Psyllid ID: psy10125


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MWNKMSHFKLKLLLCFSSLCQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMSNPQKMRGRSNGRSGGDRGYRGSVRARGRPFNPDDKCYECGGRGHYARDCRSRRSGGSGRPELCKINGRRVRVEMSNPQKMRGRSNGRSGGDRGYRGSVRARGRPFNPDDKCYECGGRGHYARDCRSRRSGGGGRRRSAVSHAEVAPCQTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQIHEE
cccccHHHHHHHHHHHHHcccccccccHHHHHHccccEEEEEEEcccccccHHHHHHHHHccccccEEEEEcccccEEEEEEccHHHHHHHHHHccccEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEEEcccccccc
cHcHHHHHHHHEEEEEcccccHHHccccccEccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEccccccEEEEEEccHccHHHHHHcccccEEcccEEEEEEEccccccccccccccccccccccccccccccccccccEcccccccEEEccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccEEEEEEEccccccccEccccccEEEEEcccccccccccEEEEEEcccccccc
mwnkmshfKLKLLLCFSSLcqeaeiedPVMMIARYMLVIYVSIVLCstsstkediedafsyygpiknvwvarnppgfgfvefedrrdaedavrgfdgreingRRVRvemsnpqkmrgrsngrsggdrgyrgsvrargrpfnpddkcyecggrghyardcrsrrsggsgrpelckingrrvrvemsnpqkmrgrsngrsggdrgyrgsvrargrpfnpddkcyecggrghyardcrsrrsggggrrrsavshaevapcqtGIEYIISKYsavshaevapcqtgivtvkqhkgdslksgffipwvigpcqihee
MWNKMSHFKLKLLLCFSSLCQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEdavrgfdgreingrrvrvemsnpqkmrgrsngrsggdrgyrgsvrargrpfnpddkcyecggrghyardcrsrrsggsgrpelckingrrvrvemsnpqkmrgrsngrsggdrgyrgsvrargrpfnpddkcyecggrghyardcrsrrsggggrrrsavshaevapcqTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQIHEE
MWNKMSHfklklllcfsslcQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMSNPQKMrgrsngrsggdrgyrgsvrARGRPFNPDDKCYECGGRGHYARDCrsrrsggsgrPELCKINGRRVRVEMSNPQKMrgrsngrsggdrgyrgsvrARGRPFNPDDKCYECGGRGHYARDCrsrrsggggrrrsAVSHAEVAPCQTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQIHEE
*****SHFKLKLLLCFSSLCQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFED*************************************************************CYECGGRGHY*****************************************************************CYECGGRGHY*********************AEVAPCQTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQI***
*******FKLKLLLCFS*******************LVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVR***********************************************************************************************************************************************************************************VKQHKGDSLKSGFFIPWVIGPCQI***
********KLKLLLCFSSLCQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMS*******************RGSVRARGRPFNPDDKCYECGGRGHYARDC*********RPELCKINGRRVRVEMSN******************RGSVRARGRPFNPDDKCYECGGRGHYARDC******************EVAPCQTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQIHEE
MWNKMSHFKLKLLLCFSSLCQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMSNP******************GSVRARGRPFNPDDKCYECGGRGHYARDCRSR**********CKINGRRVRVEMS*********************************DKCYECGGRGHYARDCR*****************EVAPCQTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQIH**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWNKMSHFKLKLLLCFSSLCQEAEIEDPVMMIARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMSNPQKMRGRSNGRSGGDRGYRGSVRARGRPFNPDDKCYECGGRGHYARDCRSRRSGGSGRPELCKINGRRVRVEMSNPQKMRGRSNGRSGGDRGYRGSVRARGRPFNPDDKCYECGGRGHYARDCRSRRSGGGGRRRSAVSHAEVAPCQTGIEYIISKYSAVSHAEVAPCQTGIVTVKQHKGDSLKSGFFIPWVIGPCQIHEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
Q8BL97267 Serine/arginine-rich spli yes N/A 0.320 0.374 0.571 5e-28
Q16629238 Serine/arginine-rich spli yes N/A 0.365 0.478 0.531 6e-28
Q3T106235 Serine/arginine-rich spli yes N/A 0.365 0.485 0.531 6e-28
Q02427144 RNA-binding protein 1 OS= no N/A 0.198 0.430 0.677 1e-18
Q6K9C3200 Serine/arginine-rich spli yes N/A 0.333 0.52 0.448 2e-18
P84104164 Serine/arginine-rich spli no N/A 0.256 0.487 0.578 7e-18
P84103164 Serine/arginine-rich spli no N/A 0.256 0.487 0.578 7e-18
Q3SZR8164 Serine/arginine-rich spli no N/A 0.256 0.487 0.578 7e-18
Q69KL9185 Serine/arginine-rich spli no N/A 0.294 0.497 0.482 1e-17
Q6K4N0185 Serine/arginine-rich spli no N/A 0.333 0.562 0.409 3e-16
>sp|Q8BL97|SRSF7_MOUSE Serine/arginine-rich splicing factor 7 OS=Mus musculus GN=Srsf7 PE=1 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (68%), Gaps = 12/112 (10%)

Query: 48  TSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRV 107
           T + K ++E AFSYYGP++ VW+ARNPPGF FVEFED RDAEDAVRG DG+ I G RVRV
Sbjct: 49  TGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRV 108

Query: 108 EMSNPQKMRGRSNGRSGGDRGYRGSVRARGRPFNPDDKCYECGGRGHYARDC 159
           E+S     R R +         R   R   RPF+P+D+CYECG +GHYA DC
Sbjct: 109 ELSTGMPRRSRFD---------RPPAR---RPFDPNDRCYECGEKGHYAYDC 148




Required for pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10.
Mus musculus (taxid: 10090)
>sp|Q16629|SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 Back     alignment and function description
>sp|Q3T106|SRSF7_BOVIN Serine/arginine-rich splicing factor 7 OS=Bos taurus GN=SRSF7 PE=2 SV=1 Back     alignment and function description
>sp|Q02427|RBP1_DROME RNA-binding protein 1 OS=Drosophila melanogaster GN=Rbp1 PE=2 SV=3 Back     alignment and function description
>sp|Q6K9C3|RZP23_ORYSJ Serine/arginine-rich splicing factor RSZ23 OS=Oryza sativa subsp. japonica GN=RSZ23 PE=2 SV=1 Back     alignment and function description
>sp|P84104|SRSF3_MOUSE Serine/arginine-rich splicing factor 3 OS=Mus musculus GN=Srsf3 PE=1 SV=1 Back     alignment and function description
>sp|P84103|SRSF3_HUMAN Serine/arginine-rich splicing factor 3 OS=Homo sapiens GN=SRSF3 PE=1 SV=1 Back     alignment and function description
>sp|Q3SZR8|SRSF3_BOVIN Serine/arginine-rich splicing factor 3 OS=Bos taurus GN=SRSF3 PE=2 SV=1 Back     alignment and function description
>sp|Q69KL9|RZ21A_ORYSJ Serine/arginine-rich splicing factor RSZ21A OS=Oryza sativa subsp. japonica GN=RSZ21A PE=2 SV=1 Back     alignment and function description
>sp|Q6K4N0|RSZ21_ORYSJ Serine/arginine-rich splicing factor RSZ21 OS=Oryza sativa subsp. japonica GN=RSZP21 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
270012981202 hypothetical protein TcasGA2_TC010640 [T 0.378 0.584 0.620 1e-34
189241002200 PREDICTED: similar to conserved hypothet 0.378 0.59 0.620 1e-34
307180295156 Splicing factor, arginine/serine-rich 7 0.375 0.75 0.593 2e-34
322787527128 hypothetical protein SINV_15244 [Solenop 0.323 0.789 0.660 2e-33
242012315192 arginine/serine-rich splicing factor, pu 0.352 0.572 0.631 9e-33
193636560181 PREDICTED: serine/arginine-rich splicing 0.368 0.635 0.637 9e-32
328724546137 PREDICTED: serine/arginine-rich splicing 0.368 0.839 0.637 2e-31
110767678206 PREDICTED: serine/arginine-rich splicing 0.391 0.592 0.548 3e-31
383850973206 PREDICTED: serine/arginine-rich splicing 0.391 0.592 0.563 5e-31
307206112127 Splicing factor, arginine/serine-rich 7 0.375 0.921 0.554 5e-31
>gi|270012981|gb|EFA09429.1| hypothetical protein TcasGA2_TC010640 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (73%), Gaps = 11/129 (8%)

Query: 32  IARYMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDA 91
           ++RY     V +     S++K+++EDAF YYGP++NVWVARNPPGF FVEFED RDAEDA
Sbjct: 1   MSRYGSDCKVYVGDLGNSASKQELEDAFRYYGPLRNVWVARNPPGFAFVEFEDARDAEDA 60

Query: 92  VRGFDGREINGRRVRVEMSNPQKMRGRSNGRSGGDRGYRG-SVRARGRPFNPDDKCYECG 150
           +RG DGR I GRR RVEM         SNG+SG  R YRG   R+RGRPF+PDD+CYECG
Sbjct: 61  IRGLDGRTICGRRARVEM---------SNGKSGSGR-YRGPPPRSRGRPFHPDDRCYECG 110

Query: 151 GRGHYARDC 159
            RGHYARDC
Sbjct: 111 DRGHYARDC 119




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189241002|ref|XP_968789.2| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307180295|gb|EFN68328.1| Splicing factor, arginine/serine-rich 7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322787527|gb|EFZ13615.1| hypothetical protein SINV_15244 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242012315|ref|XP_002426878.1| arginine/serine-rich splicing factor, putative [Pediculus humanus corporis] gi|212511107|gb|EEB14140.1| arginine/serine-rich splicing factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193636560|ref|XP_001952396.1| PREDICTED: serine/arginine-rich splicing factor 7-like isoform 1 [Acyrthosiphon pisum] gi|328724544|ref|XP_003248180.1| PREDICTED: serine/arginine-rich splicing factor 7-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328724546|ref|XP_003248181.1| PREDICTED: serine/arginine-rich splicing factor 7-like isoform 3 [Acyrthosiphon pisum] gi|328724548|ref|XP_003248182.1| PREDICTED: serine/arginine-rich splicing factor 7-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|110767678|ref|XP_001122800.1| PREDICTED: serine/arginine-rich splicing factor 7 [Apis mellifera] gi|380013414|ref|XP_003690755.1| PREDICTED: serine/arginine-rich splicing factor 7-like [Apis florea] Back     alignment and taxonomy information
>gi|383850973|ref|XP_003701038.1| PREDICTED: serine/arginine-rich splicing factor 7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307206112|gb|EFN84192.1| Splicing factor, arginine/serine-rich 7 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
UNIPROTKB|Q3T106235 SRSF7 "Serine/arginine-rich sp 0.342 0.455 0.528 1.7e-27
UNIPROTKB|J9P2I8238 SRSF7 "Uncharacterized protein 0.342 0.449 0.528 1.7e-27
UNIPROTKB|C9JAB2235 SRSF7 "Serine/arginine-rich-sp 0.342 0.455 0.528 1.7e-27
UNIPROTKB|Q16629238 SRSF7 "Serine/arginine-rich sp 0.342 0.449 0.528 1.7e-27
UNIPROTKB|F1S4R5268 SRSF7 "Uncharacterized protein 0.342 0.399 0.528 1.7e-27
MGI|MGI:1926232267 Srsf7 "serine/arginine-rich sp 0.342 0.400 0.528 1.7e-27
RGD|1307425157 Srsf7 "serine/arginine-rich sp 0.342 0.681 0.528 1.7e-27
UNIPROTKB|D4A720238 Sfrs7 "Protein Sfrs7" [Rattus 0.342 0.449 0.528 1.7e-27
UNIPROTKB|Q5ZMI0223 SRSF7 "Uncharacterized protein 0.358 0.502 0.515 2.8e-27
ZFIN|ZDB-GENE-050913-95210 srsf7 "serine/arginine-rich sp 0.342 0.509 0.487 1.1e-25
UNIPROTKB|Q3T106 SRSF7 "Serine/arginine-rich splicing factor 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 308 (113.5 bits), Expect = 1.7e-27, P = 1.7e-27
 Identities = 64/121 (52%), Positives = 78/121 (64%)

Query:    39 IYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGR 98
             +YV  +   T + K ++E AFSYYGP++ VW+ARNPPGF FVEFED RDAEDAVRG DG+
Sbjct:    13 VYVGNL--GTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK 70

Query:    99 EINGRRVRVEMSNPQKMXXXXXXXXXXXXXXXXXXXARGRPFNPDDKCYECGGRGHYARD 158
              I G RVRVE+S                        AR RPF+P+D+CYECG +GHYA D
Sbjct:    71 VICGSRVRVELSTGMPRRSRFDRPP-----------AR-RPFDPNDRCYECGEKGHYAYD 118

Query:   159 C 159
             C
Sbjct:   119 C 119


GO:0048025 "negative regulation of mRNA splicing, via spliceosome" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
GO:0008380 "RNA splicing" evidence=IEA
GO:0006397 "mRNA processing" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|J9P2I8 SRSF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JAB2 SRSF7 "Serine/arginine-rich-splicing factor 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q16629 SRSF7 "Serine/arginine-rich splicing factor 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4R5 SRSF7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1926232 Srsf7 "serine/arginine-rich splicing factor 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307425 Srsf7 "serine/arginine-rich splicing factor 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A720 Sfrs7 "Protein Sfrs7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMI0 SRSF7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-95 srsf7 "serine/arginine-rich splicing factor 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3T106SRSF7_BOVINNo assigned EC number0.53170.36530.4851yesN/A
Q16629SRSF7_HUMANNo assigned EC number0.53170.36530.4789yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-33
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 3e-23
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 7e-23
smart0036073 smart00360, RRM, RNA recognition motif 1e-17
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-17
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 2e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-16
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 2e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-14
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 5e-14
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 2e-13
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 1e-12
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 2e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 4e-12
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-12
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 3e-11
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-11
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-11
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-11
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 5e-11
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 5e-11
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-10
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-10
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-10
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 3e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-10
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 4e-10
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 7e-10
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 1e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-09
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-09
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 3e-09
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 3e-09
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 3e-09
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 1e-08
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-08
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-08
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 1e-08
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-08
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-08
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 2e-08
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 2e-08
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 3e-08
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 3e-08
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 3e-08
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 5e-08
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 5e-08
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-08
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 9e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-07
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 1e-07
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 1e-07
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-07
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-07
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 1e-07
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-07
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-07
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 3e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-07
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 3e-07
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 3e-07
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 3e-07
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 4e-07
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 5e-07
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 6e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 7e-07
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 7e-07
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 9e-07
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 9e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 1e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 1e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 1e-06
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 1e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-06
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-06
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 2e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 3e-06
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 3e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-06
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 4e-06
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-06
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 4e-06
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-06
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-06
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 5e-06
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 5e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 5e-06
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 6e-06
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 9e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 9e-06
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 1e-05
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-05
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 1e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-05
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-05
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 1e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 1e-05
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-05
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-05
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-05
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 2e-05
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 2e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 3e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-05
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 3e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-05
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 4e-05
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 4e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 5e-05
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 5e-05
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 6e-05
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-05
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 6e-05
cd1260072 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 7e-05
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 7e-05
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 7e-05
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 8e-05
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 8e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-05
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 8e-05
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 9e-05
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 1e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 2e-04
cd1245870 cd12458, RRM_AtC3H46_like, RNA recognition motif i 2e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-04
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-04
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 3e-04
COG5082190 COG5082, AIR1, Arginine methyltransferase-interact 3e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 3e-04
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 3e-04
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 4e-04
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 4e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 5e-04
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 5e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 5e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 5e-04
cd1253384 cd12533, RRM_EWS, RNA recognition motif in vertebr 6e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 6e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 6e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 6e-04
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 6e-04
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 6e-04
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 6e-04
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 6e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 6e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 7e-04
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 7e-04
COG5082190 COG5082, AIR1, Arginine methyltransferase-interact 8e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 8e-04
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 9e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 9e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 0.001
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 0.001
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.001
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 0.001
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.002
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.002
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 0.002
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 0.002
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 0.002
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 0.002
smart0034317 smart00343, ZnF_C2HC, zinc finger 0.002
smart0034317 smart00343, ZnF_C2HC, zinc finger 0.002
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 0.002
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 0.002
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 0.002
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 0.002
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.002
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.002
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 0.002
cd1246588 cd12465, RRM_UHMK1, RNA recognition motif found in 0.002
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.003
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 0.003
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 0.003
cd1262577 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in 0.003
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 0.003
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 0.003
pfam0009818 pfam00098, zf-CCHC, Zinc knuckle 0.003
pfam0009818 pfam00098, zf-CCHC, Zinc knuckle 0.003
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.004
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.004
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.004
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 0.004
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
 Score =  117 bits (295), Expect = 2e-33
 Identities = 43/62 (69%), Positives = 49/62 (79%)

Query: 51  TKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMS 110
           TK ++ED F  YGP+++VWVARNPPGF FVEFED RDAEDAVR  DGR I G RVRVE+S
Sbjct: 12  TKRELEDEFEKYGPLRSVWVARNPPGFAFVEFEDPRDAEDAVRALDGRRICGNRVRVELS 71

Query: 111 NP 112
             
Sbjct: 72  RG 73


This subfamily corresponds to the RRM of two serine/arginine (SR) proteins, serine/arginine-rich splicing factor 3 (SRSF3) and serine/arginine-rich splicing factor 7 (SRSF7). SRSF3, also termed pre-mRNA-splicing factor SRp20, modulates alternative splicing by interacting with RNA cis-elements in a concentration- and cell differentiation-dependent manner. It is also involved in termination of transcription, alternative RNA polyadenylation, RNA export, and protein translation. SRSF3 is critical for cell proliferation, and tumor induction and maintenance. It can shuttle between the nucleus and cytoplasm. SRSF7, also termed splicing factor 9G8, plays a crucial role in both constitutive splicing and alternative splicing of many pre-mRNAs. Its localization and functions are tightly regulated by phosphorylation. SRSF7 is predominantly present in the nuclear and can shuttle between nucleus and cytoplasm. It cooperates with the export protein, Tap/NXF1, helps mRNA export to the cytoplasm, and enhances the expression of unspliced mRNA. Moreover, SRSF7 inhibits tau E10 inclusion through directly interacting with the proximal downstream intron of E10, a clustering region for frontotemporal dementia with Parkinsonism (FTDP) mutations. Both SRSF3 and SRSF7 contain a single N-terminal RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal RS domain rich in serine-arginine dipeptides. The RRM domain is involved in RNA binding, and the RS domain has been implicated in protein shuttling and protein-protein interactions. . Length = 73

>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241044 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240904 cd12458, RRM_AtC3H46_like, RNA recognition motif in Arabidopsis thaliana zinc finger CCCH domain-containing protein 46 (AtC3H46) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240977 cd12533, RRM_EWS, RNA recognition motif in vertebrate Ewing Sarcoma Protein (EWS) Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger Back     alignment and domain information
>gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology motif kinase 1 (UHMK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241069 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle Back     alignment and domain information
>gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG0109|consensus346 99.84
KOG0107|consensus195 99.8
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.73
KOG0109|consensus346 99.57
KOG0105|consensus241 99.47
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.43
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.42
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.41
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.39
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.38
KOG0126|consensus219 99.38
KOG0121|consensus153 99.38
KOG4207|consensus256 99.38
KOG0113|consensus335 99.37
PTZ00368148 universal minicircle sequence binding protein (UMS 99.36
PTZ00368148 universal minicircle sequence binding protein (UMS 99.36
KOG0122|consensus270 99.34
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.33
PLN03120260 nucleic acid binding protein; Provisional 99.33
KOG0125|consensus376 99.29
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.27
KOG0149|consensus247 99.26
PLN03213 759 repressor of silencing 3; Provisional 99.25
smart0036272 RRM_2 RNA recognition motif. 99.24
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.19
KOG0148|consensus321 99.18
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.18
PLN03121243 nucleic acid binding protein; Provisional 99.16
KOG0111|consensus298 99.16
KOG0117|consensus506 99.15
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.15
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.14
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.14
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.13
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.12
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.12
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.12
KOG0130|consensus170 99.1
KOG0148|consensus321 99.1
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.1
smart0036071 RRM RNA recognition motif. 99.07
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.05
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.03
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.03
KOG0145|consensus360 99.03
KOG0114|consensus124 99.02
KOG0144|consensus 510 98.97
KOG0117|consensus 506 98.97
KOG0153|consensus377 98.96
KOG0415|consensus479 98.95
KOG0131|consensus203 98.91
KOG0127|consensus 678 98.86
KOG0108|consensus 435 98.85
KOG0131|consensus203 98.84
KOG0145|consensus360 98.83
KOG0116|consensus419 98.82
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.8
KOG0146|consensus371 98.79
COG5082190 AIR1 Arginine methyltransferase-interacting protei 98.76
KOG0132|consensus 894 98.74
KOG4206|consensus221 98.71
KOG0124|consensus 544 98.71
KOG0106|consensus216 98.7
smart0036170 RRM_1 RNA recognition motif. 98.69
KOG0127|consensus 678 98.68
KOG0144|consensus 510 98.64
KOG4212|consensus 608 98.64
KOG0123|consensus369 98.63
KOG0146|consensus371 98.62
KOG0110|consensus725 98.57
KOG0147|consensus549 98.56
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.55
KOG4661|consensus 940 98.54
KOG4400|consensus261 98.5
KOG1457|consensus284 98.49
KOG4400|consensus261 98.48
KOG0533|consensus243 98.41
KOG4212|consensus608 98.39
KOG0124|consensus544 98.37
KOG4205|consensus311 98.35
KOG0123|consensus369 98.33
KOG0110|consensus725 98.31
KOG4209|consensus231 98.28
KOG4208|consensus214 98.28
COG5082190 AIR1 Arginine methyltransferase-interacting protei 98.26
KOG1548|consensus382 98.21
KOG1995|consensus351 98.2
KOG4205|consensus311 98.19
KOG4660|consensus 549 98.18
KOG0151|consensus 877 98.01
KOG4454|consensus267 98.0
KOG1190|consensus492 97.76
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.66
KOG4211|consensus 510 97.56
KOG1457|consensus284 97.52
KOG0226|consensus290 97.46
KOG4206|consensus221 97.46
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.4
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.35
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.35
KOG0120|consensus500 97.3
PF1369632 zf-CCHC_2: Zinc knuckle 97.25
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 97.24
KOG4211|consensus 510 97.13
KOG0106|consensus216 97.07
KOG0105|consensus241 97.01
KOG4210|consensus285 96.98
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.89
KOG0147|consensus549 96.77
KOG1548|consensus382 96.72
KOG0129|consensus520 96.65
KOG1456|consensus494 96.59
KOG1190|consensus492 96.57
PF1391742 zf-CCHC_3: Zinc knuckle 96.56
KOG1456|consensus494 96.54
KOG4849|consensus 498 96.42
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.34
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.31
KOG0335|consensus 482 96.22
KOG4307|consensus944 96.14
KOG2193|consensus 584 96.08
smart0034326 ZnF_C2HC zinc finger. 96.02
KOG0120|consensus500 95.74
KOG1365|consensus508 95.56
KOG1855|consensus484 95.54
KOG0112|consensus 975 95.45
KOG0129|consensus520 95.24
KOG2314|consensus 698 94.95
KOG2202|consensus260 94.92
KOG3152|consensus278 94.81
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 94.67
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.35
KOG0112|consensus 975 93.66
KOG0128|consensus881 93.46
KOG0115|consensus275 93.34
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 93.26
KOG4676|consensus 479 93.14
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 93.09
COG5222 427 Uncharacterized conserved protein, contains RING Z 93.07
KOG4307|consensus 944 92.9
KOG0119|consensus 554 92.86
KOG1996|consensus378 92.77
KOG1365|consensus508 92.39
KOG2416|consensus718 92.37
PF1369632 zf-CCHC_2: Zinc knuckle 92.01
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 91.66
KOG2068|consensus327 91.4
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.94
KOG0128|consensus881 90.1
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 90.03
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 90.0
PF1439249 zf-CCHC_4: Zinc knuckle 89.76
PF1528840 zf-CCHC_6: Zinc knuckle 89.72
KOG0119|consensus 554 89.63
PF15023166 DUF4523: Protein of unknown function (DUF4523) 89.62
KOG0107|consensus195 89.32
PF1391742 zf-CCHC_3: Zinc knuckle 88.59
KOG2591|consensus 684 87.43
smart0034326 ZnF_C2HC zinc finger. 85.69
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 84.1
KOG2253|consensus 668 83.98
KOG2135|consensus526 82.85
KOG4285|consensus350 82.65
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 81.16
>KOG0109|consensus Back     alignment and domain information
Probab=99.84  E-value=6.1e-21  Score=170.88  Aligned_cols=181  Identities=21%  Similarity=0.386  Sum_probs=144.7

Q ss_pred             eEEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeeCCCcEEEEEeCCHHHHHHHHHhCCCceeCCeEEEEEecCCCCCCCC
Q psy10125         39 IYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMSNPQKMRGR  118 (312)
Q Consensus        39 ~~l~V~nLp~~~teedL~~~F~~~G~I~~v~i~~~~kG~afV~f~~~~~A~~Ai~~l~g~~i~g~~i~V~~a~~~~~~~~  118 (312)
                      .+|||+|||..+++.+|+.+|++||+|++++|+   |.|+||+.++..+++.||..|++..|.|..|+|+-++.+.....
T Consensus         3 ~KLFIGNLp~~~~~~elr~lFe~ygkVlECDIv---KNYgFVHiEdktaaedairNLhgYtLhg~nInVeaSksKsk~st   79 (346)
T KOG0109|consen    3 VKLFIGNLPREATEQELRSLFEQYGKVLECDIV---KNYGFVHIEDKTAAEDAIRNLHGYTLHGVNINVEASKSKSKAST   79 (346)
T ss_pred             cchhccCCCcccchHHHHHHHHhhCceEeeeee---cccceEEeecccccHHHHhhcccceecceEEEEEeccccCCCcc
Confidence            579999999999999999999999999999999   66999999999999999999999999999999999998855444


Q ss_pred             CCCCCCC-CCCCCCCccCCCCCCCCCCccccCCCCCCCCcCCCCCCCCCCCCCccccccCcccccccCCCcccCCCCCCC
Q psy10125        119 SNGRSGG-DRGYRGSVRARGRPFNPDDKCYECGGRGHYARDCRSRRSGGSGRPELCKINGRRVRVEMSNPQKMRGRSNGR  197 (312)
Q Consensus       119 ~~g~~gG-~~g~~g~~r~~g~~~~~~~~c~~Cg~~Gh~a~~Cp~~~~~~~g~~~~c~~cG~~gh~~~~cp~~~~g~~~g~  197 (312)
                      ..+.++- ........|.....+++...|..-...+.+..+|.++....+.++++...-|++-|+..+.++-+-..+   
T Consensus        80 kl~vgNis~tctn~ElRa~fe~ygpviecdivkdy~fvh~d~~eda~~air~l~~~~~~gk~m~vq~stsrlrtapg---  156 (346)
T KOG0109|consen   80 KLHVGNISPTCTNQELRAKFEKYGPVIECDIVKDYAFVHFDRAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPG---  156 (346)
T ss_pred             ccccCCCCccccCHHHhhhhcccCCceeeeeecceeEEEEeeccchHHHHhcccccccccceeeeeeeccccccCCC---
Confidence            4443332 233344556666777776666666666666667777666666777888999999999988876543322   


Q ss_pred             CCCCCCCCCCccCCCCCCCCCccccccCCcCccccCCCCCCCCCC
Q psy10125        198 SGGDRGYRGSVRARGRPFNPDDKCYECGGRGHYARDCRSRRSGGG  242 (312)
Q Consensus       198 ~g~~~G~~g~~~~~~~~~~~~~~C~~Cg~~GH~ar~Cp~~~~~~~  242 (312)
                                       ++....||+||++|||+++||.+..+..
T Consensus       157 -----------------mgDq~~cyrcGkeghwskEcP~~~~~rv  184 (346)
T KOG0109|consen  157 -----------------MGDQSGCYRCGKEGHWSKECPVDRTGRV  184 (346)
T ss_pred             -----------------CCCHHHheeccccccccccCCccCCCcc
Confidence                             2234569999999999999999988753



>KOG0107|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4400|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4400|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 7e-21
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 1e-19
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 2e-19
1x4a_A109 Solution Structure Of Rrm Domain In Splicing Factor 1e-08
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 1e-07
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 1e-07
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-07
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 2e-07
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 4e-07
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 7e-07
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 9e-07
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 1e-06
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 3e-06
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 4e-06
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 5e-06
3pgw_S437 Crystal Structure Of Human U1 Snrnp Length = 437 8e-06
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 4e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 6e-05
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 7e-05
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 9e-05
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 1e-04
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 1e-04
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 1e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-04
2hyi_B91 Structure Of The Human Exon Junction Complex With A 1e-04
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 1e-04
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-04
1wf2_A98 Solution Structure Of Rrm Domain In Hnrpc Protein L 2e-04
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 3e-04
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 4e-04
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 4e-04
4a8x_A88 Structure Of The Core Asap Complex Length = 88 5e-04
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 6e-04
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 9e-04
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure

Iteration: 1

Score = 97.8 bits (242), Expect = 7e-21, Method: Composition-based stats. Identities = 44/63 (69%), Positives = 52/63 (82%) Query: 48 TSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRV 107 T + K ++E AFSYYGP++ VW+ARNPPGF FVEFED RDAEDAVRG DG+ I G RVRV Sbjct: 10 TGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRV 69 Query: 108 EMS 110 E+S Sbjct: 70 ELS 72
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|1X4A|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor Sf2 Length = 109 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1WF2|A Chain A, Solution Structure Of Rrm Domain In Hnrpc Protein Length = 98 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|4A8X|A Chain A, Structure Of The Core Asap Complex Length = 88 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.72
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.7
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.7
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.69
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.68
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.68
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.68
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.67
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.67
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.67
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.67
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.67
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.66
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.66
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.66
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.66
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.66
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.66
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.66
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.65
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.65
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.65
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.65
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.64
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.64
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.64
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.64
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.64
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.64
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.64
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.64
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.64
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.64
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.64
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.64
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.64
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.64
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.63
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.63
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.63
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.63
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.63
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.63
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.63
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.63
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.63
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.63
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.62
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.62
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.62
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.62
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.62
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.62
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.62
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.62
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.62
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.61
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.61
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.61
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.61
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.61
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.61
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.61
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.61
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.6
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.6
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.6
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.6
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.6
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.6
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.6
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.6
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.6
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.59
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.59
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.59
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.59
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.59
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.59
2div_A99 TRNA selenocysteine associated protein; structural 99.59
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.59
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.58
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.58
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.58
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.58
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.58
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.58
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.57
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.57
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.57
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.57
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.57
1x5p_A97 Negative elongation factor E; structure genomics, 99.57
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.57
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.57
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.57
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.57
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.56
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.56
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.56
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.56
2dis_A109 Unnamed protein product; structural genomics, RRM 99.56
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.56
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.56
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.56
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.55
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.33
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.55
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.55
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.55
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.55
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.55
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.55
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.55
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.55
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.54
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.54
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.54
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.54
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.54
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.54
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.54
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.54
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.53
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.53
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.53
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.53
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.52
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.52
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.52
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.52
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.52
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.52
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.51
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.51
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.51
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.51
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.5
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.5
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.49
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.49
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.49
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.49
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.48
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.47
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.47
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.47
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.46
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.45
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.45
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.44
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 99.44
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.44
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.43
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.43
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.42
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.42
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.41
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.41
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.41
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.41
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 99.4
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.4
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.4
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.4
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.39
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.38
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.38
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.37
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.37
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.37
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.37
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.37
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.36
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.36
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.35
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.35
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.34
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.32
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.32
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.32
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 99.31
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.31
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.31
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.31
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.3
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.29
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.29
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.28
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.28
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.26
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.25
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.24
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.23
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.22
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.21
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.2
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.18
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.14
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.14
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.13
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.08
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.06
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 99.05
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 99.05
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 99.04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.04
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 99.02
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 98.97
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 98.96
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 98.92
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.87
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.87
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 98.68
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.61
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 98.6
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 98.58
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 98.53
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 98.5
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 98.47
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 98.44
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 98.43
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 98.42
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 98.41
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 98.34
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 98.28
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.26
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.05
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 97.92
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 97.9
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 97.38
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 97.26
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 97.11
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 97.06
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.04
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.01
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 96.67
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.65
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.62
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 96.29
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.07
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 95.96
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.84
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.01
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.24
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.74
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 87.83
2i2y_A150 Fusion protein consists of immunoglobin G- binding 87.29
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.72  E-value=2.1e-17  Score=128.45  Aligned_cols=78  Identities=22%  Similarity=0.504  Sum_probs=72.3

Q ss_pred             CCCceEEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeeC-----CCcEEEEEeCCHHHHHHHHHhCCCceeCCeEEEEEe
Q psy10125         35 YMLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARN-----PPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEM  109 (312)
Q Consensus        35 ~~~~~~l~V~nLp~~~teedL~~~F~~~G~I~~v~i~~~-----~kG~afV~f~~~~~A~~Ai~~l~g~~i~g~~i~V~~  109 (312)
                      ..+.++|||+|||+++|+++|+++|++||.|..+.|+++     ++|||||+|.+.++|++|++.||+..|.|+.|+|++
T Consensus        16 ~~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~   95 (99)
T 4fxv_A           16 YFQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSY   95 (99)
T ss_dssp             CCCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEE
Confidence            344679999999999999999999999999999999865     478999999999999999999999999999999999


Q ss_pred             cCC
Q psy10125        110 SNP  112 (312)
Q Consensus       110 a~~  112 (312)
                      ++|
T Consensus        96 AkP   98 (99)
T 4fxv_A           96 ARP   98 (99)
T ss_dssp             CCB
T ss_pred             eeC
Confidence            975



>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-14
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 6e-14
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-13
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-12
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-12
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-11
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-11
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-11
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 9e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-10
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 5e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 5e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 9e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-09
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-09
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-09
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 7e-09
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 7e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-08
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 3e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-08
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 6e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 8e-07
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 9e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 8e-06
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 1e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-05
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-05
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-05
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-05
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 4e-05
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 7e-05
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 8e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 3e-04
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-04
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 0.002
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 0.002
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 0.002
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 0.003
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.004
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Heterogeneous nuclear ribonucleoproteins C1/C2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.3 bits (172), Expect = 5e-16
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 45  LCSTSSTKEDIEDAFSYYGPIKNVWVARNPPGFGFVEFEDRRDAEDAVRGFDGREINGRR 104
           L +    K D+E  FS YG I    V     GF FV++ + R+A  AV G DGR I G+ 
Sbjct: 23  LNTLVVKKSDVEAIFSKYGKIVGCSV---HKGFAFVQYVNERNARAAVAGEDGRMIAGQV 79

Query: 105 VRVEMSNPQKMRGRSNGRSG 124
           + + ++   K+  RS   SG
Sbjct: 80  LDINLAAEPKVN-RSGPSSG 98


>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.71
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.71
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.71
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.7
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.7
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.7
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.69
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.69
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.68
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.68
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.68
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.67
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.67
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.67
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.66
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.66
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.66
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.66
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.65
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.65
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.65
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.65
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.64
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.64
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.64
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.64
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.64
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.64
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.64
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.63
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.63
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.62
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.62
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.61
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.61
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.61
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.61
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.6
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.6
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.6
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.6
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.6
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.6
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.59
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.59
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.59
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.59
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.58
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.58
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.58
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.57
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.57
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.56
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.55
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.55
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.54
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.54
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.53
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.53
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.53
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.51
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.51
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.5
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.45
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.43
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.32
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.32
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.31
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.29
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.27
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.22
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.21
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.2
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.09
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 99.08
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.93
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 98.56
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 98.34
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 97.38
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.05
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.99
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 96.99
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.7
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 96.59
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 93.89
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 92.7
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 90.43
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 87.51
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 85.32
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 81.22
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.72  E-value=2.3e-17  Score=126.34  Aligned_cols=81  Identities=31%  Similarity=0.387  Sum_probs=74.5

Q ss_pred             CCceEEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeeC-----CCcEEEEEeCCHHHHHHHHHhCCCceeCCeEEEEEec
Q psy10125         36 MLVIYVSIVLCSTSSTKEDIEDAFSYYGPIKNVWVARN-----PPGFGFVEFEDRRDAEDAVRGFDGREINGRRVRVEMS  110 (312)
Q Consensus        36 ~~~~~l~V~nLp~~~teedL~~~F~~~G~I~~v~i~~~-----~kG~afV~f~~~~~A~~Ai~~l~g~~i~g~~i~V~~a  110 (312)
                      ..+++|||+|||+.+|+++|+++|++||.|..+.|+.+     ++|||||+|.+.++|++||+.||+..|.++.|+|+++
T Consensus         6 ~~~~~lfV~nL~~~~t~~~l~~~F~~~g~v~~v~i~~d~~tg~~~g~afV~f~~~~~a~~A~~~l~g~~~~gr~i~V~~a   85 (99)
T d1whwa_           6 SGSGRLFVRNLSYTSSEEDLEKLFSAYGPLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQVFQGRMLHVLPS   85 (99)
T ss_dssp             CSCEEEEEECCCTTCCHHHHHHHHHTTSCEEEEECCCCTTTCCCCSEEEEEESSHHHHHHHHHHTTTEESSSCEEEEEEC
T ss_pred             CCCCEEEEECCCCcCCHHHHHHHHHhcCCceeeeecccccccccCcceEEEECCHHHHHHHHHHcCCCEECCEEEEEEEC
Confidence            34678999999999999999999999999999999764     5899999999999999999999999999999999999


Q ss_pred             CCCCCC
Q psy10125        111 NPQKMR  116 (312)
Q Consensus       111 ~~~~~~  116 (312)
                      .++...
T Consensus        86 ~~~~~~   91 (99)
T d1whwa_          86 TIKKEA   91 (99)
T ss_dssp             CCCSTT
T ss_pred             CCCCcc
Confidence            987654



>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure