Psyllid ID: psy10145


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR
ccccccccccEEEEEccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccEEEEEccc
ccccccccccEEEEEccccccccccccHHHHHHHHHHccHHHHHHEHcccccccEEHHHHHHHHHHHcHHHccccccccHHHHHHHHHHcccccccEEEcccEEEEEccc
mknlsskqlhyvrcirpnqghhpklfeTGLVQHQVKYLGLLETVRIRRSgfcyrlpyehfvsrykllsprtwpfplcspiEAVHVIlhglpiphgefafgrsklfvrspr
mknlsskqLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPhgefafgrsklfvrspr
MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR
********LHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLF*****
MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR
MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR
****SSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSP*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
O43795 1136 Unconventional myosin-Ib no N/A 1.0 0.096 0.472 2e-26
Q05096 1136 Unconventional myosin-Ib yes N/A 1.0 0.096 0.472 2e-26
P46735 1107 Unconventional myosin-Ib yes N/A 1.0 0.099 0.463 2e-25
Q92002 1028 Unconventional myosin-Ic N/A N/A 1.0 0.107 0.481 3e-25
P47807 1045 Unconventional myosin-Ia no N/A 1.0 0.105 0.481 1e-24
Q9UBC5 1043 Unconventional myosin-Ia no N/A 1.0 0.105 0.472 2e-24
A5PF48 1026 Unconventional myosin-Ic no N/A 1.0 0.107 0.509 2e-24
O00159 1063 Unconventional myosin-Ic no N/A 0.972 0.100 0.485 3e-24
Q5ZLA6 1028 Unconventional myosin-Ic no N/A 1.0 0.107 0.454 4e-24
Q9WTI7 1063 Unconventional myosin-Ic no N/A 0.972 0.100 0.467 4e-24
>sp|O43795|MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 73/110 (66%)

Query: 1   MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHF 60
           MKNL +K  +Y+RCI+PN      +F   LV HQ++YLGLLE VR+RR+G+ +R  YE  
Sbjct: 582 MKNLQTKNPNYIRCIKPNDKKAAHIFNEALVCHQIRYLGLLENVRVRRAGYAFRQAYEPC 641

Query: 61  VSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR 110
           + RYK+L  +TWP         V V+ + L IP  E++FGRSK+F+R+PR
Sbjct: 642 LERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPR 691




Motor protein that may participate in process critical to neuronal development and function such as cell migration, neurite outgrowth and vesicular transport.
Homo sapiens (taxid: 9606)
>sp|Q05096|MYO1B_RAT Unconventional myosin-Ib OS=Rattus norvegicus GN=Myo1b PE=2 SV=1 Back     alignment and function description
>sp|P46735|MYO1B_MOUSE Unconventional myosin-Ib OS=Mus musculus GN=Myo1b PE=2 SV=3 Back     alignment and function description
>sp|Q92002|MYO1C_LITCT Unconventional myosin-Ic OS=Lithobates catesbeiana GN=Myo1c PE=2 SV=1 Back     alignment and function description
>sp|P47807|MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus GN=MYO1A PE=1 SV=2 Back     alignment and function description
>sp|Q9UBC5|MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens GN=MYO1A PE=1 SV=1 Back     alignment and function description
>sp|A5PF48|MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio GN=myo1c PE=3 SV=1 Back     alignment and function description
>sp|O00159|MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 Back     alignment and function description
>sp|Q5ZLA6|MYO1C_CHICK Unconventional myosin-Ic OS=Gallus gallus GN=MYO1C PE=2 SV=1 Back     alignment and function description
>sp|Q9WTI7|MYO1C_MOUSE Unconventional myosin-Ic OS=Mus musculus GN=Myo1c PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
242006356 1031 myosin Ib, putative [Pediculus humanus c 0.954 0.101 0.603 2e-35
270002310 1011 hypothetical protein TcasGA2_TC001321 [T 1.0 0.108 0.572 2e-32
189234926 1040 PREDICTED: similar to unconventional myo 1.0 0.105 0.572 2e-32
241618557 1096 myosin IA, putative [Ixodes scapularis] 1.0 0.100 0.536 3e-29
291243929 1050 PREDICTED: predicted protein-like [Sacco 1.0 0.104 0.490 3e-26
224055879 1136 PREDICTED: unconventional myosin-Ib [Tae 1.0 0.096 0.490 5e-26
348511695 1050 PREDICTED: myosin-Ib isoform 3 [Oreochro 1.0 0.104 0.481 8e-26
348511693 1079 PREDICTED: myosin-Ib isoform 2 [Oreochro 1.0 0.101 0.481 8e-26
321463836 1029 hypothetical protein DAPPUDRAFT_306979 [ 0.972 0.103 0.485 9e-26
348511691 1137 PREDICTED: myosin-Ib isoform 1 [Oreochro 1.0 0.096 0.481 9e-26
>gi|242006356|ref|XP_002424017.1| myosin Ib, putative [Pediculus humanus corporis] gi|212507309|gb|EEB11279.1| myosin Ib, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/116 (60%), Positives = 89/116 (76%), Gaps = 11/116 (9%)

Query: 1   MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHF 60
           ++NLSSKQ HYVRCI+PN+   P++FET LVQHQ++YL L+ETVR+RR GFC++L YE F
Sbjct: 580 LQNLSSKQPHYVRCIKPNELKQPRIFETALVQHQIRYLCLIETVRVRRQGFCFKLEYESF 639

Query: 61  VSRYKLLSPRTWP------FPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR 110
           ++RYK+LS  TWP      FP     E V  +L  LPIP+GEFAFGR+K+FVRSPR
Sbjct: 640 LNRYKMLSLYTWPNWKKNSFP-----EGVSRLLKDLPIPNGEFAFGRTKVFVRSPR 690




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270002310|gb|EEZ98757.1| hypothetical protein TcasGA2_TC001321 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234926|ref|XP_971077.2| PREDICTED: similar to unconventional myosin 95e [Tribolium castaneum] Back     alignment and taxonomy information
>gi|241618557|ref|XP_002408349.1| myosin IA, putative [Ixodes scapularis] gi|215502978|gb|EEC12472.1| myosin IA, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|291243929|ref|XP_002741852.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|224055879|ref|XP_002194105.1| PREDICTED: unconventional myosin-Ib [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|348511695|ref|XP_003443379.1| PREDICTED: myosin-Ib isoform 3 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348511693|ref|XP_003443378.1| PREDICTED: myosin-Ib isoform 2 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|321463836|gb|EFX74849.1| hypothetical protein DAPPUDRAFT_306979 [Daphnia pulex] Back     alignment and taxonomy information
>gi|348511691|ref|XP_003443377.1| PREDICTED: myosin-Ib isoform 1 [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
UNIPROTKB|F1SN33 667 F1SN33 "Uncharacterized protei 0.990 0.163 0.495 3.9e-24
UNIPROTKB|A6QLD6 1136 MYO1B "Uncharacterized protein 0.990 0.095 0.504 8.2e-24
UNIPROTKB|F1NTJ5 1100 Gga.13962 "Uncharacterized pro 0.990 0.099 0.495 9.9e-24
ZFIN|ZDB-GENE-030131-695 1168 myo1b "myosin IB" [Danio rerio 1.0 0.094 0.490 1.1e-23
UNIPROTKB|G1T0J3 1136 MYO1B "Uncharacterized protein 1.0 0.096 0.481 1.3e-23
UNIPROTKB|J9NW77 1107 MYO1B "Uncharacterized protein 0.990 0.098 0.486 4.4e-23
UNIPROTKB|E2RB62 1136 MYO1B "Uncharacterized protein 0.990 0.095 0.486 4.6e-23
UNIPROTKB|E9PDF6 1107 MYO1B "Unconventional myosin-I 1.0 0.099 0.472 5.6e-23
UNIPROTKB|O43795 1136 MYO1B "Unconventional myosin-I 1.0 0.096 0.472 5.8e-23
UNIPROTKB|D2H883 1136 PANDA_006422 "Putative unchara 0.990 0.095 0.486 5.8e-23
UNIPROTKB|F1SN33 F1SN33 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 3.9e-24, P = 3.9e-24
 Identities = 55/111 (49%), Positives = 76/111 (68%)

Query:     1 MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHF 60
             MKNL +K  +Y+RCI+PN      +F  GLV HQ++YLGLLE VR+RR+G+ +R  YE  
Sbjct:   392 MKNLQTKNPNYIRCIKPNDKKAAHIFNEGLVCHQIRYLGLLENVRVRRAGYAFRQAYEPC 451

Query:    61 VSRYKLLSPRTWPFPLCSPIEA-VHVILHGLPIPHGEFAFGRSKLFVRSPR 110
             + RYK+L  +TWP     P  A V V+ + L IP  E++FGRSK+F+R+PR
Sbjct:   452 LERYKMLCKQTWPH-WKGPARAGVEVLFNELEIPVEEYSFGRSKIFIRNPR 501




GO:0016459 "myosin complex" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003774 "motor activity" evidence=IEA
UNIPROTKB|A6QLD6 MYO1B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTJ5 Gga.13962 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-695 myo1b "myosin IB" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G1T0J3 MYO1B "Uncharacterized protein" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW77 MYO1B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RB62 MYO1B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDF6 MYO1B "Unconventional myosin-Ib" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O43795 MYO1B "Unconventional myosin-Ib" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D2H883 PANDA_006422 "Putative uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
cd01378674 cd01378, MYSc_type_I, Myosin motor domain, type I 6e-46
smart00242677 smart00242, MYSc, Myosin 2e-40
pfam00063679 pfam00063, Myosin_head, Myosin head (motor domain) 4e-37
cd00124679 cd00124, MYSc, Myosin motor domain 1e-34
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 4e-31
cd01377693 cd01377, MYSc_type_II, Myosin motor domain, type I 4e-23
cd01381671 cd01381, MYSc_type_VII, Myosin motor domain, type 3e-22
cd01383677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 3e-19
cd01387677 cd01387, MYSc_type_XV, Myosin motor domain, type X 1e-18
cd01380691 cd01380, MYSc_type_V, Myosin motor domain, type V 2e-18
cd01379653 cd01379, MYSc_type_III, Myosin motor domain, type 2e-17
cd01384674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 5e-17
cd01385692 cd01385, MYSc_type_IX, Myosin motor domain, type I 7e-17
PTZ00014821 PTZ00014, PTZ00014, myosin-A; Provisional 1e-11
cd01382717 cd01382, MYSc_type_VI, Myosin motor domain, type V 2e-06
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
 Score =  156 bits (396), Expect = 6e-46
 Identities = 52/110 (47%), Positives = 70/110 (63%)

Query: 1   MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHF 60
           ++ L     HY+RCI+PN+   P  F+   V HQVKYLGLLE VR+RR+GF YR  ++ F
Sbjct: 556 VETLMKCTPHYIRCIKPNETKSPNDFDESRVLHQVKYLGLLENVRVRRAGFAYRQTFDKF 615

Query: 61  VSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR 110
           + RYKLLSP+TWP         V VIL  L I   E+  G++K+F+R+P 
Sbjct: 616 LQRYKLLSPKTWPTWPGDAKSGVEVILKDLNIDPEEYQMGKTKIFIRNPE 665


Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 674

>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
cd01378674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01377693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
PTZ00014821 myosin-A; Provisional 100.0
cd01383677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01382717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
cd01380691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01386767 MYSc_type_XVIII Myosin motor domain, type XVIII my 100.0
smart00242677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
cd01381671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01385692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd01384674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
cd00124679 MYSc Myosin motor domain. This catalytic (head) do 100.0
cd01387677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd01379653 MYSc_type_III Myosin motor domain, type III myosin 100.0
PF00063689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
KOG0162|consensus 1106 99.96
KOG0161|consensus 1930 99.96
KOG0164|consensus 1001 99.95
KOG0163|consensus 1259 99.94
KOG0160|consensus 862 99.93
KOG4229|consensus 1062 96.28
KOG4229|consensus 1062 87.29
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
Probab=100.00  E-value=1.9e-37  Score=240.50  Aligned_cols=110  Identities=47%  Similarity=0.898  Sum_probs=103.9

Q ss_pred             CCCcCCCCCeeEEeccCCCCCCCCccchHHHHHHHHhhchhHHHHHHhhcccccccHHHHHhhhhhhcCCCCCCCCCChH
Q psy10145          1 MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPI   80 (110)
Q Consensus         1 m~~l~~t~~~fIrCIkPN~~~~p~~fd~~~v~~Ql~~~gi~e~~~~~~~gyp~r~~~~~F~~ry~~l~~~~~~~~~~~~~   80 (110)
                      |++|++|+||||||||||+.+.|+.||...|.+||+|+||+|++++++.|||+|++|.+|++||+.|++..++....+++
T Consensus       556 m~~L~~t~phfIRCIKPN~~k~p~~Fd~~~V~~QLr~~GvLE~iri~r~Gyp~R~~~~~F~~rY~~L~~~~~~~~~~~~k  635 (674)
T cd01378         556 VETLMKCTPHYIRCIKPNETKSPNDFDESRVLHQVKYLGLLENVRVRRAGFAYRQTFDKFLQRYKLLSPKTWPTWPGDAK  635 (674)
T ss_pred             HHHHHccCCeEEEEECCCccCCchhcCHHHHHHHHHhcChHHHHHHHhcCCCccccHHHHHHHHHHhCcccccccCCCHH
Confidence            56899999999999999999999999999999999999999999999999999999999999999999986555556889


Q ss_pred             HHHHHHHhhCCCCCCCeEeCcceEEcccCC
Q psy10145         81 EAVHVILHGLPIPHGEFAFGRSKLFVRSPR  110 (110)
Q Consensus        81 ~~~~~ll~~~~~~~~~~~~G~tkVFlr~g~  110 (110)
                      +.|+.||+.+++++++|++|+||||||+|+
T Consensus       636 ~~~~~iL~~~~~~~~~~~~GkTkVFlr~~~  665 (674)
T cd01378         636 SGVEVILKDLNIDPEEYQMGKTKIFIRNPE  665 (674)
T ss_pred             HHHHHHHHHcCCCcccEEecCceEEEeCch
Confidence            999999999999999999999999999984



Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon

>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
1lkx_A697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 6e-21
4a7f_C697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 6e-21
1qvi_A840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 6e-17
1kk7_A837 Scallop Myosin In The Near Rigor Conformation Lengt 6e-17
1b7t_A835 Myosin Digested By Papain Length = 835 6e-17
1dfl_A831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 6e-17
1dfk_A830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 6e-17
2ec6_A838 Placopecten Striated Muscle Myosin Ii Length = 838 7e-17
4db1_A783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 3e-16
3i5g_A839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 2e-15
2os8_A840 Rigor-Like Structures Of Muscle Myosins Reveal Key 9e-15
2w4g_M840 Isometrically Contracting Insect Asynchronous Fligh 5e-14
2mys_A843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 6e-14
1m8q_A840 Molecular Models Of Averaged Rigor Crossbridges Fro 6e-14
1mma_A762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 7e-14
1w9i_A770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 7e-14
1w9k_A770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 7e-14
2aka_A776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 2e-13
1yv3_A762 The Structural Basis Of Blebbistatin Inhibition And 2e-13
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 2e-13
1fmv_A761 Crystal Structure Of The Apo Motor Domain Of Dictyo 2e-13
1d0x_A761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 2e-13
2xel_A776 Molecular Mechanism Of Pentachloropseudilin Mediate 2e-13
2xo8_A776 Crystal Structure Of Myosin-2 In Complex With Tribr 2e-13
3mnq_A788 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-13
3myh_X762 Insights Into The Importance Of Hydrogen Bonding In 2e-13
2jhr_A788 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-13
1w9l_A770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-13
1w9j_A770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-13
1mmd_A762 Truncated Head Of Myosin From Dictyostelium Discoid 2e-13
1jwy_A776 Crystal Structure Of The Dynamin A Gtpase Domain Co 2e-13
1mmg_A762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 4e-13
1lvk_A762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 6e-13
1mmn_A762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 6e-13
2y0r_X758 Structural Basis For The Allosteric Interference Of 9e-13
1w8j_A766 Crystal Structure Of Myosin V Motor Domain - Nucleo 1e-12
1oe9_A795 Crystal Structure Of Myosin V Motor With Essential 1e-12
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 1e-12
2y9e_X758 Structural Basis For The Allosteric Interference Of 2e-12
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 2e-11
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 4e-10
1br1_A820 Smooth Muscle Myosin Motor Domain-Essential Light C 4e-10
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 4e-10
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 4e-10
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 4e-10
1br2_A791 Smooth Muscle Myosin Motor Domain Complexed With Mg 4e-10
2x9h_A695 Crystal Structure Of Myosin-2 Motor Domain In Compl 5e-06
3mkd_A692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 9e-06
2x51_A789 M6 Delta Insert1 Length = 789 5e-04
2vas_A788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 5e-04
2bkh_A814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 5e-04
4e7z_A798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 5e-04
4dbq_A788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 5e-04
4dbp_A814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 5e-04
2bki_A858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 5e-04
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 5e-04
3l9i_A814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 5e-04
2v26_A784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 5e-04
4dbr_A786 Myosin Vi D179y (md) Pre-powerstroke State Length = 5e-04
4e7s_A798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 5e-04
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure

Iteration: 1

Score = 95.9 bits (237), Expect = 6e-21, Method: Composition-based stats. Identities = 43/100 (43%), Positives = 62/100 (62%) Query: 10 HYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSP 69 HYVRCI+ N + + V+HQV+YLGLLE VR+RR+GF R+ Y F +RYK+L Sbjct: 583 HYVRCIKSNDNKQAGVIDEDRVRHQVRYLGLLENVRVRRAGFAGRIEYTRFYNRYKMLCK 642 Query: 70 RTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSP 109 +TWP + +A +IL I E G++K+F+R+P Sbjct: 643 KTWPSFNGTAKQATELILQQHNIDKEEIRMGKTKVFIRNP 682
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
1lkx_A697 Myosin IE heavy chain; myosin motor domain, lever 9e-49
2v26_A784 Myosin VI; calmodulin-binding, nucleotide-binding, 5e-42
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 7e-42
1w9i_A770 Myosin II heavy chain; molecular motor, ATPase, mo 9e-42
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 4e-41
4db1_A783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 1e-40
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 4e-40
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 2e-39
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 4e-39
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-39
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
 Score =  163 bits (415), Expect = 9e-49
 Identities = 44/110 (40%), Positives = 65/110 (59%)

Query: 1   MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHF 60
           +  L +   HYVRCI+ N      + +   V+HQV+YLGLLE VR+RR+GF  R+ Y  F
Sbjct: 574 ITTLLACSPHYVRCIKSNDNKQAGVIDEDRVRHQVRYLGLLENVRVRRAGFAGRIEYTRF 633

Query: 61  VSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSPR 110
            +RYK+L  +TWP    +  +A  +IL    I   E   G++K+F+R+P 
Sbjct: 634 YNRYKMLCKKTWPSFNGTAKQATELILQQHNIDKEEIRMGKTKVFIRNPT 683


>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
1lkx_A697 Myosin IE heavy chain; myosin motor domain, lever 100.0
4db1_A783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
2v26_A784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
1w9i_A770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
Probab=100.00  E-value=9.3e-38  Score=241.71  Aligned_cols=109  Identities=40%  Similarity=0.770  Sum_probs=97.7

Q ss_pred             CCCcCCCCCeeEEeccCCCCCCCCccchHHHHHHHHhhchhHHHHHHhhcccccccHHHHHhhhhhhcCCCCCCCCCChH
Q psy10145          1 MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPI   80 (110)
Q Consensus         1 m~~l~~t~~~fIrCIkPN~~~~p~~fd~~~v~~Ql~~~gi~e~~~~~~~gyp~r~~~~~F~~ry~~l~~~~~~~~~~~~~   80 (110)
                      |++|++|+||||||||||+.+.|+.||..+|.+||+|+||+|++++++.|||+|++|.+|++||++|.|..++.+..+++
T Consensus       574 m~~L~~t~phfVRCIkPN~~k~p~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~R~~~~eF~~RY~~L~~~~~~~~~~~~k  653 (697)
T 1lkx_A          574 ITTLLACSPHYVRCIKSNDNKQAGVIDEDRVRHQVRYLGLLENVRVRRAGFAGRIEYTRFYNRYKMLCKKTWPSFNGTAK  653 (697)
T ss_dssp             HHHHTTSEEEEEEEECCCTTCCTTCCCHHHHHHHHHHHTSHHHHHHHHHSCSBCCBSHHHHTTSCSSSCC---------C
T ss_pred             HHHHHccCCcceEeecCCCcCCCCCcChhhccccCcccccHHHHHHHhcCCCccccHHHHHHHHHHhCcccccccCCCHH
Confidence            56899999999999999999999999999999999999999999999999999999999999999999987777666889


Q ss_pred             HHHHHHHhhCCCCCCCeEeCcceEEcccC
Q psy10145         81 EAVHVILHGLPIPHGEFAFGRSKLFVRSP  109 (110)
Q Consensus        81 ~~~~~ll~~~~~~~~~~~~G~tkVFlr~g  109 (110)
                      +.|+.+|+.+++++++|++|+||||||+|
T Consensus       654 ~~~~~ll~~~~~~~~~~~~G~TKVF~r~~  682 (697)
T 1lkx_A          654 QATELILQQHNIDKEEIRMGKTKVFIRNP  682 (697)
T ss_dssp             HHHHHHHHTTCCCGGGEEECSSBEEESSS
T ss_pred             HHHHHHHHHcCCCcCcEEeCCeeEEEeCC
Confidence            99999999999999999999999999986



>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1br2a2710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 9e-41
d1lkxa_684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 1e-40
d1d0xa2712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 4e-38
d1kk8a2789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 2e-37
d1w7ja2730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 8e-37
d2mysa2794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 9e-36
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]
 Score =  140 bits (353), Expect = 9e-41
 Identities = 32/109 (29%), Positives = 55/109 (50%)

Query: 1   MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHF 60
           M  L +   ++VRCI PN        +  LV  Q++  G+LE +RI R GF  R+ ++ F
Sbjct: 592 MTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEF 651

Query: 61  VSRYKLLSPRTWPFPLCSPIEAVHVILHGLPIPHGEFAFGRSKLFVRSP 109
             RY++L+    P       +A  +++  L +    +  G+SK+F R+ 
Sbjct: 652 RQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTG 700


>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]
Probab=100.00  E-value=3.4e-37  Score=237.79  Aligned_cols=109  Identities=29%  Similarity=0.561  Sum_probs=104.0

Q ss_pred             CCCcCCCCCeeEEeccCCCCCCCCccchHHHHHHHHhhchhHHHHHHhhcccccccHHHHHhhhhhhcCCCCCCCCCChH
Q psy10145          1 MKNLSSKQLHYVRCIRPNQGHHPKLFETGLVQHQVKYLGLLETVRIRRSGFCYRLPYEHFVSRYKLLSPRTWPFPLCSPI   80 (110)
Q Consensus         1 m~~l~~t~~~fIrCIkPN~~~~p~~fd~~~v~~Ql~~~gi~e~~~~~~~gyp~r~~~~~F~~ry~~l~~~~~~~~~~~~~   80 (110)
                      |++|++|+||||||||||+.+.|+.||...|.+||+++||+|++++++.|||+|++|.+|++||++|.+...+....+.+
T Consensus       592 ~~~L~~t~~hfIRCIKPN~~k~p~~Fd~~~V~~QLr~~Gvle~vri~r~Gyp~R~~~~eF~~RY~~L~~~~~~~~~~d~~  671 (710)
T d1br2a2         592 MTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGK  671 (710)
T ss_dssp             HHHHHTSEEEEEEEECCCSSCCTTCCCHHHHHHHHHHTTHHHHHHHHHHSCCEEEEHHHHHHHHGGGGTTSSCSSCCCHH
T ss_pred             HHHHhCCCCeEEEEeCcCCCCCCCCCCHHHHHHHHHHhCHHHHHHHHhcCCCccccHHHHHHHHHHhCcccccCCCCCHH
Confidence            46789999999999999999999999999999999999999999999999999999999999999999987766667899


Q ss_pred             HHHHHHHhhCCCCCCCeEeCcceEEcccC
Q psy10145         81 EAVHVILHGLPIPHGEFAFGRSKLFVRSP  109 (110)
Q Consensus        81 ~~~~~ll~~~~~~~~~~~~G~tkVFlr~g  109 (110)
                      +.|+.+|+.+++++++|++|+||||||+|
T Consensus       672 ~~~~~lL~~l~~~~~~~~iG~TkVFlr~~  700 (710)
T d1br2a2         672 QACILMIKALELDPNLYRIGQSKIFFRTG  700 (710)
T ss_dssp             HHHHHHHHHHTCCGGGEEECSSEEEECTT
T ss_pred             HHHHHHHHHcCCCcceEEecCCeEEECCC
Confidence            99999999999999999999999999987



>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure