosphate ki no N/A 0.323 0.5 0.736 3e-29
Q50KA9152 Nucleoside diphosphate ki yes N/A 0.323 0.5 0.723 4e-29
Q05982152 Nucleoside diphosphate ki yes N/A 0.323 0.5 0.723 6e-29
P70011154 Nucleoside diphosphate ki N/A N/A 0.323 0.493 0.723 7e-29
>sp|P08879|NDKA_DROME Nucleoside diphosphate kinase OS=Drosophila melanogaster GN=awd PE=1 SV=3 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 60/76 (78%), Positives = 69/76 (90%)

Query: 160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 219
           VWEGLN+VKTGR MLGATNPADS PGT+RGD CIQVGRNI+HGSD+VESA+KEIALWF E
Sbjct: 78  VWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNE 137

Query: 220 KEVIGWTNASESWIYE 235
           KE++ WT A++ WIYE
Sbjct: 138 KELVTWTPAAKDWIYE 153
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|Q6XI71|NDKA_DROYA Nucleoside diphosphate kinase (Fragment) OS=Drosophila yakuba GN=awd PE=2 SV=1 Back     alignment and function description
>sp|P27950|NDK_GINCI Nucleoside diphosphate kinase (Fragment) OS=Ginglymostoma cirratum PE=3 SV=1 Back     alignment and function description
>sp|P52175|NDKA2_BOVIN Nucleoside diphosphate kinase A 2 OS=Bos taurus GN=NME1-2 PE=1 SV=3 Back     alignment and function description
>sp|P52174|NDKA1_BOVIN Nucleoside diphosphate kinase A 1 OS=Bos taurus GN=NME1-1 PE=1 SV=3 Back     alignment and function description
>sp|Q5RC56|NDKA_PONAB Nucleoside diphosphate kinase A OS=Pongo abelii GN=NME1 PE=2 SV=1 Back     alignment and function description
>sp|P15531|NDKA_HUMAN Nucleoside diphosphate kinase A OS=Homo sapiens GN=NME1 PE=1 SV=1 Back     alignment and function description
>sp|Q50KA9|NDKA_CANFA Nucleoside diphosphate kinase A OS=Canis familiaris GN=NME1 PE=2 SV=1 Back     alignment and function description
>sp|Q05982|NDKA_RAT Nucleoside diphosphate kinase A OS=Rattus norvegicus GN=Nme1 PE=1 SV=1 Back     alignment and function description
>sp|P70011|NDKA2_XENLA Nucleoside diphosphate kinase A2 OS=Xenopus laevis PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
110671458153 putative abnormal wing disc-like protein 0.323 0.496 1.0 2e-37
189235892169 PREDICTED: similar to putative nucleosid 0.323 0.449 0.868 9e-33
294459457153 abnormal wing disc protein [Antheraea pe 0.323 0.496 0.855 1e-32
270003279154 hypothetical protein TcasGA2_TC002492 [T 0.323 0.493 0.868 1e-32
153791847154 abnormal wing disc-like protein [Bombyx 0.323 0.493 0.842 3e-32
170036973195 nucleoside diphosphate kinase [Culex qui 0.323 0.389 0.828 6e-32
322791096161 hypothetical protein SINV_12396 [Solenop 0.323 0.472 0.855 1e-31
330370526178 abnormal wing disc-like protein [Spodopt 0.323 0.426 0.828 1e-31
389608603153 nucleoside-diphosphate kinase NBR-A [Pap 0.323 0.496 0.815 3e-31
94468478168 nucleoside diphosphate kinase [Aedes aeg 0.323 0.452 0.802 3e-31
>gi|110671458|gb|ABG81980.1| putative abnormal wing disc-like protein [Diaphorina citri] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%)

Query: 160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 219
           VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE
Sbjct: 78  VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 137

Query: 220 KEVIGWTNASESWIYE 235
           KEVIGWTNASESWIYE
Sbjct: 138 KEVIGWTNASESWIYE 153

Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189235892|ref|XP_967503.2| PREDICTED: similar to putative nucleoside diphosphate kinase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|294459457|gb|ADE75591.1| abnormal wing disc protein [Antheraea pernyi] Back     alignment and taxonomy information
>gi|270003279|gb|EEZ99726.1| hypothetical protein TcasGA2_TC002492 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|153791847|ref|NP_001093284.1| abnormal wing disc-like protein [Bombyx mori] gi|95103130|gb|ABF51506.1| abnormal wing disc-like protein [Bombyx mori] Back     alignment and taxonomy information
>gi|170036973|ref|XP_001846335.1| nucleoside diphosphate kinase [Culex quinquefasciatus] gi|167879963|gb|EDS43346.1| nucleoside diphosphate kinase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|322791096|gb|EFZ15678.1| hypothetical protein SINV_12396 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|330370526|gb|AEC12435.1| abnormal wing disc-like protein [Spodoptera litura] Back     alignment and taxonomy information
>gi|389608603|dbj|BAM17911.1| nucleoside-diphosphate kinase NBR-A [Papilio xuthus] Back     alignment and taxonomy information
>gi|94468478|gb|ABF18088.1| nucleoside diphosphate kinase [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
FB|FBgn0000150153 awd "abnormal wing discs" [Dro 0.323 0.496 0.789 6.9e-31
UNIPROTKB|Q6XI71150 awd "Nucleoside diphosphate ki 0.323 0.506 0.789 6.9e-31
UNIPROTKB|Q32Q12292 NME1-NME2 "Nucleoside diphosph 0.323 0.260 0.697 4.2e-30
UNIPROTKB|G1K1A3110 NME1 "Nucleoside diphosphate k 0.323 0.690 0.75 2.7e-29
UNIPROTKB|E2RC20292 NME1 "Nucleoside diphosphate k 0.323 0.260 0.697 2.9e-29
UNIPROTKB|P52175152 NME1-2 "Nucleoside diphosphate 0.323 0.5 0.736 7.1e-29
UNIPROTKB|P15531152 NME1 "Nucleoside diphosphate k 0.323 0.5 0.736 7.1e-29
UNIPROTKB|P52174152 NME1-1 "Nucleoside diphosphate 0.323 0.5 0.736 9.1e-29
RGD|70497152 Nme1 "NME/NM23 nucleoside diph 0.323 0.5 0.723 1.9e-28
UNIPROTKB|Q50KA9152 NME1 "Nucleoside diphosphate k 0.323 0.5 0.723 2.4e-28
FB|FBgn0000150 awd "abnormal wing discs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 340 (124.7 bits), Expect = 6.9e-31, P = 6.9e-31
 Identities = 60/76 (78%), Positives = 69/76 (90%)

Query:   160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 219
             VWEGLN+VKTGR MLGATNPADS PGT+RGD CIQVGRNI+HGSD+VESA+KEIALWF E
Sbjct:    78 VWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNE 137

Query:   220 KEVIGWTNASESWIYE 235
             KE++ WT A++ WIYE
Sbjct:   138 KELVTWTPAAKDWIYE 153
GO:0004550 "nucleoside diphosphate kinase activity" evidence=ISS;NAS;IMP;IDA
GO:0007017 "microtubule-based process" evidence=IMP
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=ISS;IMP
GO:0008017 "microtubule binding" evidence=IDA
GO:0005874 "microtubule" evidence=NAS;IDA
GO:0007067 "mitosis" evidence=IMP
GO:0005524 "ATP binding" evidence=IDA
GO:0016301 "kinase activity" evidence=IDA
GO:0000287 "magnesium ion binding" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IMP;IDA
GO:0018105 "peptidyl-serine phosphorylation" evidence=IDA
GO:0005525 "GTP binding" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0006183 "GTP biosynthetic process" evidence=ISS;NAS
GO:0006241 "CTP biosynthetic process" evidence=ISS;NAS
GO:0006228 "UTP biosynthetic process" evidence=ISS;NAS
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IEP;IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0034332 "adherens junction organization" evidence=IMP
GO:0035152 "regulation of tube architecture, open tracheal system" evidence=IMP
UNIPROTKB|Q6XI71 awd "Nucleoside diphosphate kinase" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|Q32Q12 NME1-NME2 "Nucleoside diphosphate kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G1K1A3 NME1 "Nucleoside diphosphate kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC20 NME1 "Nucleoside diphosphate kinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P52175 NME1-2 "Nucleoside diphosphate kinase A 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P15531 NME1 "Nucleoside diphosphate kinase A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P52174 NME1-1 "Nucleoside diphosphate kinase A 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|70497 Nme1 "NME/NM23 nucleoside diphosphate kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q50KA9 NME1 "Nucleoside diphosphate kinase A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P15532NDKA_MOUSE2, ., 7, ., 4, ., 60.71050.32340.5yesN/A
Q05982NDKA_RAT2, ., 7, ., 4, ., 60.72360.32340.5yesN/A
Q50KA9NDKA_CANFA2, ., 7, ., 4, ., 60.72360.32340.5yesN/A
Q8TFN0NDK_EMENI2, ., 7, ., 4, ., 60.65780.32340.4967yesN/A
P39207NDK1_ARATH2, ., 7, ., 4, ., 60.60520.31910.5033yesN/A
Q5RC56NDKA_PONAB2, ., 7, ., 4, ., 60.73680.32340.5yesN/A
Q7Z8P9NDK_ASPFU2, ., 7, ., 4, ., 60.67100.32340.4967yesN/A
P49740NDK_SCHPO2, ., 7, ., 4, ., 60.60520.32340.5033yesN/A
P52175NDKA2_BOVIN2, ., 7, ., 4, ., 60.73680.32340.5yesN/A
P52174NDKA1_BOVIN2, ., 7, ., 4, ., 60.73680.32340.5yesN/A
Q75DD1NDK_ASHGO2, ., 7, ., 4, ., 60.61840.32340.5033yesN/A
Q2JVI1NDK_SYNJA2, ., 7, ., 4, ., 60.53940.32340.5100yesN/A
O57535NDK_CHICK2, ., 7, ., 4, ., 60.72360.32340.4967yesN/A
P36010NDK_YEAST2, ., 7, ., 4, ., 60.57890.32340.4967yesN/A
Q2JPL4NDK_SYNJB2, ., 7, ., 4, ., 60.52630.32340.5100yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.6LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 1e-39
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 3e-35
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 2e-32
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 1e-30
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 9e-30
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 2e-29
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 3e-27
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 3e-22
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 1e-16
pfam0450062 pfam04500, FLYWCH, FLYWCH zinc finger domain 4e-13
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 8e-12
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 3e-11
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 4e-11
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 5e-09
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 4e-08
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 1e-06
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-04
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 5e-04
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 8e-04
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information 
 Score =  133 bits (337), Expect = 1e-39
 Identities = 51/75 (68%), Positives = 63/75 (84%)

Query: 160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 219
           VWEG N+VK GR +LGATNP +SAPGT+RGD C+ VGRN++HGSDSVESAK+EIALWF  
Sbjct: 75  VWEGKNVVKQGRKLLGATNPLESAPGTIRGDFCVDVGRNVIHGSDSVESAKREIALWFKP 134

Query: 220 KEVIGWTNASESWIY 234
           +E++ WT+ S  WIY
Sbjct: 135 EELVSWTSHSSKWIY 149

Length = 149
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|203031 pfam04500, FLYWCH, FLYWCH zinc finger domain Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
KOG0888|consensus156 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 99.98
PLN02931177 nucleoside diphosphate kinase family protein 99.98
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 99.98
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 99.97
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 99.97
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 99.97
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 99.97
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 99.97
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 99.97
PRK14544183 nucleoside diphosphate kinase; Provisional 99.97
PF0450062 FLYWCH: FLYWCH zinc finger domain; InterPro: IPR00 99.5
PF0310660 WRKY: WRKY DNA -binding domain; InterPro: IPR00365 85.23
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-37  Score=253.09  Aligned_cols=129  Identities=46%  Similarity=0.773  Sum_probs=119.8

Q ss_pred             CCCccccCCCCCCCcCCCCCchhHHHHHHHHHHhhchhh------------hhhhhhcccCCCccc-------CccEEEE
Q psy10009         99 SEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTK------------NIRLNLQNITKPLNG-------NDINNFE  159 (235)
Q Consensus        99 ~e~t~alikP~~~~~~~~~~~~~~~~~il~~i~~~~~~~------------~~~~y~~~~~k~f~~-------sGpvval  159 (235)
                      .|+|||+||||++..       .++|+||+.|.+.|+.+            +.+||.+|.+++||.       ||||+||
T Consensus         2 ~e~Tl~lIKPdav~~-------~~~g~Ii~~i~~~Gf~I~~~k~~~lt~~~a~~fY~~~~gk~ff~~Lv~~m~sGp~val   74 (149)
T PTZ00093          2 SERTFIMVKPDGVQR-------GLVGEIIKRFEKKGYKLVALKMLQPTPEIAEEHYKEHKGKPFFPGLVKYISSGPVVCM   74 (149)
T ss_pred             CceEEEEECcchhhc-------CchHHHHHHHHHCCCEEEEeEeecCCHHHHHHHHHHhcCCchHHHHHHHHhcCCEEEE
Confidence            478999999999851       45799999999966666            346999999999986       9999999


Q ss_pred             EEecccHHHHHHHHhCCCCCCCCCCCCcccccccccCeeEEEcCCCHHHHHHHhhhccCCCceeccccCCcCccc
Q psy10009        160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIY  234 (235)
Q Consensus       160 ~l~g~nav~~~r~l~Gptdp~~A~P~siRa~fg~~~~~N~vHgSds~e~a~~ei~~fF~~~~~~~~~~~~~~~~~  234 (235)
                      +|+|+|||+.||+||||+||.+|.|+|||++||.+.++|+||||||+++|.+||+|||++.++.+|....+.|+|
T Consensus        75 ~l~g~nav~~~R~l~Gpt~p~~a~p~siR~~fg~~~~~NavH~Sds~e~A~~Ei~~fF~~~~~~~~~~~~~~~~~  149 (149)
T PTZ00093         75 VWEGKNVVKQGRKLLGATNPLESAPGTIRGDFCVDVGRNVIHGSDSVESAKREIALWFKPEELVSWTSHSSKWIY  149 (149)
T ss_pred             EEeCCCHHHHHHHHhCCCCccccCCCcchhhhccccccceeecCCCHHHHHHHHHHhCChhhccCccccchhhhC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999987

>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>KOG0888|consensus Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PF04500 FLYWCH: FLYWCH zinc finger domain; InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF03106 WRKY: WRKY DNA -binding domain; InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 1e-32
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 9e-32
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 2e-30
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 2e-30
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 3e-30
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 3e-30
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 7e-30
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 5e-29
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 6e-29
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 6e-29
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 4e-28
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-26
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-26
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 3e-26
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 3e-26
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 6e-25
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 5e-23
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 7e-23
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 8e-22
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-21
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 8e-20
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-19
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 4e-19
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 5e-19
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 1e-18
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 1e-18
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 1e-18
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 2e-18
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 2e-18
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 9e-18
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 1e-17
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 2e-17
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 2e-17
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 2e-17
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 2e-17
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 3e-17
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 4e-17
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 5e-17
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 9e-17
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 1e-16
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 4e-15
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 8e-15
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 1e-14
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-12
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 2e-12
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-12
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 2e-12
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 6e-12
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 6e-12
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 2e-11
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 3e-11
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 4e-11
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 5e-11
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 5e-11
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 6e-11
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 7e-09
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 2e-08
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 9e-08
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 4e-07
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 4e-07
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 3e-06
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 3e-06
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 3e-06
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 9e-06
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 8e-05
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure 
Iteration: 1

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 60/76 (78%), Positives = 69/76 (90%)
Query: 160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 219
           VWEGLN+VKTGR MLGATNPADS PGT+RGD CIQVGRNI+HGSD+VESA+KEIALWF E
Sbjct: 78  VWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNE 137
Query: 220 KEVIGWTNASESWIYE 235
           KE++ WT A++ WIYE
Sbjct: 138 KELVTWTPAAKDWIYE 153
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 5e-47
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 1e-46
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 2e-46
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 2e-46
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 2e-46
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 3e-46
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 4e-46
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 7e-46
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 1e-45
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 2e-45
3js9_A156 Nucleoside diphosphate kinase family protein; niai 2e-45
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 2e-45
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 3e-45
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 1e-44
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 2e-44
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 3e-44
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 1e-43
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 2e-43
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 3e-41
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 1e-40
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 4e-40
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 6e-40
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 9e-40
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 1e-39
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 2e-39
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 1e-37
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 8e-36
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 3e-35
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 2e-34
2rpr_A87 Flywch-type zinc finger-containing protein 1; flyw 6e-13
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
 Score =  152 bits (386), Expect = 5e-47
 Identities = 45/76 (59%), Positives = 65/76 (85%)

Query: 160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTE 219
           VW+GL++V+T R ++GATNPAD+ PGT+RGD CI+VG+N++HGSDSVESA++EIALWF  
Sbjct: 94  VWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRA 153

Query: 220 KEVIGWTNASESWIYE 235
            E++ W +++  W+YE
Sbjct: 154 DELLCWEDSAGHWLYE 169
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure
>2rpr_A Flywch-type zinc finger-containing protein 1; flywch domain, alternative splicing, DNA-binding, metal- binding, nucleus, metal binding protein; NMR {Homo sapiens} Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 99.97
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.84
2rpr_A87 Flywch-type zinc finger-containing protein 1; flyw 99.68
1wj2_A78 Probable WRKY transcription factor 4; DNA-binding 84.05
2ayd_A76 WRKY transcription factor 1; beta strands, zinc fi 81.37
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-42  Score=286.29  Aligned_cols=130  Identities=45%  Similarity=0.709  Sum_probs=122.4

Q ss_pred             CCCccccCCCCCCCcCCCCCchhHHHHHHHHHHhhchhh------------hhhhhhcccCCCccc-------CccEEEE
Q psy10009         99 SEPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTK------------NIRLNLQNITKPLNG-------NDINNFE  159 (235)
Q Consensus        99 ~e~t~alikP~~~~~~~~~~~~~~~~~il~~i~~~~~~~------------~~~~y~~~~~k~f~~-------sGpvval  159 (235)
                      +++||++||||++.-       .++|+||+.|.+.|+++            +.+||.+|+++|||+       |||||||
T Consensus        11 ~~rTl~iIKPDav~~-------~l~GeIi~rie~~Gf~Iv~~K~~~ls~e~a~~fY~~h~~kpff~~Lv~~mtSGPvvam   83 (161)
T 4fkx_A           11 SERTFIAVKPDGVQR-------NLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGM   83 (161)
T ss_dssp             TCEEEEEECHHHHHT-------TCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEE
T ss_pred             cccEEEEECHHHhcc-------CcHHHHHHHHHHCCCEEEEEEEecCCHHHHHHHHHHHcCCccHHHHHHHHhCCCcEEE
Confidence            478999999999872       46899999999866666            456999999999996       9999999


Q ss_pred             EEecccHHHHHHHHhCCCCCCCCCCCCcccccccccCeeEEEcCCCHHHHHHHhhhccCCCceeccccCCcCcccC
Q psy10009        160 VWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE  235 (235)
Q Consensus       160 ~l~g~nav~~~r~l~Gptdp~~A~P~siRa~fg~~~~~N~vHgSds~e~a~~ei~~fF~~~~~~~~~~~~~~~~~~  235 (235)
                      +|+|+|||+.||+|||||||.+|+|+|||++||.+..+|+||||||+|+|++||++||++.++++|..+.+.||||
T Consensus        84 vleg~naV~~~R~l~GpTdp~~A~PgTIR~~fg~~~~~N~vHgSDs~esA~rEI~~fF~~~e~~~~~~~~~~~~ye  159 (161)
T 4fkx_A           84 VWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIYE  159 (161)
T ss_dssp             EEESTTHHHHHHHHHCCSSGGGCCTTSHHHHHCCBTTBCCEEECSSHHHHHHHHHHHCCGGGSCCCCCTTHHHHCS
T ss_pred             EEeccChHHHHHHHhcCCChhhcCCCChhHhhCCCccceeEEeCCCHHHHHHHHHHcCChhhcccccccchhheec
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999997
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure
>2rpr_A Flywch-type zinc finger-containing protein 1; flywch domain, alternative splicing, DNA-binding, metal- binding, nucleus, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wj2_A Probable WRKY transcription factor 4; DNA-binding domain, zinc-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.79.1.1 PDB: 2lex_A* Back     alignment and structure
>2ayd_A WRKY transcription factor 1; beta strands, zinc finger; 1.60A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 9e-27
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 6e-25
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 6e-24
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-23
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-23
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 6e-23
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 6e-23
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 3e-22
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-22
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-22
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 5e-22
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 2e-21
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-21
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 2e-20
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-18
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 3e-14
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 98.5 bits (245), Expect = 9e-27
 Identities = 51/74 (68%), Positives = 64/74 (86%)

Query: 161 WEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEK 220
           WEGLN+VKTGRVMLG TNPADS PGT+RGD CIQVGRNI+HGSDSV+SA+KEI+LWF  +
Sbjct: 77  WEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPE 136

Query: 221 EVIGWTNASESWIY 234
           E++ + + +  W+Y
Sbjct: 137 ELVDYKSCAHDWVY 150
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 99.97
d1wj2a_71 WRKY DNA-binding protein 4 {Thale cress (Arabidops 86.31
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]

Probab=100.00  E-value=6.2e-41  Score=273.54  Aligned_cols=129  Identities=33%  Similarity=0.583  Sum_probs=122.0

Q ss_pred             CCccccCCCCCCCcCCCCCchhHHHHHHHHHHhhchhhh------------hhhhhcccCCCccc-------CccEEEEE
Q psy10009        100 EPTLALPSGSESNDCHDNPADKKKSTIMKTYSKLSLTKN------------IRLNLQNITKPLNG-------NDINNFEV  160 (235)
Q Consensus       100 e~t~alikP~~~~~~~~~~~~~~~~~il~~i~~~~~~~~------------~~~y~~~~~k~f~~-------sGpvval~  160 (235)
                      |+||++||||++.    +   +++|+|++.|.+.||.+.            .+||.+|.+++||.       ||||+||+
T Consensus         6 e~Tl~iIKPDav~----~---~~~g~Ii~~i~~~Gf~I~~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~mtSGPv~amv   78 (153)
T d1s57a_           6 EETYIMVKPDGIQ----R---GLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMA   78 (153)
T ss_dssp             EEEEEEECHHHHH----T---TCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHTGGGTTSSSHHHHHHHHTSSCEEEEE
T ss_pred             heeEEEEChhhhh----c---CCHHHHHHHHHHCCCEEEEEEeecCCHHHHHHHHHHHhcchhHHHHHhhccCCCeeeee
Confidence            7899999999887    2   468999999999777764            56999999999985       99999999


Q ss_pred             EecccHHHHHHHHhCCCCCCCCCCCCcccccccccCeeEEEcCCCHHHHHHHhhhccCCCceeccccCCcCcccC
Q psy10009        161 WEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVESAKKEIALWFTEKEVIGWTNASESWIYE  235 (235)
Q Consensus       161 l~g~nav~~~r~l~Gptdp~~A~P~siRa~fg~~~~~N~vHgSds~e~a~~ei~~fF~~~~~~~~~~~~~~~~~~  235 (235)
                      |+|+|||+.||+|+|||||.+|.|+|||++||.+.++|+||||||+++|++||+|||++.++++|..+.++|+||
T Consensus        79 l~g~nav~~~r~l~Gpt~p~~A~p~tiR~~yg~~~~~N~vHgSds~esA~rEi~~fFp~~ei~~~~~~~~~~~~~  153 (153)
T d1s57a_          79 WEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE  153 (153)
T ss_dssp             EEETTHHHHHHHHHCCSSTTTSCTTSHHHHHCCBTTBCCEEECSSHHHHHHHHHHHSCTTCCCCCCCTTHHHHCC
T ss_pred             ecccchhhhHHHhccCCCccccCCCCchhhheeeccCceeECCCCHHHHHHHHHHccChhhcccCcccccccccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999998
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure
>d1wj2a_ g.79.1.1 (A:) WRKY DNA-binding protein 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure