Psyllid ID: psy10147


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MSSPDVEPVSRRPTVPPPQPPPSAKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
ccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccc
cccccccHHHHHHHHHHHccccccccccccccccHHHHHccccHHHEEEHHHcccHHHHHHHHHcHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHcccHHHHcccccccccccHHHHHHHHHHcccc
msspdvepvsrrptvpppqpppsakmvtitngpRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPtymssylganshslsftamPYVLNSLFCIVAghfadnlvshsWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSafnsagflashadiapnhagVTFAISNTL
msspdvepvsrrptvpppqpppsaKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
MSSPDVEpvsrrptvpppqpppsAKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
**************************VTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAI****
*SSPDVE***************************WISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
**********************SAKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
***PDVEPVSRRPTVPPPQPP********TNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPDVEPVSRRPTVPPPQPPPSAKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVIISMGLSAFNSAGFLASHADIAPNHAGVTFAISNTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query179 2.2.26 [Sep-21-2011]
Q8GX78541 Probable anion transporte yes N/A 0.927 0.306 0.333 1e-21
Q652N5591 Probable anion transporte yes N/A 0.804 0.243 0.351 2e-21
Q9SDI4529 Probable anion transporte no N/A 0.804 0.272 0.371 2e-21
Q9NRA2495 Sialin OS=Homo sapiens GN yes N/A 0.810 0.292 0.390 7e-21
Q9MZD1495 Sialin OS=Ovis aries GN=S N/A N/A 0.810 0.292 0.397 2e-20
Q8BN82495 Sialin OS=Mus musculus GN yes N/A 0.810 0.292 0.390 1e-19
O82390512 Sodium-dependent phosphat no N/A 0.804 0.281 0.351 4e-19
Q8W0H5519 Probable anion transporte no N/A 0.815 0.281 0.306 3e-17
Q53P54428 Probable anion transporte no N/A 0.927 0.387 0.296 2e-16
Q53WP9535 Probable anion transporte no N/A 0.877 0.293 0.298 9e-16
>sp|Q8GX78|ANTR2_ARATH Probable anion transporter 2, chloroplastic OS=Arabidopsis thaliana GN=ANTR2 PE=2 SV=1 Back     alignment and function desciption
 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 91/177 (51%), Gaps = 11/177 (6%)

Query: 13  PTVPPPQPPPSAKMVTITNGPR-------WISFISHWSLWSVYIAHFAMNWSTYIIMQWL 65
           P   P       K++   + PR       W   +S   +W++ I+HF  NW T+I++ W+
Sbjct: 314 PKDDPDLSEEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWM 373

Query: 66  PTYMSSYLGAN-SHSLSFTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLI 124
           PTY +  L  N + S     +P++  ++F  + G  AD LVS   ++  VR++M SIG +
Sbjct: 374 PTYYNQVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSRGLSITNVRKIMQSIGFL 433

Query: 125 GPAVFLIFFCAVDNLLFAVI---ISMGLSAFNSAGFLASHADIAPNHAGVTFAISNT 178
           GPA FL     V     AV+    S G  AF+ +G  ++H DI P +AGV   +SNT
Sbjct: 434 GPAFFLSQLSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNT 490




Inorganic phosphate and probable anion transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q652N5|PHT44_ORYSJ Probable anion transporter 4, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SDI4|PHT41_ORYSJ Probable anion transporter 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NRA2|S17A5_HUMAN Sialin OS=Homo sapiens GN=SLC17A5 PE=1 SV=2 Back     alignment and function description
>sp|Q9MZD1|S17A5_SHEEP Sialin OS=Ovis aries GN=SLC17A5 PE=2 SV=1 Back     alignment and function description
>sp|Q8BN82|S17A5_MOUSE Sialin OS=Mus musculus GN=Slc17a5 PE=2 SV=2 Back     alignment and function description
>sp|O82390|ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic OS=Arabidopsis thaliana GN=ANTR1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W0H5|PHT43_ORYSJ Probable anion transporter 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;3 PE=2 SV=1 Back     alignment and function description
>sp|Q53P54|PHT46_ORYSJ Probable anion transporter 6 OS=Oryza sativa subsp. japonica GN=PHT4;6 PE=2 SV=1 Back     alignment and function description
>sp|Q53WP9|PHT42_ORYSJ Probable anion transporter 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
242021014 400 conserved hypothetical protein [Pediculu 0.815 0.365 0.724 1e-55
443710431 409 hypothetical protein CAPTEDRAFT_173625 [ 0.921 0.403 0.616 1e-54
350427489 406 PREDICTED: sodium-dependent phosphate tr 0.854 0.376 0.692 2e-54
383863548 406 PREDICTED: sodium-dependent phosphate tr 0.854 0.376 0.679 2e-54
340727901 406 PREDICTED: sodium-dependent phosphate tr 0.854 0.376 0.685 6e-54
48101741 406 PREDICTED: sialin-like [Apis mellifera] 0.815 0.359 0.704 7e-54
156547110 406 PREDICTED: sodium-dependent phosphate tr 0.938 0.413 0.614 9e-54
380016728 406 PREDICTED: probable anion transporter 2, 0.815 0.359 0.697 1e-53
307199621258 Sialin [Harpegnathos saltator] 0.938 0.651 0.614 1e-53
332023424 406 Sodium-dependent phosphate transport pro 0.815 0.359 0.691 2e-53
>gi|242021014|ref|XP_002430942.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516160|gb|EEB18204.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (83%), Gaps = 3/149 (2%)

Query: 34  RWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSFTAMPYVLNSLF 93
           RW  F+ HW LW++YIAHFAMNWS YIIMQWLPTY+S  LGAN  S+S TAMPY++NSL 
Sbjct: 201 RWSEFLRHWPLWALYIAHFAMNWSNYIIMQWLPTYLSRNLGANKESISLTAMPYIVNSLV 260

Query: 94  CIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVI---ISMGLS 150
            IVAGHFAD L++  WTVL+VRRLMTSIGL+GP +FL+ FCAVDNLL AVI   ISMGL 
Sbjct: 261 GIVAGHFADKLINRRWTVLSVRRLMTSIGLLGPGIFLLAFCAVDNLLAAVIIVCISMGLC 320

Query: 151 AFNSAGFLASHADIAPNHAGVTFAISNTL 179
           A NSAG L+++ADIAPNHAG+TFAISNTL
Sbjct: 321 ACNSAGHLSNYADIAPNHAGLTFAISNTL 349




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|443710431|gb|ELU04684.1| hypothetical protein CAPTEDRAFT_173625 [Capitella teleta] Back     alignment and taxonomy information
>gi|350427489|ref|XP_003494774.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383863548|ref|XP_003707242.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340727901|ref|XP_003402272.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|48101741|ref|XP_392708.1| PREDICTED: sialin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|156547110|ref|XP_001602716.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380016728|ref|XP_003692327.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Apis florea] Back     alignment and taxonomy information
>gi|307199621|gb|EFN80175.1| Sialin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332023424|gb|EGI63667.1| Sodium-dependent phosphate transport protein 1, chloroplastic [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
UNIPROTKB|Q9NRA2495 SLC17A5 "Sialin" [Homo sapiens 0.798 0.288 0.410 1.5e-23
RGD|1311388495 Slc17a5 "solute carrier family 0.804 0.290 0.406 2e-23
UNIPROTKB|E1B7R3495 SLC17A5 "Uncharacterized prote 0.804 0.290 0.406 5.4e-23
MGI|MGI:1924105495 Slc17a5 "solute carrier family 0.804 0.290 0.4 1.5e-22
UNIPROTKB|F1RQG9497 SLC17A5 "Uncharacterized prote 0.804 0.289 0.406 1.5e-22
TAIR|locus:2126066541 ANTR2 "AT4G00370" [Arabidopsis 0.804 0.266 0.364 2e-22
UNIPROTKB|E2R8R4495 SLC17A5 "Uncharacterized prote 0.804 0.290 0.4 2.5e-22
TAIR|locus:2060694512 PHT4;1 "AT2G29650" [Arabidopsi 0.804 0.281 0.351 3.5e-21
UNIPROTKB|Q5ZL94484 SLC17A5 "Uncharacterized prote 0.804 0.297 0.36 2.2e-20
ZFIN|ZDB-GENE-060929-1158489 slc17a5 "solute carrier family 0.804 0.294 0.346 3.7e-19
UNIPROTKB|Q9NRA2 SLC17A5 "Sialin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 1.5e-23, P = 1.5e-23
 Identities = 62/151 (41%), Positives = 91/151 (60%)

Query:    35 WISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSF-TAMPYVLNSLF 93
             W+  +    LW++ +AHF+ NW+ Y ++  LPTYM   L  N     F +++PY L S  
Sbjct:   282 WVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPY-LGSWL 340

Query:    94 C-IVAGHFADNL-VSHSWTVLTVRRLMTSIGLIGPAVFLIF--FCAVD-NLLFAVI-ISM 147
             C I++G  ADNL    +++ L VRR+ + IG+IGPAVFL+   F   D +L  A + IS 
Sbjct:   341 CMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTIST 400

Query:   148 GLSAFNSAGFLASHADIAPNHAGVTFAISNT 178
              L  F S+GF  +H DIAP++AG+   I+NT
Sbjct:   401 TLGGFCSSGFSINHLDIAPSYAGILLGITNT 431




GO:0006865 "amino acid transport" evidence=IEA
GO:0030054 "cell junction" evidence=IEA
GO:0030672 "synaptic vesicle membrane" evidence=IEA
GO:0016020 "membrane" evidence=TAS
GO:0005351 "sugar:hydrogen symporter activity" evidence=TAS
GO:0005765 "lysosomal membrane" evidence=IDA;TAS
GO:0015136 "sialic acid transmembrane transporter activity" evidence=IDA
GO:0015739 "sialic acid transport" evidence=IDA
GO:0005887 "integral to plasma membrane" evidence=TAS
GO:0006820 "anion transport" evidence=TAS
GO:0006811 "ion transport" evidence=TAS
GO:0055085 "transmembrane transport" evidence=TAS
RGD|1311388 Slc17a5 "solute carrier family 17 (anion/sugar transporter), member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7R3 SLC17A5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1924105 Slc17a5 "solute carrier family 17 (anion/sugar transporter), member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQG9 SLC17A5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2126066 ANTR2 "AT4G00370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8R4 SLC17A5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2060694 PHT4;1 "AT2G29650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL94 SLC17A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1158 slc17a5 "solute carrier family 17 (anion/sugar transporter), member 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
TIGR00894465 TIGR00894, 2A0114euk, Na(+)-dependent inorganic ph 1e-14
TIGR00893399 TIGR00893, 2A0114, D-galactonate transporter 1e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 0.004
>gnl|CDD|129972 TIGR00894, 2A0114euk, Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
 Score = 70.5 bits (173), Expect = 1e-14
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 6/149 (4%)

Query: 35  WISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLSF-TAMPYVLNSLF 93
             +      +W+++ A F   W   I+  +LPT++S  L  +       +++PY+   L 
Sbjct: 254 IKAIPKSLPVWAIWFAIFGHFWLYTILPTYLPTFISWVLRVSGKENGLLSSLPYLFAWLC 313

Query: 94  CIVAGHFADNLVSHSWTVLT-VRRLMTSIGLIGPAVFLIFF----CAVDNLLFAVIISMG 148
            I AG+ AD L S     LT  R++   IG +GP +F         A    +  + ++  
Sbjct: 314 SIFAGYLADFLKSSKTLSLTAARKIFNGIGGLGPGIFAYALPYLSAAFYLTIIILTLANA 373

Query: 149 LSAFNSAGFLASHADIAPNHAGVTFAISN 177
           +S+   AG L +  D+AP   G    I+ 
Sbjct: 374 VSSGPLAGVLINSLDLAPRFLGFIKGITG 402


[Transport and binding proteins, Anions]. Length = 465

>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 179
KOG2532|consensus466 99.88
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.73
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.72
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.62
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.54
TIGR00893399 2A0114 d-galactonate transporter. 99.52
PLN00028476 nitrate transmembrane transporter; Provisional 99.5
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.5
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.5
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.47
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.45
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.42
PRK11663434 regulatory protein UhpC; Provisional 99.42
TIGR00897402 2A0118 polyol permease family. This family of prot 99.42
PRK10133438 L-fucose transporter; Provisional 99.37
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.34
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.34
TIGR00900365 2A0121 H+ Antiporter protein. 99.33
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.32
TIGR00901356 2A0125 AmpG-related permease. 99.29
KOG2533|consensus495 99.29
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.29
KOG4686|consensus459 99.28
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.28
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.27
PRK03545390 putative arabinose transporter; Provisional 99.27
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.27
PRK10054 395 putative transporter; Provisional 99.26
PRK09952438 shikimate transporter; Provisional 99.26
TIGR00896355 CynX cyanate transporter. This family of proteins 99.25
PRK10642 490 proline/glycine betaine transporter; Provisional 99.25
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.24
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.23
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.23
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.23
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.22
PRK03699394 putative transporter; Provisional 99.2
PRK15075434 citrate-proton symporter; Provisional 99.2
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.19
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.19
PRK09705393 cynX putative cyanate transporter; Provisional 99.18
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.18
TIGR00895398 2A0115 benzoate transport. 99.18
PRK11010 491 ampG muropeptide transporter; Validated 99.17
PRK15011393 sugar efflux transporter B; Provisional 99.16
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.15
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.14
PRK10489417 enterobactin exporter EntS; Provisional 99.14
PRK11043401 putative transporter; Provisional 99.13
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.13
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.13
TIGR00891405 2A0112 putative sialic acid transporter. 99.12
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.1
PRK12307426 putative sialic acid transporter; Provisional 99.09
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.09
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.08
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.07
PLN00028 476 nitrate transmembrane transporter; Provisional 99.06
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.06
PRK10504471 putative transporter; Provisional 99.04
PRK11652394 emrD multidrug resistance protein D; Provisional 99.03
PRK11663 434 regulatory protein UhpC; Provisional 99.03
PRK10504 471 putative transporter; Provisional 99.02
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.01
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.01
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.0
PRK03633 381 putative MFS family transporter protein; Provision 99.0
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.99
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.99
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.98
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 98.97
PRK09528 420 lacY galactoside permease; Reviewed 98.97
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.96
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.96
TIGR00891 405 2A0112 putative sialic acid transporter. 98.95
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.95
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.95
PRK09874 408 drug efflux system protein MdtG; Provisional 98.95
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.94
PRK12382 392 putative transporter; Provisional 98.94
PRK03699 394 putative transporter; Provisional 98.94
PRK09528420 lacY galactoside permease; Reviewed 98.93
PRK09848448 glucuronide transporter; Provisional 98.93
PRK03633381 putative MFS family transporter protein; Provision 98.93
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.92
PF13347428 MFS_2: MFS/sugar transport protein 98.91
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.9
TIGR00805 633 oat sodium-independent organic anion transporter. 98.9
PRK11195393 lysophospholipid transporter LplT; Provisional 98.9
PRK12307 426 putative sialic acid transporter; Provisional 98.89
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.88
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.88
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.87
PRK05122 399 major facilitator superfamily transporter; Provisi 98.87
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.86
PRK11902402 ampG muropeptide transporter; Reviewed 98.86
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.85
PRK10091382 MFS transport protein AraJ; Provisional 98.85
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.85
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 98.85
TIGR00900 365 2A0121 H+ Antiporter protein. 98.85
PRK11646400 multidrug resistance protein MdtH; Provisional 98.84
PRK10489 417 enterobactin exporter EntS; Provisional 98.84
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.84
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.84
TIGR00895 398 2A0115 benzoate transport. 98.84
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 98.84
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 98.83
PRK03545 390 putative arabinose transporter; Provisional 98.83
PRK10091 382 MFS transport protein AraJ; Provisional 98.83
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.83
PRK03893496 putative sialic acid transporter; Provisional 98.82
PRK03893 496 putative sialic acid transporter; Provisional 98.81
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.81
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.81
TIGR00897 402 2A0118 polyol permease family. This family of prot 98.79
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.78
PRK05122399 major facilitator superfamily transporter; Provisi 98.78
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 98.77
PRK11043 401 putative transporter; Provisional 98.77
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.77
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.76
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.76
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 98.74
KOG2504|consensus509 98.74
PRK11195 393 lysophospholipid transporter LplT; Provisional 98.72
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 98.72
PRK09705 393 cynX putative cyanate transporter; Provisional 98.71
TIGR00893 399 2A0114 d-galactonate transporter. 98.7
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.7
PRK10133 438 L-fucose transporter; Provisional 98.67
PF1283277 MFS_1_like: MFS_1 like family 98.67
KOG1330|consensus 493 98.66
PRK11652 394 emrD multidrug resistance protein D; Provisional 98.66
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.66
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 98.66
PTZ00207 591 hypothetical protein; Provisional 98.65
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 98.63
TIGR00892 455 2A0113 monocarboxylate transporter 1. 98.63
TIGR00898505 2A0119 cation transport protein. 98.62
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 98.61
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.61
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 98.61
PRK12382392 putative transporter; Provisional 98.59
PRK15011 393 sugar efflux transporter B; Provisional 98.58
PRK10077479 xylE D-xylose transporter XylE; Provisional 98.55
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.55
PRK09669444 putative symporter YagG; Provisional 98.53
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.53
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.53
PRK09874408 drug efflux system protein MdtG; Provisional 98.53
PRK11902 402 ampG muropeptide transporter; Reviewed 98.53
PRK10429 473 melibiose:sodium symporter; Provisional 98.52
PRK14995 495 methyl viologen resistance protein SmvA; Provision 98.52
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.51
PRK09669 444 putative symporter YagG; Provisional 98.51
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.5
KOG0569|consensus485 98.49
PRK10429 473 melibiose:sodium symporter; Provisional 98.48
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.48
COG2270438 Permeases of the major facilitator superfamily [Ge 98.48
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.48
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.46
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.45
COG2211467 MelB Na+/melibiose symporter and related transport 98.45
PRK09848 448 glucuronide transporter; Provisional 98.43
PRK11462 460 putative transporter; Provisional 98.43
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.41
PRK11010 491 ampG muropeptide transporter; Validated 98.41
KOG3626|consensus 735 98.41
TIGR00896 355 CynX cyanate transporter. This family of proteins 98.4
PRK10642 490 proline/glycine betaine transporter; Provisional 98.4
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.39
PRK09952 438 shikimate transporter; Provisional 98.39
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.38
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.38
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.38
KOG2615|consensus 451 98.37
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.37
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 98.36
KOG0253|consensus528 98.35
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.34
PRK11462460 putative transporter; Provisional 98.34
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.32
PRK15075 434 citrate-proton symporter; Provisional 98.31
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.3
KOG2504|consensus 509 98.29
PRK10054395 putative transporter; Provisional 98.29
KOG1330|consensus493 98.27
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.24
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 98.23
TIGR00898 505 2A0119 cation transport protein. 98.23
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.18
COG2211 467 MelB Na+/melibiose symporter and related transport 98.13
PTZ00207591 hypothetical protein; Provisional 98.07
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.06
TIGR00901 356 2A0125 AmpG-related permease. 98.04
KOG2563|consensus480 98.02
KOG0254|consensus 513 98.01
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.0
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.98
KOG3764|consensus464 97.97
TIGR00805 633 oat sodium-independent organic anion transporter. 97.89
PF06813 250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 97.82
PF13347 428 MFS_2: MFS/sugar transport protein 97.8
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.74
KOG0569|consensus 485 97.71
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.67
KOG0255|consensus 521 97.67
PRK10207489 dipeptide/tripeptide permease B; Provisional 97.61
KOG3764|consensus 464 97.61
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.58
TIGR00788 468 fbt folate/biopterin transporter. The only functio 97.57
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 97.57
KOG2615|consensus451 97.44
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.42
KOG0254|consensus513 97.37
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 97.32
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.3
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 97.2
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.1
TIGR00788468 fbt folate/biopterin transporter. The only functio 96.95
KOG0252|consensus 538 96.91
KOG3762|consensus 618 96.91
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 96.9
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 96.76
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 96.75
KOG0252|consensus538 96.51
KOG3762|consensus 618 96.49
COG2270 438 Permeases of the major facilitator superfamily [Ge 96.35
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 96.27
KOG2533|consensus 495 96.22
KOG2532|consensus 466 96.12
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 96.01
PRK09584500 tppB putative tripeptide transporter permease; Rev 95.96
KOG2816|consensus463 95.59
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 95.53
KOG0255|consensus521 95.52
KOG2816|consensus 463 95.42
KOG0637|consensus 498 95.39
KOG2325|consensus 488 95.28
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 94.9
KOG2563|consensus 480 94.67
KOG0253|consensus 528 94.51
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 94.08
KOG3810|consensus433 93.49
COG0477 338 ProP Permeases of the major facilitator superfamil 93.15
KOG3098|consensus461 92.58
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 91.43
PF02990 521 EMP70: Endomembrane protein 70; InterPro: IPR00424 91.21
COG2962293 RarD Predicted permeases [General function predict 90.86
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 89.99
PRK15462493 dipeptide/tripeptide permease D; Provisional 89.79
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 89.3
KOG1237|consensus 571 85.32
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 84.6
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 84.12
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 82.21
KOG1479|consensus 406 80.88
>KOG2532|consensus Back     alignment and domain information
Probab=99.88  E-value=1.5e-21  Score=149.37  Aligned_cols=174  Identities=32%  Similarity=0.599  Sum_probs=144.6

Q ss_pred             CCCCCCCC----CCCCCCCCCCCCCCCcccccCCCCCcHHHHhhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCC
Q psy10147          1 MSSPDVEP----VSRRPTVPPPQPPPSAKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGAN   76 (179)
Q Consensus         1 ~~~p~~~~----~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~~~~g~~   76 (179)
                      .|+|++++    +|++.+.+...+++.++    ..+.||+++++++.+|..++..++.+++.+.+.+|+|+|+.+++|+|
T Consensus       217 ~d~P~~h~~is~~El~~I~~~k~~~~~~~----~~~vP~~~i~ts~~vwai~~~~f~~~~~~~~l~~y~PtY~~~VL~f~  292 (466)
T KOG2532|consen  217 SDSPSKHPNISEKELKYIEKGKSEAHVKK----KPPVPYKAILTSPPVWAIWISAFGGNWGFYLLLTYLPTYLKEVLGFD  292 (466)
T ss_pred             cCCcccCCCCCHHHHHHHHhcccccccCC----CCCCCHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhCCC
Confidence            37777765    56666655544332221    15789999999999999999999999999999999999999999999


Q ss_pred             cccch-hhhhhHHHHHHHHHHHHHHHHHHHhcCCchhhhHHHHHHHHhHHhHHHHHHHhhcch--HHHHHH---HHHHHH
Q psy10147         77 SHSLS-FTAMPYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSIGLIGPAVFLIFFCAVDN--LLFAVI---ISMGLS  150 (179)
Q Consensus        77 ~~~~g-l~~~~~~~~~ig~~~~g~l~dr~~~r~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~---~~~~~~  150 (179)
                      ..+.| +.++|++...+..+++|.++||+.+|..+....||.+..++..+.++.++.+.+.++  .+..++   ++.++.
T Consensus       293 v~~~G~~salP~l~~~~~k~~~g~lsD~l~~~~ls~t~~rkifn~i~~~~~ai~l~~l~~~~~~~~~~a~~~l~~~~~~~  372 (466)
T KOG2532|consen  293 VRETGFLSALPFLAMAIVKFVAGQLSDRLTFRILSETTVRKIFNTIAFGGPAVFLLVLAFTSDEHRLLAVILLTIAIGLS  372 (466)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhccCchHhHHHHHHhHHHHHHHHHHHeeeecCCCcchHHHHHHHHHHHHc
Confidence            99999 699999999999999999999998876677778999999999999888888777652  323333   667788


Q ss_pred             HhhhhchhhhhhhccchhHHHHHHHhhc
Q psy10147        151 AFNSAGFLASHADIAPNHAGVTFAISNT  178 (179)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~g~~~gi~~~  178 (179)
                      +...++......|..|++.+...|+.|+
T Consensus       373 g~~~~Gf~~~~~~~apq~a~~l~g~~~~  400 (466)
T KOG2532|consen  373 GFNISGFYKNHQDIAPQHAGFVMGIINF  400 (466)
T ss_pred             ccchhhhHhhhhhccchHHHHHHHHHHH
Confidence            8888889999999999999999998875



>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>PF02990 EMP70: Endomembrane protein 70; InterPro: IPR004240 The transmembrane 9 superfamily protein (TM9SF) may function as a channel or small molecule transporter Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 5e-11
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 59.3 bits (144), Expect = 5e-11
 Identities = 26/181 (14%), Positives = 52/181 (28%), Gaps = 9/181 (4%)

Query: 3   SPDVEPVSRRPTVPPPQPPPSAKMVTITNGPRWISFISHWSLWSVYIAHFAMNWSTYIIM 62
           S  + P+       P      A+             + +  LW + IA+  +    Y I+
Sbjct: 213 SCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGIL 272

Query: 63  QWLPTYMSSYLGANSHSLSFTAM-PYVLNSLFCIVAGHFADNLVSHSWTVLTVRRLMTSI 121
            W PTY+           S+             ++ G  +D +   +     V      +
Sbjct: 273 DWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVF----FM 328

Query: 122 GLIGPAVFLIFFCAVDNLLFAVIISMGLSAFN---SAGFLASHADIAPNHA-GVTFAISN 177
            L+  A  + +     N    +I  + +                ++AP  A G     + 
Sbjct: 329 TLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTG 388

Query: 178 T 178
            
Sbjct: 389 L 389


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.51
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.49
2cfq_A417 Lactose permease; transport, transport mechanism, 99.31
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.29
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.16
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.11
2xut_A 524 Proton/peptide symporter family protein; transport 99.1
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.1
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.77
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.76
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.73
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.57
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 98.5
2xut_A524 Proton/peptide symporter family protein; transport 95.92
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
Probab=99.51  E-value=5.8e-13  Score=100.52  Aligned_cols=136  Identities=5%  Similarity=-0.027  Sum_probs=98.6

Q ss_pred             CcHHHHhhcHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHhCCCcccch-hhhhhHHHHHHHHHHHHHHHHHHHhcCCc
Q psy10147         33 PRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTY-MSSYLGANSHSLS-FTAMPYVLNSLFCIVAGHFADNLVSHSWT  110 (179)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~-l~~~~g~~~~~~g-l~~~~~~~~~ig~~~~g~l~dr~~~r~~~  110 (179)
                      .++++++++|.++...+..++.....+.+..|+|.| +++.+|+++.+++ +.....++..++.+++|+++||+++|   
T Consensus       249 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~~r~~~~---  325 (438)
T 3o7q_A          249 ASLSRLARIRHWRWAVLAQFCYVGAQTACWSYLIRYAVEEIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISRFAPH---  325 (438)
T ss_dssp             HHHHHHTTCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHH---
T ss_pred             hhHHHHHhChHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHhcch---
Confidence            467789999999999999999888899999999999 8888899999999 57777888999999999999998653   


Q ss_pred             hhhhHHHHHHHHhHHhHHHHHHHhhcchHHHHHH--HHHHHHHhhhhchhhhhhhccchhHHHHHHHhh
Q psy10147        111 VLTVRRLMTSIGLIGPAVFLIFFCAVDNLLFAVI--ISMGLSAFNSAGFLASHADIAPNHAGVTFAISN  177 (179)
Q Consensus       111 ~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~g~~~gi~~  177 (179)
                            .....+.+...+..+.....++.+..+.  +.....+...+..++...|..|++++.+.++.+
T Consensus       326 ------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  388 (438)
T 3o7q_A          326 ------KVLAAYALIAMALCLISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNLGQDTKYGSSFIV  388 (438)
T ss_dssp             ------HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHTTHHHHHHHHHHSSCGGGHHHHHHHHH
T ss_pred             ------HHHHHHHHHHHHHHHHHHHcCCcHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccchhhHHH
Confidence                  2333444444444444444544433323  222233344566778878888877777666543



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.49
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.15
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.07
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.65
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.49  E-value=1.8e-13  Score=101.44  Aligned_cols=140  Identities=16%  Similarity=0.157  Sum_probs=96.5

Q ss_pred             CcHHHHhhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccch-hhhhhHHHHHHHHHHHHHHHHHHHhcCCch
Q psy10147         33 PRWISFISHWSLWSVYIAHFAMNWSTYIIMQWLPTYMSSYLGANSHSLS-FTAMPYVLNSLFCIVAGHFADNLVSHSWTV  111 (179)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~~~~g~~~~~~g-l~~~~~~~~~ig~~~~g~l~dr~~~r~~~~  111 (179)
                      ..++++++++.++......++.....+++..|.|.|+++.++++..+++ ...+..+...++.+++|+++||++++.   
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~---  316 (447)
T d1pw4a_         240 IFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGN---  316 (447)
T ss_dssp             HHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTC---
T ss_pred             HHHHHHHcCchHHHHHHHhhhhhhhhhcchhhhhhhcccccccccchhhhhhhcchhhhhhhhhhhhhhhhhccccc---
Confidence            3456778899999999999999999999999999999999999999988 477788889999999999999987652   


Q ss_pred             hhhHHHHHHHHhHHhHHHHHHHhh--cchHHHHHH--HHHHH-HHhhhhchhhhhhhccchh-HHHHHHHhhc
Q psy10147        112 LTVRRLMTSIGLIGPAVFLIFFCA--VDNLLFAVI--ISMGL-SAFNSAGFLASHADIAPNH-AGVTFAISNT  178 (179)
Q Consensus       112 ~~~r~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~--~~~~~-~~~~~~~~~~~~~~~~~~~-~g~~~gi~~~  178 (179)
                         +.................+..  ..+.+...+  +..++ .+......+....|..|++ +|++.|+.++
T Consensus       317 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~~  386 (447)
T d1pw4a_         317 ---RGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGL  386 (447)
T ss_dssp             ---HHHHHHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHH
T ss_pred             ---cccccchhHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHH
Confidence               222222222222222222222  223333333  22222 2233455677888888866 9999988764



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure