Psyllid ID: psy10250

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
GFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTGKEKTNATIPADLTRQFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEAL
ccccccccHHHHHHHHHHHHHcccccccEEEEHHHHHcccHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHcccccccEEEEHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHcccccccccccEEEccHHHHHHHHHHHHc
ccccccccHHHHHHHHHHHHHccccEEEEEEEHHHHHcccHHHHHHHHHHHHHHHccHHHEEEEccHHHHccHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHccccccccEEEEEEcHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEHHHHHcccHHHHHHHHHHHHHHHcccccEEEEccHHHHccHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEcEcccccHHHHHHHHHHHHHHHcccccccccEcEEEcccHHHHHHHcHcc
GFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMfagsdfiktstgkektnatipadltrqFEAVDLSRLKNKKSLLLKIIEFIdlttlsgddtEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLdrenarddvKVASvaagfpsgqYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEkcgekihmKTILAVGELKTSENIYCASMTAmfagsdfiktstgkektnatipaGIIMCSAIKHFHKLsgkkiglkpaggistfeDSVRWIYLVLIMLgpdwlnkdLFRIGASSLLNNILQELEAL
GFPSGQYLLETRLHEIELLakqkvdevDIVIQRSlvlnnqwpeLFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTgkektnatipadltrqfeavdlsrlknkkslLLKIIEfidlttlsgdDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHtaavcvypaRVVDVIKVLDrenarddvkvasvaagfpsgqYLLETRLHEIELLAKQKVDEVDIVIQRSlvlnnqwpeLFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEAL
GFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTGKEKTNATIPADLTRQFEAVDlsrlknkkslllkIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEAL
******YLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTS*******ATIPADLTRQFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNIL******
GFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTGKEKTNATIPADLTRQFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEA*
GFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTGKEKTNATIPADLTRQFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEAL
****GQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTGKEKTNATIPADLTRQFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCEEKIHMKTILAVGELKTSENIYYASMTAMFAGSDFIKTSTGKEKTNATIPADLTRQFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELEAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query387 2.2.26 [Sep-21-2011]
Q9Y315318 Putative deoxyribose-phos yes N/A 0.715 0.871 0.514 7e-73
Q91YP3318 Putative deoxyribose-phos yes N/A 0.777 0.946 0.473 4e-70
Q3T0V9318 Putative deoxyribose-phos yes N/A 0.715 0.871 0.485 5e-69
Q19264303 Putative deoxyribose-phos yes N/A 0.651 0.831 0.475 3e-64
Q6LUH4257 Deoxyribose-phosphate ald yes N/A 0.635 0.957 0.373 2e-33
Q086G0257 Deoxyribose-phosphate ald yes N/A 0.607 0.914 0.364 1e-32
B2VH50259 Deoxyribose-phosphate ald yes N/A 0.620 0.926 0.371 4e-32
A8H728257 Deoxyribose-phosphate ald yes N/A 0.604 0.910 0.375 1e-31
B0TQ91257 Deoxyribose-phosphate ald yes N/A 0.607 0.914 0.360 3e-31
B4EWA4259 Deoxyribose-phosphate ald yes N/A 0.604 0.903 0.357 4e-31
>sp|Q9Y315|DEOC_HUMAN Putative deoxyribose-phosphate aldolase OS=Homo sapiens GN=DERA PE=1 SV=2 Back     alignment and function desciption
 Score =  274 bits (701), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 190/282 (67%), Gaps = 5/282 (1%)

Query: 105 PADLTR--QFEAVDLSRLKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEE 162
           PA L R  Q +A    + + + + LLK + FIDLTTLSGDDT + ++ L  KA  P+ E+
Sbjct: 23  PAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIRED 82

Query: 163 LKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRL 222
           L + +      + TAAVCVYPARV D +K L  + A  ++ VASVAAGFP+GQ  L+TRL
Sbjct: 83  LLKALNMHDKGITTAAVCVYPARVCDAVKAL--KAAGCNIPVASVAAGFPAGQTHLKTRL 140

Query: 223 HEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTS 282
            EI L  +    E+D+VI RSLVL  QW  L+ E++Q ++ CGE  H+KTILA GEL T 
Sbjct: 141 EEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGEA-HLKTILATGELGTL 199

Query: 283 ENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGI 342
            N+Y ASM AM AGSDFIKTSTGKE  NAT P  I+M  AI+ F   +G KIG KPAGGI
Sbjct: 200 TNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGI 259

Query: 343 STFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQEL 384
            + +DS+ W+ LV   LG +WL  +LFRIGAS+LL++I +++
Sbjct: 260 RSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQI 301
Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.
Homo sapiens (taxid: 9606)
EC: 4EC: .EC: 1EC: .EC: 2EC: .EC: 4
>sp|Q91YP3|DEOC_MOUSE Putative deoxyribose-phosphate aldolase OS=Mus musculus GN=Dera PE=2 SV=1 Back     alignment and function description
>sp|Q3T0V9|DEOC_BOVIN Putative deoxyribose-phosphate aldolase OS=Bos taurus GN=DERA PE=2 SV=1 Back     alignment and function description
>sp|Q19264|DEOC_CAEEL Putative deoxyribose-phosphate aldolase OS=Caenorhabditis elegans GN=F09E5.3 PE=3 SV=1 Back     alignment and function description
>sp|Q6LUH4|DEOC_PHOPR Deoxyribose-phosphate aldolase OS=Photobacterium profundum GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|Q086G0|DEOC_SHEFN Deoxyribose-phosphate aldolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|B2VH50|DEOC_ERWT9 Deoxyribose-phosphate aldolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|A8H728|DEOC_SHEPA Deoxyribose-phosphate aldolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|B0TQ91|DEOC_SHEHH Deoxyribose-phosphate aldolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|B4EWA4|DEOC_PROMH Deoxyribose-phosphate aldolase OS=Proteus mirabilis (strain HI4320) GN=deoC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
170047509312 deoxyribose-phosphate aldolase [Culex qu 0.666 0.826 0.519 8e-74
158299914310 AGAP009161-PA [Anopheles gambiae str. PE 0.666 0.832 0.511 1e-73
157135334321 deoxyribose-phosphate aldolase [Aedes ae 0.640 0.772 0.523 4e-72
395538541321 PREDICTED: putative deoxyribose-phosphat 0.713 0.859 0.522 2e-71
395850577362 PREDICTED: putative deoxyribose-phosphat 0.715 0.765 0.510 3e-71
33989376336 DERA protein, partial [Homo sapiens] 0.806 0.928 0.476 3e-71
307213992309 Putative deoxyribose-phosphate aldolase 0.671 0.841 0.528 4e-71
340720128293 PREDICTED: putative deoxyribose-phosphat 0.677 0.894 0.5 4e-71
116063554318 putative deoxyribose-phosphate aldolase 0.715 0.871 0.514 4e-71
4680691336 CGI-26 protein [Homo sapiens] 0.715 0.824 0.514 5e-71
>gi|170047509|ref|XP_001851261.1| deoxyribose-phosphate aldolase [Culex quinquefasciatus] gi|167869934|gb|EDS33317.1| deoxyribose-phosphate aldolase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  283 bits (725), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 178/260 (68%), Gaps = 2/260 (0%)

Query: 128 LKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVV 187
           LK +   DLTTLSGDDT A VE L  +A  P  E L +        VHTAAVCVYP+RV 
Sbjct: 49  LKALSLTDLTTLSGDDTRANVERLCFRAAYPFPERLADP--KDYGKVHTAAVCVYPSRVG 106

Query: 188 DVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLN 247
           D  + L      D +++A+VA GFPSGQY L +RL EI    +Q   E+DIV+ RSLVLN
Sbjct: 107 DAYRALGALKRLDQIQIAAVATGFPSGQYPLHSRLAEITYAIEQGATEIDIVVDRSLVLN 166

Query: 248 NQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKE 307
            +W +L+ E+ +M+E CG+K H+KTIL +GE  T  N+Y ASM AM AGSDFIKTSTGKE
Sbjct: 167 GKWNQLYEEIVKMREACGDKAHLKTILGIGECGTMVNVYKASMVAMMAGSDFIKTSTGKE 226

Query: 308 KTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKD 367
             NAT+P G++M  AI+ F++L+GKKIGLKPAGG+ T +D+V W+ ++   LG  WL  +
Sbjct: 227 AVNATLPVGLVMIRAIQEFYRLTGKKIGLKPAGGVRTVKDAVAWMIMIKETLGEQWLTPE 286

Query: 368 LFRIGASSLLNNILQELEAL 387
           LFR GAS LL+++ ++  +L
Sbjct: 287 LFRFGASGLLDDVEKQYYSL 306

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158299914|ref|XP_319922.4| AGAP009161-PA [Anopheles gambiae str. PEST] gi|157013747|gb|EAA14693.4| AGAP009161-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157135334|ref|XP_001656607.1| deoxyribose-phosphate aldolase [Aedes aegypti] gi|108881236|gb|EAT45461.1| AAEL003246-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|395538541|ref|XP_003771237.1| PREDICTED: putative deoxyribose-phosphate aldolase [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|395850577|ref|XP_003797859.1| PREDICTED: putative deoxyribose-phosphate aldolase [Otolemur garnettii] Back     alignment and taxonomy information
>gi|33989376|gb|AAH56234.1| DERA protein, partial [Homo sapiens] Back     alignment and taxonomy information
>gi|307213992|gb|EFN89199.1| Putative deoxyribose-phosphate aldolase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340720128|ref|XP_003398495.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|116063554|ref|NP_057038.2| putative deoxyribose-phosphate aldolase [Homo sapiens] gi|24636817|sp|Q9Y315.2|DEOC_HUMAN RecName: Full=Putative deoxyribose-phosphate aldolase; Short=DERA; AltName: Full=2-deoxy-D-ribose 5-phosphate aldolase; AltName: Full=Phosphodeoxyriboaldolase; Short=Deoxyriboaldolase gi|119616764|gb|EAW96358.1| 2-deoxyribose-5-phosphate aldolase homolog (C. elegans), isoform CRA_b [Homo sapiens] gi|157170050|gb|AAI52914.1| 2-deoxyribose-5-phosphate aldolase homolog (C. elegans) [synthetic construct] Back     alignment and taxonomy information
>gi|4680691|gb|AAD27735.1|AF132960_1 CGI-26 protein [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
UNIPROTKB|Q9Y315318 DERA "Putative deoxyribose-pho 0.648 0.789 0.535 8.5e-65
UNIPROTKB|F1NT21318 DERA "Uncharacterized protein" 0.638 0.776 0.547 3.7e-64
UNIPROTKB|F1PPB6318 DERA "Uncharacterized protein" 0.648 0.789 0.523 1.2e-63
ZFIN|ZDB-GENE-041010-200318 dera "2-deoxyribose-5-phosphat 0.638 0.776 0.523 1.6e-63
UNIPROTKB|F1SQY2318 DERA "Uncharacterized protein" 0.648 0.789 0.519 3.3e-63
RGD|1589836308 Dera "deoxyribose-phosphate al 0.648 0.814 0.523 5.4e-63
MGI|MGI:1913762318 Dera "2-deoxyribose-5-phosphat 0.648 0.789 0.527 6.9e-63
UNIPROTKB|Q3T0V9318 DERA "Putative deoxyribose-pho 0.640 0.779 0.509 2.7e-61
FB|FBgn0033735347 CG8525 [Drosophila melanogaste 0.635 0.708 0.483 3.2e-58
WB|WBGene00017283303 F09E5.3 [Caenorhabditis elegan 0.627 0.801 0.478 3.2e-58
UNIPROTKB|Q9Y315 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 660 (237.4 bits), Expect = 8.5e-65, P = 8.5e-65
 Identities = 136/254 (53%), Positives = 176/254 (69%)

Query:   131 IEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVI 190
             + FIDLTTLSGDDT + ++ L  KA  P+ E+L + +      + TAAVCVYPARV D +
Sbjct:    51 VTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAV 110

Query:   191 KVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQW 250
             K L  + A  ++ VASVAAGFP+GQ  L+TRL EI L  +    E+D+VI RSLVL  QW
Sbjct:   111 KAL--KAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQW 168

Query:   251 PELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTN 310
               L+ E++Q ++ CGE  H+KTILA GEL T  N+Y ASM AM AGSDFIKTSTGKE  N
Sbjct:   169 EALYDEIRQFRKACGEA-HLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVN 227

Query:   311 ATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFR 370
             AT P  I+M  AI+ F   +G KIG KPAGGI + +DS+ W+ LV   LG +WL  +LFR
Sbjct:   228 ATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFR 287

Query:   371 IGASSLLNNILQEL 384
             IGAS+LL++I +++
Sbjct:   288 IGASTLLSDIERQI 301
GO:0005737 "cytoplasm" evidence=IEA
GO:0009264 "deoxyribonucleotide catabolic process" evidence=IEA
GO:0046386 "deoxyribose phosphate catabolic process" evidence=IEA
GO:0004139 "deoxyribose-phosphate aldolase activity" evidence=IDA
GO:0046121 "deoxyribonucleoside catabolic process" evidence=IDA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1NT21 DERA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPB6 DERA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-200 dera "2-deoxyribose-5-phosphate aldolase homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQY2 DERA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1589836 Dera "deoxyribose-phosphate aldolase (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1913762 Dera "2-deoxyribose-5-phosphate aldolase homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0V9 DERA "Putative deoxyribose-phosphate aldolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0033735 CG8525 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00017283 F09E5.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8EHK4DEOC_SHEON4, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
B8CKI4DEOC_SHEPW4, ., 1, ., 2, ., 40.36710.60460.9105yesN/A
Q8DBT2DEOC_VIBVU4, ., 1, ., 2, ., 40.34640.60720.9108yesN/A
Q086G0DEOC_SHEFN4, ., 1, ., 2, ., 40.36470.60720.9143yesN/A
B4EWA4DEOC_PROMH4, ., 1, ., 2, ., 40.35790.60460.9034yesN/A
Q8ZIQ4DEOC2_YERPE4, ., 1, ., 2, ., 40.32940.61750.9018yesN/A
B8E6P4DEOC_SHEB24, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
Q19264DEOC_CAEEL4, ., 1, ., 2, ., 40.47540.65110.8316yesN/A
B7VJF8DEOC_VIBSL4, ., 1, ., 2, ., 40.35150.60200.9031yesN/A
C5BHJ2DEOC_EDWI94, ., 1, ., 2, ., 40.35010.61490.9189yesN/A
Q3T0V9DEOC_BOVIN4, ., 1, ., 2, ., 40.48580.71570.8710yesN/A
A1RH87DEOC_SHESW4, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
A3D7J4DEOC_SHEB54, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
B6ENG3DEOC_ALISL4, ., 1, ., 2, ., 40.35290.60460.9069yesN/A
Q7MI38DEOC2_VIBVY4, ., 1, ., 2, ., 40.34640.60720.9108yesN/A
Q9Y315DEOC_HUMAN4, ., 1, ., 2, ., 40.51410.71570.8710yesN/A
A4W698DEOC_ENT384, ., 1, ., 2, ., 40.33720.61750.9227yesN/A
A9KZ80DEOC_SHEB94, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
Q66EW0DEOC2_YERPS4, ., 1, ., 2, ., 40.32940.61750.9018yesN/A
A4Y9A8DEOC_SHEPC4, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
A8H728DEOC_SHEPA4, ., 1, ., 2, ., 40.3750.60460.9105yesN/A
Q7NRS9DEOC_CHRVO4, ., 1, ., 2, ., 40.36710.60720.9215yesN/A
A8FYQ9DEOC_SHESH4, ., 1, ., 2, ., 40.36820.60980.9182yesN/A
B2VH50DEOC_ERWT94, ., 1, ., 2, ., 40.37160.62010.9266yesN/A
B0TQ91DEOC_SHEHH4, ., 1, ., 2, ., 40.36070.60720.9143yesN/A
A7MUW7DEOC_VIBHB4, ., 1, ., 2, ., 40.34250.60720.9108yesN/A
A1S474DEOC_SHEAM4, ., 1, ., 2, ., 40.34580.63560.9571yesN/A
Q87M22DEOC_VIBPA4, ., 1, ., 2, ., 40.33850.60720.9108yesN/A
Q5E7J7DEOC_VIBF14, ., 1, ., 2, ., 40.33850.60720.9108yesN/A
Q6LUH4DEOC_PHOPR4, ., 1, ., 2, ., 40.37350.63560.9571yesN/A
A6WRB8DEOC_SHEB84, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
Q91YP3DEOC_MOUSE4, ., 1, ., 2, ., 40.47360.77770.9465yesN/A
Q0HXQ4DEOC_SHESR4, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
B5FA98DEOC_VIBFM4, ., 1, ., 2, ., 40.33850.60720.9108yesN/A
B1KRP8DEOC_SHEWM4, ., 1, ., 2, ., 40.37980.60980.9182yesN/A
Q0HLF0DEOC_SHESM4, ., 1, ., 2, ., 40.35790.60980.9218yesN/A
A0KU07DEOC_SHESA4, ., 1, ., 2, ., 40.35400.60980.9218yesN/A
A3QGT3DEOC_SHELP4, ., 1, ., 2, ., 40.35010.61240.9221yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.20.691
4th Layer4.1.2.40.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
cd00959203 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase 2e-58
PRK05283257 PRK05283, PRK05283, deoxyribose-phosphate aldolase 3e-53
COG0274228 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nuc 1e-51
cd00945201 cd00945, Aldolase_Class_I, Class I aldolases 2e-40
PRK00507221 PRK00507, PRK00507, deoxyribose-phosphate aldolase 4e-29
TIGR00126211 TIGR00126, deoC, deoxyribose-phosphate aldolase 8e-28
cd00959203 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase 4e-27
COG0274228 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nuc 3e-24
cd00945201 cd00945, Aldolase_Class_I, Class I aldolases 4e-23
pfam01791231 pfam01791, DeoC, DeoC/LacD family aldolase 4e-20
PRK05283257 PRK05283, PRK05283, deoxyribose-phosphate aldolase 2e-15
PRK00507221 PRK00507, PRK00507, deoxyribose-phosphate aldolase 4e-12
TIGR00126211 TIGR00126, deoC, deoxyribose-phosphate aldolase 5e-12
pfam01791231 pfam01791, DeoC, DeoC/LacD family aldolase 5e-09
>gnl|CDD|188646 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information 
 Score =  188 bits (480), Expect = 2e-58
 Identities = 75/245 (30%), Positives = 103/245 (42%), Gaps = 42/245 (17%)

Query: 130 IIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDV 189
           +   ID T L  D TE  +  L  +A +                   AAVCV P  V   
Sbjct: 1   LASLIDHTLLKPDATEEDIRKLCDEAKEY----------------GFAAVCVNPCFVPLA 44

Query: 190 IKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQ 249
            + L        VKV +V  GFP G    E ++ E         DE+D+VI    + +  
Sbjct: 45  REAL----KGSGVKVCTVI-GFPLGATTTEVKVAEAREAIADGADEIDMVINIGALKSGD 99

Query: 250 WPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKT 309
           +  ++ E+  + E CG    +K IL  G L T E I  A   A+ AG+DFIKTSTG    
Sbjct: 100 YEAVYEEIAAVVEACGGA-PLKVILETGLL-TDEEIIKACEIAIEAGADFIKTSTGFGPG 157

Query: 310 NATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLF 369
            AT+    +M  A+         ++G+K AGGI T ED++       I  G         
Sbjct: 158 GATVEDVKLMKEAVG-------GRVGVKAAGGIRTLEDALAM-----IEAG-------AT 198

Query: 370 RIGAS 374
           RIG S
Sbjct: 199 RIGTS 203

2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family. DERA belongs to the class I aldolases and catalyzes a reversible aldol reaction between acetaldehyde and glyceraldehyde 3-phosphate to generate 2-deoxyribose 5-phosphate. DERA is unique in catalyzing the aldol reaction between two aldehydes, and its broad substrate specificity confers considerable utility as a biocatalyst, offering an environmentally benign alternative to chiral transition metal catalysis of the asymmetric aldol reaction. Length = 203
>gnl|CDD|235387 PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|223351 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|188634 cd00945, Aldolase_Class_I, Class I aldolases Back     alignment and domain information
>gnl|CDD|234784 PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|232838 TIGR00126, deoC, deoxyribose-phosphate aldolase Back     alignment and domain information
>gnl|CDD|188646 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>gnl|CDD|223351 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|188634 cd00945, Aldolase_Class_I, Class I aldolases Back     alignment and domain information
>gnl|CDD|216703 pfam01791, DeoC, DeoC/LacD family aldolase Back     alignment and domain information
>gnl|CDD|235387 PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|234784 PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|232838 TIGR00126, deoC, deoxyribose-phosphate aldolase Back     alignment and domain information
>gnl|CDD|216703 pfam01791, DeoC, DeoC/LacD family aldolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 387
PRK05283257 deoxyribose-phosphate aldolase; Provisional 100.0
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 100.0
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 100.0
PRK00507221 deoxyribose-phosphate aldolase; Provisional 100.0
KOG3981|consensus326 100.0
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 100.0
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 100.0
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 100.0
PRK05283257 deoxyribose-phosphate aldolase; Provisional 100.0
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 99.97
PRK00507221 deoxyribose-phosphate aldolase; Provisional 99.96
PRK07226267 fructose-bisphosphate aldolase; Provisional 99.96
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 99.95
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 99.95
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 99.9
KOG3981|consensus326 99.85
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 99.84
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 99.74
PRK07226267 fructose-bisphosphate aldolase; Provisional 99.25
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 99.17
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 98.99
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.47
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.46
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 98.4
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 98.27
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.25
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 98.1
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 97.92
PRK08227264 autoinducer 2 aldolase; Validated 97.91
PRK09250348 fructose-bisphosphate aldolase; Provisional 97.83
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.81
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 97.79
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 97.73
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.71
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 97.65
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 97.63
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.62
PRK06852304 aldolase; Validated 97.62
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 97.52
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.52
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.45
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.45
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 97.43
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.41
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 97.41
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 97.41
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 97.29
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 97.25
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 97.24
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 97.23
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 97.17
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 97.17
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 97.13
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 97.05
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 97.03
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 96.98
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 96.96
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.92
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.89
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 96.88
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 96.8
PRK04302223 triosephosphate isomerase; Provisional 96.75
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 96.75
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 96.65
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 96.62
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 96.57
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 96.54
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.53
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 96.53
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 96.53
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 96.5
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 96.49
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 96.47
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 96.47
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 96.46
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 96.46
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 96.37
PLN02274 505 inosine-5'-monophosphate dehydrogenase 96.35
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 96.31
PLN02746347 hydroxymethylglutaryl-CoA lyase 96.3
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 96.28
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 96.27
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 96.27
PRK08227264 autoinducer 2 aldolase; Validated 96.26
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 96.25
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 96.16
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 96.14
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 96.13
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 96.1
PRK12330 499 oxaloacetate decarboxylase; Provisional 96.09
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 96.08
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 96.02
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 96.01
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 95.99
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 95.98
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 95.98
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 95.96
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 95.94
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 95.93
PF01645368 Glu_synthase: Conserved region in glutamate syntha 95.93
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 95.91
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.88
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 95.82
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 95.82
COG1891235 Uncharacterized protein conserved in archaea [Func 95.76
PLN02826409 dihydroorotate dehydrogenase 95.76
PRK13523337 NADPH dehydrogenase NamA; Provisional 95.72
PRK14041 467 oxaloacetate decarboxylase; Provisional 95.7
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 95.62
PF00682237 HMGL-like: HMGL-like of this family is not conserv 95.59
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 95.55
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 95.53
PRK11197381 lldD L-lactate dehydrogenase; Provisional 95.53
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 95.52
PRK09250348 fructose-bisphosphate aldolase; Provisional 95.5
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 95.48
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 95.46
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 95.37
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 95.37
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 95.33
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 95.26
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 95.23
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 95.2
PLN02746347 hydroxymethylglutaryl-CoA lyase 95.19
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 95.17
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 95.15
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.14
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 95.12
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 95.1
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 95.1
PLN02535364 glycolate oxidase 95.09
PRK12331 448 oxaloacetate decarboxylase; Provisional 95.08
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 95.08
PF00682237 HMGL-like: HMGL-like of this family is not conserv 95.05
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 94.99
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 94.9
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 94.87
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 94.82
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 94.82
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 94.75
PLN02321 632 2-isopropylmalate synthase 94.69
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 94.69
PRK02227238 hypothetical protein; Provisional 94.68
KOG2335|consensus 358 94.66
PRK12581 468 oxaloacetate decarboxylase; Provisional 94.63
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 94.58
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 94.55
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 94.54
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 94.53
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 94.52
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 94.51
PRK06852304 aldolase; Validated 94.46
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 94.43
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 94.43
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 94.41
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 94.35
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 94.32
cd02812219 PcrB_like PcrB_like proteins. One member of this f 94.3
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 94.29
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 94.24
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 94.18
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 94.12
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 94.1
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 94.1
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 94.06
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 93.97
PLN02979366 glycolate oxidase 93.95
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 93.95
PRK09389 488 (R)-citramalate synthase; Provisional 93.93
PRK09016296 quinolinate phosphoribosyltransferase; Validated 93.89
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 93.86
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 93.83
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 93.81
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 93.81
PRK14040 593 oxaloacetate decarboxylase; Provisional 93.78
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 93.76
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 93.72
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 93.64
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 93.53
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 93.53
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.52
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 93.46
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 93.46
PRK06096284 molybdenum transport protein ModD; Provisional 93.37
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 93.21
PRK12331 448 oxaloacetate decarboxylase; Provisional 93.21
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 93.09
PRK12655220 fructose-6-phosphate aldolase; Reviewed 93.05
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.01
PLN03228503 methylthioalkylmalate synthase; Provisional 92.99
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 92.95
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 92.91
PRK12653220 fructose-6-phosphate aldolase; Reviewed 92.88
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 92.81
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 92.75
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 92.65
TIGR03151 307 enACPred_II putative enoyl-(acyl-carrier-protein) 92.62
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 92.62
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 92.6
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 92.58
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 92.56
PRK00915 513 2-isopropylmalate synthase; Validated 92.53
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 92.53
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 92.48
PRK09282 592 pyruvate carboxylase subunit B; Validated 92.45
PRK14040 593 oxaloacetate decarboxylase; Provisional 92.43
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 92.12
PRK02227238 hypothetical protein; Provisional 92.1
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 92.01
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 91.93
TIGR01334277 modD putative molybdenum utilization protein ModD. 91.92
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 91.8
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 91.62
PRK12581468 oxaloacetate decarboxylase; Provisional 91.57
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 91.45
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 91.38
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 91.36
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.19
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 91.15
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 91.09
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 90.98
COG1891235 Uncharacterized protein conserved in archaea [Func 90.97
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 90.95
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 90.95
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 90.87
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 90.84
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.82
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 90.48
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.3
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 90.17
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 90.09
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 90.07
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 90.04
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 89.91
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 89.9
PRK14042 596 pyruvate carboxylase subunit B; Provisional 89.84
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 89.83
PRK12330 499 oxaloacetate decarboxylase; Provisional 89.7
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 89.64
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 89.47
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 89.45
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 89.29
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesi 89.12
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 89.11
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 89.06
PRK00208250 thiG thiazole synthase; Reviewed 88.74
PRK12999 1146 pyruvate carboxylase; Reviewed 88.47
PRK05437 352 isopentenyl pyrophosphate isomerase; Provisional 88.39
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 88.27
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 88.17
COG0119409 LeuA Isopropylmalate/homocitrate/citramalate synth 88.16
TIGR00970 564 leuA_yeast 2-isopropylmalate synthase, yeast type. 88.1
PRK14042 596 pyruvate carboxylase subunit B; Provisional 87.93
PRK07565 334 dihydroorotate dehydrogenase 2; Reviewed 87.8
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 87.77
PRK01362214 putative translaldolase; Provisional 87.58
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 87.18
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 87.05
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 87.04
PRK09485304 mmuM homocysteine methyltransferase; Provisional 86.93
PRK11572248 copper homeostasis protein CutC; Provisional 86.88
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 86.7
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 86.67
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 86.44
PRK14024241 phosphoribosyl isomerase A; Provisional 86.31
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 86.06
PRK08649 368 inosine 5-monophosphate dehydrogenase; Validated 86.0
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 85.99
PRK01060281 endonuclease IV; Provisional 85.85
PLN02460338 indole-3-glycerol-phosphate synthase 85.72
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 85.54
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 85.54
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 85.47
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 85.38
PRK00915 513 2-isopropylmalate synthase; Validated 85.26
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 85.13
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 85.07
PRK10605362 N-ethylmaleimide reductase; Provisional 84.99
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 84.91
PRK13523337 NADPH dehydrogenase NamA; Provisional 84.68
PRK08645 612 bifunctional homocysteine S-methyltransferase/5,10 83.97
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 83.87
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 83.51
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 83.32
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 83.3
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 83.23
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 83.11
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 82.87
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 82.86
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 82.84
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 82.73
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 82.51
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 82.49
PRK15108 345 biotin synthase; Provisional 82.31
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 82.18
PRK07695201 transcriptional regulator TenI; Provisional 82.1
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synth 82.04
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 81.95
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 81.41
TIGR03586327 PseI pseudaminic acid synthase. 81.4
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 81.28
PLN02591250 tryptophan synthase 80.93
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 80.87
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 80.77
PRK08508279 biotin synthase; Provisional 80.71
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 80.7
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 80.37
TIGR00737 319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 80.23
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 80.06
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.4e-75  Score=559.45  Aligned_cols=241  Identities=38%  Similarity=0.556  Sum_probs=224.1

Q ss_pred             HHHHHhhcccccccCCCCCCHHHHHHHHHHhcCCCcHHHHHHHhhhccC--CCeEEEEECCccHHHHHHHhhhcCCCC-C
Q psy10250        125 SLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQAN--VHTAAVCVYPARVVDVIKVLDRENARD-D  201 (387)
Q Consensus       125 ~~~~~l~~~ID~T~L~~~~T~~~i~~l~~~A~~~~~~~~~~~~~~~~~~--~~~~aVcV~P~~v~~a~~~L~~~~~~~-~  201 (387)
                      .+.++++++||||+|+|++|+++|+++|++|+                +  |+|++|||||+||+++++.|++.  ++ +
T Consensus         5 ~~~~~~~~~ID~TlL~p~~T~~~I~~lc~eA~----------------~~~~~faaVcV~P~~v~~a~~~L~~~--~~~~   66 (257)
T PRK05283          5 AAALRALSLMDLTTLNDDDTDEKVIALCHQAK----------------TPVGNTAAICIYPRFIPIARKTLREQ--GTPE   66 (257)
T ss_pred             HHHHHHHHHhcccCCCCCCCHHHHHHHHHHHH----------------hcCCCeeEEEECHHHHHHHHHHhccc--CCCC
Confidence            35789999999999999999999999999999                5  79999999999999999999742  24 6


Q ss_pred             ceEEEEecCCCCCCCCHHHHHHHHHHHHHCCCCeeeeecCchhhhcCChhHHHHHHHHHHHHhCCCcceEEEEeeccCCC
Q psy10250        202 VKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKT  281 (387)
Q Consensus       202 v~v~tVvigFP~G~~~~e~K~~Ea~~Ai~~GAdEID~Vin~~~lk~g~~~~v~~Ei~~v~~~~~~~~~lKvIlEt~~L~t  281 (387)
                      ++|||| ||||+|++++++|++|+++|+++||||||||+|++++++|+|++|++||++|+++|+++.++||||||++|++
T Consensus        67 vkv~tV-igFP~G~~~t~~K~~Ea~~Ai~~GAdEiD~Vinig~lk~g~~~~v~~ei~~v~~~~~~~~~lKVIlEt~~L~~  145 (257)
T PRK05283         67 IRIATV-TNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFELVKACKEACAANVLLKVIIETGELKD  145 (257)
T ss_pred             CeEEEE-ecCCCCCCcHHHHHHHHHHHHHcCCCEEeeeccHHHHhCCcHHHHHHHHHHHHHHhCCCceEEEEEeccccCC
Confidence            999999 6999999999999999999999999999999999999999999999999999999984489999999999955


Q ss_pred             hHHHHHHHHHHHHcCCCEEEcCCCCCCCCCChhhhHhHHHHHHHHHHHcCCCceEeEeccCCCHHHHHHHHHHHHHhcCC
Q psy10250        282 SENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGP  361 (387)
Q Consensus       282 ~e~i~~a~~ia~~aGaDfVKTSTGf~~~gat~~~~~~m~~~v~~~~~~~~~~~gIKasGGIrt~~~a~~~i~l~~~~~Ga  361 (387)
                      +|+|++||++|+++|||||||||||++.|||++++++|++.++.+  ..++++||||||||||++||+.|+.+.++.+|+
T Consensus       146 ee~i~~a~~~a~~aGADFVKTSTGf~~~gAt~edv~lm~~~i~~~--~~~~~vgIKAsGGIrt~~~A~~~i~ag~~~lg~  223 (257)
T PRK05283        146 EALIRKASEIAIKAGADFIKTSTGKVPVNATLEAARIMLEVIRDM--GVAKTVGFKPAGGVRTAEDAAQYLALADEILGA  223 (257)
T ss_pred             HHHHHHHHHHHHHhCCCEEEcCCCCCCCCCCHHHHHHHHHHHHhc--ccCCCeeEEccCCCCCHHHHHHHHHHHHHHhCh
Confidence            446999999999999999999999999999999888888777654  246889999999999999999999999999999


Q ss_pred             CccCCCcceeeccchHHHHHHHHhh
Q psy10250        362 DWLNKDLFRIGASSLLNNILQELEA  386 (387)
Q Consensus       362 ~w~~~~~~RIGtSs~~~il~~~~~~  386 (387)
                      +|++|++||||+||+++++.++|+.
T Consensus       224 ~~~~~~~fR~G~Ssll~~~~~~~~~  248 (257)
T PRK05283        224 DWADARHFRFGASSLLASLLKTLGH  248 (257)
T ss_pred             hhcCcccEeeehHHhHHHHHHHHhc
Confidence            9999999999999999999998853

>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>KOG3981|consensus Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>KOG3981|consensus Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>KOG2335|consensus Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK09485 mmuM homocysteine methyltransferase; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1ktn_A250 Structural Genomics, Protein Ec1535 Length = 250 2e-24
1jcl_A260 Observation Of Covalent Intermediates In An Enzyme 3e-24
1jcj_A260 Observation Of Covalent Intermediates In An Enzyme 2e-23
2a4a_A281 Deoxyribose-Phosphate Aldolase From P. Yoelii Lengt 6e-19
3r12_A260 Crystal Structure Of A Deoxyribose-Phosphate Aldola 2e-14
3npx_A264 Optimization Of The In Silico Designed Kemp Elimina 5e-12
3ngj_A239 Crystal Structure Of A Putative Deoxyribose-Phospha 6e-12
3nq8_A269 Optimization Of The In Silico Designed Kemp Elimina 6e-12
3npu_A263 Optimization Of The In Silico Designed Kemp Elimina 1e-11
3npw_A264 In Silico Designed Of An Improved Kemp Eliminase Ke 4e-11
3q2d_A272 Optimization Of The In Silico Designed Kemp Elimina 4e-11
3nr0_B271 Optimization Of The In Silico Designed Kemp Elimina 5e-11
3nq2_A264 Optimization Of The In Silico Designed Kemp Elimina 5e-11
3nqv_A272 Optimization Of The In Silico Designed Kemp Elimina 4e-10
3ng3_A227 Crystal Structure Of Deoxyribose Phosphate Aldolase 6e-10
3oa3_A288 Crystal Structure Of A Putative Deoxyribose-Phospha 9e-09
3ndo_A231 Crystal Structure Of Deoxyribose Phosphate Aldolase 1e-08
1vcv_A226 Structure Of 2-Deoxyribose-5-Phosphate Aldolase Fro 6e-07
4eiv_A297 1.37 Angstrom Resolution Crystal Structure Of Apo-F 9e-06
3qyq_A293 1.8 Angstrom Resolution Crystal Structure Of A Puta 1e-05
1j2w_A220 Tetrameric Structure Of Aldolase From Thermus Therm 1e-05
1mzh_A225 Qr15, An Aldolase Length = 225 4e-05
>pdb|1KTN|A Chain A, Structural Genomics, Protein Ec1535 Length = 250 Back     alignment and structure 
Iteration: 1

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 120/243 (49%), Gaps = 19/243 (7%)
Query: 131 IEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVI 190
           ++ +DLTTL+ DDT+  V  L  +A  P+               +TAA+C+YP R + + 
Sbjct: 12  LKLMDLTTLNDDDTDEKVIALCHQAKTPVG--------------NTAAICIYP-RFIPIA 56
Query: 191 KVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQ-RSLVLNNQ 249
           +   +E    ++++A+V   FP G   ++  L E         DEVD+V   R+L+  N+
Sbjct: 57  RKTLKEQGTPEIRIATVT-NFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNE 115
Query: 250 WPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKT 309
                      +      + +K I+  GELK    I  AS  ++ AG+DFIKTSTGK   
Sbjct: 116 QVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAV 175
Query: 310 NATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLF 369
           NAT  +  IM   I+       K +G KPAGG+ T ED+ +++ +   + G DW +   +
Sbjct: 176 NATPESARIMMEVIRDMG--VEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHY 233
Query: 370 RIG 372
           R G
Sbjct: 234 RFG 236
>pdb|1JCL|A Chain A, Observation Of Covalent Intermediates In An Enzyme Mechanism At Atomic Resolution Length = 260 Back     alignment and structure
>pdb|1JCJ|A Chain A, Observation Of Covalent Intermediates In An Enzyme Mechanism At Atomic Resolution Length = 260 Back     alignment and structure
>pdb|2A4A|A Chain A, Deoxyribose-Phosphate Aldolase From P. Yoelii Length = 281 Back     alignment and structure
>pdb|3R12|A Chain A, Crystal Structure Of A Deoxyribose-Phosphate Aldolase (Tm_1559) From Thermotoga Maritima At 1.75 A Resolution Length = 260 Back     alignment and structure
>pdb|3NPX|A Chain A, Optimization Of The In Silico Designed Kemp Eliminase Ke70 By Computational Design And Directed Evolution Length = 264 Back     alignment and structure
>pdb|3NGJ|A Chain A, Crystal Structure Of A Putative Deoxyribose-Phosphate Aldolase From Entamoeba Histolytica Length = 239 Back     alignment and structure
>pdb|3NQ8|A Chain A, Optimization Of The In Silico Designed Kemp Eliminase Ke70 By Computational Design And Directed Evolution R4 85A Length = 269 Back     alignment and structure
>pdb|3NPU|A Chain A, Optimization Of The In Silico Designed Kemp Eliminase Ke70 By Computational Design And Directed Evolution Length = 263 Back     alignment and structure
>pdb|3NPW|A Chain A, In Silico Designed Of An Improved Kemp Eliminase Ke70 Mutant By Computational Design And Directed Evolution Length = 264 Back     alignment and structure
>pdb|3Q2D|A Chain A, Optimization Of The In Silico Designed Kemp Eliminase Ke70 By Computational Design And Directed Evolution Length = 272 Back     alignment and structure
>pdb|3NQ2|A Chain A, Optimization Of The In Silico Designed Kemp Eliminase Ke70 By Computational Design And Directed Evolution R2 35G Length = 264 Back     alignment and structure
>pdb|3NQV|A Chain A, Optimization Of The In Silico Designed Kemp Eliminase Ke70 By Computational Design And Directed Evolution R5 74A Length = 272 Back     alignment and structure
>pdb|3NG3|A Chain A, Crystal Structure Of Deoxyribose Phosphate Aldolase From Mycobacterium Avium 104 In A Schiff Base With An Unknown Aldehyde Length = 227 Back     alignment and structure
>pdb|3OA3|A Chain A, Crystal Structure Of A Putative Deoxyribose-Phosphate Aldolase From Coccidioides Immitis Length = 288 Back     alignment and structure
>pdb|3NDO|A Chain A, Crystal Structure Of Deoxyribose Phosphate Aldolase From Mycobacterium Smegmatis Length = 231 Back     alignment and structure
>pdb|1VCV|A Chain A, Structure Of 2-Deoxyribose-5-Phosphate Aldolase From Pyrobaculum Aerophilum Length = 226 Back     alignment and structure
>pdb|4EIV|A Chain A, 1.37 Angstrom Resolution Crystal Structure Of Apo-Form Of A Putative Deoxyribose-Phosphate Aldolase From Toxoplasma Gondii Me49 Length = 297 Back     alignment and structure
>pdb|3QYQ|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of A Putative Deoxyribose- Phosphate Aldolase From Toxoplasma Gondii Me49 Length = 293 Back     alignment and structure
>pdb|1J2W|A Chain A, Tetrameric Structure Of Aldolase From Thermus Thermophilus Hb8 Length = 220 Back     alignment and structure
>pdb|1MZH|A Chain A, Qr15, An Aldolase Length = 225 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 2e-88
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 3e-34
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 2e-87
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 1e-30
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 3e-80
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 2e-31
3oa3_A288 Aldolase; structural genomics, seattle structural 2e-56
3oa3_A288 Aldolase; structural genomics, seattle structural 7e-25
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 7e-56
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 1e-25
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 1e-54
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 1e-22
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 8e-54
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 1e-20
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 3e-52
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 2e-23
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 3e-50
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 1e-22
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 4e-49
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 2e-22
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 1e-47
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 4e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Length = 260 Back     alignment and structure
 Score =  267 bits (684), Expect = 2e-88
 Identities = 89/263 (33%), Positives = 134/263 (50%), Gaps = 19/263 (7%)

Query: 124 KSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYP 183
           K+  L+ ++ +DLTTL+ DDT+  V  L  +A  P+               +TAA+C+YP
Sbjct: 6   KASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVG--------------NTAAICIYP 51

Query: 184 ARVVDVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRS 243
             +    K L +E    ++++A+V   FP G   ++  L E         DEVD+V    
Sbjct: 52  RFIPIARKTL-KEQGTPEIRIATVT-NFPHGNDDIDIALAETRAAIAYGADEVDVVFPYR 109

Query: 244 LVLNNQWPELFSEVKQMKEKCGEK-IHMKTILAVGELKTSENIYCASMTAMFAGSDFIKT 302
            ++       F  VK  KE C    + +K I+  GELK    I  AS  ++ AG+DFIKT
Sbjct: 110 ALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKT 169

Query: 303 STGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPD 362
           STGK   NAT  +  IM   I+       K +G KPAGG+ T ED+ +++ +   + G D
Sbjct: 170 STGKVAVNATPESARIMMEVIRDMG--VEKTVGFKPAGGVRTAEDAQKYLAIADELFGAD 227

Query: 363 WLNKDLFRIGASSLLNNILQELE 385
           W +   +R GASSLL ++L+ L 
Sbjct: 228 WADARHYRFGASSLLASLLKALG 250
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Length = 260 Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Length = 281 Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Length = 281 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Length = 297 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Length = 297 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Length = 288 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Length = 288 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} PDB: 1o0y_A* 3r13_A* Length = 260 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} PDB: 1o0y_A* 3r13_A* Length = 260 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Length = 231 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Length = 231 Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Length = 226 Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Length = 226 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Length = 239 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Length = 239 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Length = 225 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Length = 225 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Length = 220 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Length = 220 Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Length = 234 Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Length = 234 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 100.0
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 100.0
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 100.0
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 100.0
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 100.0
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 100.0
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 100.0
3oa3_A288 Aldolase; structural genomics, seattle structural 100.0
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 100.0
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 100.0
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 100.0
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 100.0
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 100.0
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 99.98
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 99.98
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.97
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 99.97
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 99.97
3oa3_A288 Aldolase; structural genomics, seattle structural 99.97
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 99.97
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 99.97
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 99.95
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.85
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 99.72
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 99.41
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 99.4
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 99.22
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.12
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 98.95
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 98.91
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 98.89
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 98.86
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.32
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.3
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 98.2
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 98.19
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 98.04
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 98.01
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 97.9
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 97.74
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 97.72
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 97.71
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.63
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 97.61
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 97.56
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 97.55
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.55
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 97.4
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.37
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 97.37
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 97.31
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 97.3
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 97.28
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 97.27
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 97.25
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 97.23
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.17
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.15
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.1
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 97.1
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 97.06
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.06
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 97.03
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 97.01
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.97
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 96.96
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 96.91
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 96.9
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 96.88
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 96.8
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.79
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 96.76
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 96.73
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 96.68
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 96.58
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 96.58
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 96.56
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 96.54
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 96.53
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 96.42
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 96.37
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 96.34
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 96.32
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 96.31
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 96.3
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 96.28
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 96.25
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 96.25
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 96.21
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 96.2
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 96.12
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 96.09
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 96.03
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.88
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 95.87
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 95.78
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 95.66
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 95.64
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 95.5
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.47
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 95.43
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 95.28
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 95.18
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 95.17
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 95.07
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 95.04
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.04
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 95.0
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 94.97
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 94.93
3ble_A337 Citramalate synthase from leptospira interrogans; 94.9
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 94.74
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 94.71
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 94.58
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 94.41
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 94.4
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 94.36
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 94.36
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 94.24
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 94.23
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 94.22
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 93.97
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 93.96
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 93.94
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 93.88
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 93.79
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 93.73
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 93.71
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 93.69
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 93.6
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 93.55
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 93.55
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 93.44
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 93.29
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 93.27
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 93.23
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 93.17
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 93.17
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 93.1
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 93.04
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 92.9
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 92.89
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 92.88
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 92.85
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 92.76
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 92.73
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 92.7
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 92.66
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 92.6
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 92.55
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 92.51
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 92.5
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 92.49
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 92.23
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 92.21
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 91.96
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 91.93
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 91.86
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 91.83
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 91.82
3ble_A337 Citramalate synthase from leptospira interrogans; 91.78
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 91.78
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 91.64
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 91.58
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 91.5
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 91.48
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 91.47
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 91.42
2qgy_A391 Enolase from the environmental genome shotgun sequ 91.39
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 91.38
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 91.31
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 91.25
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 90.93
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 90.92
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 90.89
1tzz_A392 Hypothetical protein L1841; structural genomics, m 90.86
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 90.76
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 90.66
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 90.45
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 90.42
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 90.32
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 90.31
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 90.3
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 90.19
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 90.18
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 90.11
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 89.91
3gd6_A 391 Muconate cycloisomerase; structural genomics, NYSG 89.85
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 89.84
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 89.8
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 89.68
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 89.56
3ngf_A269 AP endonuclease, family 2; structural genomics, se 89.56
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 89.55
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 89.53
2hzg_A 401 Mandelate racemase/muconate lactonizing enzyme/EN 89.46
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 89.39
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 89.32
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 89.14
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 89.1
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 89.09
3hq1_A 644 2-isopropylmalate synthase; LEUA, mycobacterium tu 89.08
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 88.92
2qde_A 397 Mandelate racemase/muconate lactonizing enzyme FA 88.65
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 88.44
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 88.42
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 88.31
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 88.18
1ujp_A271 Tryptophan synthase alpha chain; riken structural 88.16
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 88.16
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 88.15
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 88.15
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 87.85
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 87.76
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 87.63
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 87.53
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 87.5
2poz_A392 Putative dehydratase; octamer, structural genomics 87.27
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 87.03
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 87.0
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 86.78
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 86.76
3eez_A378 Putative mandelate racemase/muconate lactonizing e 86.69
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 86.61
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 86.59
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 86.51
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 86.35
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 85.9
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 85.82
4dwd_A 393 Mandelate racemase/muconate lactonizing enzyme, C 85.79
4e4u_A 412 Mandalate racemase/muconate lactonizing enzyme; ma 85.67
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 85.65
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 85.46
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 85.2
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 84.86
2o56_A407 Putative mandelate racemase; dehydratase, structur 84.79
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 84.62
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 84.61
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 84.55
2gl5_A410 Putative dehydratase protein; structural genomics, 84.5
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 84.42
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 84.4
2qw5_A335 Xylose isomerase-like TIM barrel; putative sugar p 84.35
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 84.26
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 84.22
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 84.2
2q02_A272 Putative cytoplasmic protein; structural genomics, 84.12
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 84.08
3ngf_A269 AP endonuclease, family 2; structural genomics, se 84.08
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 84.0
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 83.62
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 83.44
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 83.42
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 83.4
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 83.37
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 83.15
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 83.14
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 83.1
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 83.07
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 82.98
3rmj_A 370 2-isopropylmalate synthase; LEUA, truncation, neis 82.97
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 82.91
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 82.76
3kws_A287 Putative sugar isomerase; structural genomics, joi 82.59
2oz8_A389 MLL7089 protein; structural genomics, unknown func 82.57
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 82.52
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 82.47
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 82.43
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 82.31
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 82.25
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 82.01
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 81.76
3r0u_A379 Enzyme of enolase superfamily; structural genomics 81.56
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 81.46
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 81.36
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 80.9
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 80.76
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 80.75
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 80.62
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 80.56
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 80.52
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 80.5
3qxb_A316 Putative xylose isomerase; structural genomics, jo 80.21
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-74  Score=555.99  Aligned_cols=246  Identities=24%  Similarity=0.318  Sum_probs=225.4

Q ss_pred             hhhHHHHHHhhcccccccCCCCCCHHHHHHHHHHhcCCCcHHHHHHHhhhccCCCeEEEEECCccHHHHHHHhhhcCCC-
Q psy10250        121 KNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVVDVIKVLDRENAR-  199 (387)
Q Consensus       121 ~~~~~~~~~l~~~ID~T~L~~~~T~~~i~~l~~~A~~~~~~~~~~~~~~~~~~~~~~aVcV~P~~v~~a~~~L~~~~~~-  199 (387)
                      -++..+.++++++||||+|+|++|+++|+++|++|++               +|+|++|||||+||+++++.|+++  + 
T Consensus        17 ~~~~~~~~~la~~IDhTlL~p~~T~e~I~~lc~eA~~---------------~~~~aaVCV~P~~V~~a~~~L~~~--~~   79 (297)
T 4eiv_A           17 IYKQFTSRTLLNFFEVAALTDGETNESVAAVCKIAAK---------------DPAIVGVSVRPAFVRFIRQELVKS--AP   79 (297)
T ss_dssp             HHHHHHHHHHHTTEEEEECSTTCCHHHHHHHHHHHHS---------------SSCCSEEEECGGGHHHHHHTGGGT--CG
T ss_pred             ehhhhhHHHHHHhcCccCCCCCCCHHHHHHHHHHHHh---------------hcCcEEEEECHHHHHHHHHHhccc--Cc
Confidence            3566788999999999999999999999999999993               589999999999999999999863  2 


Q ss_pred             --CCceEEEEecCCCCCCCCHHHHHHHHHHHHHCCCCeeeeecCchhhhc---CChhHHHHHHHHHHHHhCCCcceEEEE
Q psy10250        200 --DDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLN---NQWPELFSEVKQMKEKCGEKIHMKTIL  274 (387)
Q Consensus       200 --~~v~v~tVvigFP~G~~~~e~K~~Ea~~Ai~~GAdEID~Vin~~~lk~---g~~~~v~~Ei~~v~~~~~~~~~lKvIl  274 (387)
                        ++++|||| ||||+|++++++|++|+++|+++||||||||||++++++   |+|++|++||++|+++|++ .+|||||
T Consensus        80 ~~s~v~V~tV-igFP~G~~~~e~K~~Ea~~Av~~GAdEIDmVinig~lk~~~~g~~~~V~~eI~~v~~a~~~-~~lKVIl  157 (297)
T 4eiv_A           80 EVAGIKVCAA-VNFPEGTGTPDTVSLEAVGALKDGADEIECLIDWRRMNENVADGESRIRLLVSEVKKVVGP-KTLKVVL  157 (297)
T ss_dssp             GGGGSEEEEE-ESTTTCCCCHHHHHHHHHHHHHTTCSEEEEECCTHHHHHCHHHHHHHHHHHHHHHHHHHTT-SEEEEEC
T ss_pred             CCCCCeEEEE-ecCCCCCCCHHHHHHHHHHHHHcCCCEEEeeeeHHHHhcccCCcHHHHHHHHHHHHHHhcC-CceEEEE
Confidence              57999999 599999999999999999999999999999999999999   9999999999999999976 7999999


Q ss_pred             eeccCCChHHHHHHHHHHHHcCCCEEEcCCCCCCCCCChhhhHhHHHHHHHHH---------------HHcCCCceEeEe
Q psy10250        275 AVGELKTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFH---------------KLSGKKIGLKPA  339 (387)
Q Consensus       275 Et~~L~t~e~i~~a~~ia~~aGaDfVKTSTGf~~~gat~~~~~~m~~~v~~~~---------------~~~~~~~gIKas  339 (387)
                      ||++|+++|.|++||++|+++|||||||||||+++|||++++++|++.|+.+.               ..+++++|||||
T Consensus       158 Et~~Lt~~e~i~~A~~ia~~AGADFVKTSTGf~~~gAT~edV~lM~~~v~~~~~~~~~~~~~~~~~~~~~tg~~vgvKAs  237 (297)
T 4eiv_A          158 SGGELQGGDIISRAAVAALEGGADFLQTSSGLGATHATMFTVHLISIALREYMVRENERIRVEGINREGAAVRCIGIKIE  237 (297)
T ss_dssp             CSSCCCCHHHHHHHHHHHHHHTCSEEECCCSSSSCCCCHHHHHHHHHHHHHHHCC------------------CCEEEEE
T ss_pred             ecccCCcHHHHHHHHHHHHHhCCCEEEcCCCCCCCCCCHHHHHHHHHHHHHHhccccccccccccccccccCCceeEEec
Confidence            99999665558999999999999999999999999999999999999998763               234789999999


Q ss_pred             -ccCCCHHHHHHHHHHHHHhcCCCccCCCcceeeccc-hHHHHHHHHhh
Q psy10250        340 -GGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASS-LLNNILQELEA  386 (387)
Q Consensus       340 -GGIrt~~~a~~~i~l~~~~~Ga~w~~~~~~RIGtSs-~~~il~~~~~~  386 (387)
                       |||||++||+.|++++++ +|.+|++|++||||+|| +++.+..++|.
T Consensus       238 ~GGIrt~e~A~~~i~~~~e-lG~~wl~~~~fRiGaSs~ll~el~~~~~~  285 (297)
T 4eiv_A          238 VGDVHMAETADFLMQMIFE-NGPRSIVRDKFRVGGGFNLLKELRDCYES  285 (297)
T ss_dssp             CTTCCHHHHHHHHHHHHHH-HCGGGCSTTTEEEEECHHHHHHHHHHHHT
T ss_pred             CCCCCCHHHHHHHHHHHHH-hCccccCCCceEecccHHHHHHHHHHHhh
Confidence             999999999999999999 99999999999999998 77777777764
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 387
d1p1xa_250 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 2e-60
d1p1xa_250 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 1e-16
d2a4aa1256 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldol 2e-59
d2a4aa1256 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldol 5e-14
d1o0ya_251 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 2e-44
d1o0ya_251 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 3e-15
d1vcva1226 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase 5e-43
d1vcva1226 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase 8e-13
d1mzha_225 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 2e-42
d1mzha_225 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 3e-14
d1ub3a_211 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 3e-39
d1ub3a_211 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 5e-15
d1n7ka_234 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 1e-35
d1n7ka_234 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 4e-09
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Deoxyribose-phosphate aldolase DeoC
species: Escherichia coli [TaxId: 562]

 Score =  193 bits (492), Expect = 2e-60
 Identities = 86/259 (33%), Positives = 132/259 (50%), Gaps = 19/259 (7%)

Query: 128 LKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANVHTAAVCVYPARVV 187
           L+ ++ +DLTTL+ DDT+  V  L  +A  P+               +TAA+C+YP  + 
Sbjct: 9   LRALKLMDLTTLNDDDTDEKVIALCHQAKTPVG--------------NTAAICIYPRFI- 53

Query: 188 DVIKVLDRENARDDVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLN 247
            + +   +E    ++++A+V   FP G   ++  L E         DEVD+V     ++ 
Sbjct: 54  PIARKTLKEQGTPEIRIATVT-NFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMA 112

Query: 248 NQWPELFSEVKQMKEKCGEK-IHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSTGK 306
                 F  VK  KE C    + +K I+  GELK    I  AS  ++ AG+DFIKTSTGK
Sbjct: 113 GNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGK 172

Query: 307 EKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNK 366
              NAT  +  IM   I+       K +G KPAGG+ T ED+ +++ +   + G DW + 
Sbjct: 173 VAVNATPESARIMMEVIRDMG--VEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADA 230

Query: 367 DLFRIGASSLLNNILQELE 385
             +R GASSLL ++L+ L 
Sbjct: 231 RHYRFGASSLLASLLKALG 249
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 256 Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 256 Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 226 Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 226 Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Length = 225 Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Length = 225 Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Length = 211 Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Length = 211 Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 234 Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 234 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 100.0
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 100.0
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 100.0
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 100.0
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 100.0
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 100.0
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 100.0
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 100.0
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 99.98
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 99.97
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 99.97
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 99.97
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 99.97
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 99.95
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.47
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 97.46
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.41
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.26
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 97.14
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 96.96
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 96.72
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 96.19
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 96.04
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 95.81
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 95.76
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 95.72
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 95.72
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 95.36
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 95.27
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 94.94
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 94.78
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.68
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 94.67
d1ofda2809 Alpha subunit of glutamate synthase, central and F 94.37
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 94.26
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 94.15
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 94.08
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 93.79
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 93.27
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 92.99
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 92.84
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 92.8
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 92.41
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 92.13
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 91.93
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 91.38
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 91.13
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 90.92
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 88.43
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 87.56
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 87.12
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 86.98
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 83.92
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 83.69
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 82.93
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 82.86
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 82.68
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 82.21
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 82.13
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 82.03
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 81.48
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 80.8
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 80.54
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 80.51
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 80.11
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Deoxyribose-phosphate aldolase DeoC
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.5e-72  Score=533.86  Aligned_cols=243  Identities=36%  Similarity=0.538  Sum_probs=224.0

Q ss_pred             hHHHHHHhhcccccccCCCCCCHHHHHHHHHHhcCCCcHHHHHHHhhhccCC--CeEEEEECCccHHHHHHHhhhcCCCC
Q psy10250        123 KKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLHQQANV--HTAAVCVYPARVVDVIKVLDRENARD  200 (387)
Q Consensus       123 ~~~~~~~l~~~ID~T~L~~~~T~~~i~~l~~~A~~~~~~~~~~~~~~~~~~~--~~~aVcV~P~~v~~a~~~L~~~~~~~  200 (387)
                      .+.+.++.+++||||+|+|++|++||.++|++|+                +|  +|++|||||+||+++++.|+++. ++
T Consensus         4 ~~~~~l~~~~~iD~T~L~~~~T~~~i~~lc~~A~----------------~~~~~~aaVCV~P~~v~~a~~~l~~~~-~~   66 (250)
T d1p1xa_           4 LKASSLRALKLMDLTTLNDDDTDEKVIALCHQAK----------------TPVGNTAAICIYPRFIPIARKTLKEQG-TP   66 (250)
T ss_dssp             HHHHHHHHHTTEEEECCCTTCCHHHHHHHHHHTE----------------ETTEECSEEECCGGGHHHHHHHHHHTT-CT
T ss_pred             hhHHHHHHhhhccCCCCCCCCCHHHHHHHHHHHH----------------hhcCCeEEEEEChHHHHHHHHHhhhcC-CC
Confidence            3445567779999999999999999999999999                66  99999999999999999997641 35


Q ss_pred             CceEEEEecCCCCCCCCHHHHHHHHHHHHHCCCCeeeeecCchhhhcCChhHHHHHHHHHHHHhC-CCcceEEEEeeccC
Q psy10250        201 DVKVASVAAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCG-EKIHMKTILAVGEL  279 (387)
Q Consensus       201 ~v~v~tVvigFP~G~~~~e~K~~Ea~~Ai~~GAdEID~Vin~~~lk~g~~~~v~~Ei~~v~~~~~-~~~~lKvIlEt~~L  279 (387)
                      +++|||| ||||+|+++++.|++|+++|+++||||||||+|++++++|+|+++++||++++++|+ .++++||||||++|
T Consensus        67 ~v~v~tV-igFP~G~~~~e~K~~E~~~Ai~~GAdEID~Vin~~~l~~g~~~~v~~ei~~v~~~~~~~~~~lKVIlEt~~L  145 (250)
T d1p1xa_          67 EIRIATV-TNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGEL  145 (250)
T ss_dssp             TSEEEEE-ESTTTCCSCHHHHHHHHHHHHHHTCSEEEEECCHHHHHTTCCHHHHHHHHHHHHHHHHTTCEEEEECCHHHH
T ss_pred             cceEEEE-eccCCCCccHhHHHHHHHHHHHcCCCeEEEeecchhhccccHHHHHHHHHHHHHhhccCCceEEEEEecccc
Confidence            7999999 599999999999999999999999999999999999999999999999999999985 34899999999999


Q ss_pred             CChHHHHHHHHHHHHcCCCEEEcCCCCCCCCCChhhhHhHHHHHHHHHHHcCCCceEeEeccCCCHHHHHHHHHHHHHhc
Q psy10250        280 KTSENIYCASMTAMFAGSDFIKTSTGKEKTNATIPAGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIML  359 (387)
Q Consensus       280 ~t~e~i~~a~~ia~~aGaDfVKTSTGf~~~gat~~~~~~m~~~v~~~~~~~~~~~gIKasGGIrt~~~a~~~i~l~~~~~  359 (387)
                      ++++.+++||++|+++|||||||||||+++|+|++++.+|.+.++.+  ..+.++|||+||||||++||.+|+++..+.+
T Consensus       146 td~e~i~~a~~ia~~aGadFvKTSTG~~~~gat~~~v~~m~~~i~~~--~~~~~vgIKasGGIrt~~~a~~~i~~ga~~i  223 (250)
T d1p1xa_         146 KDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDM--GVEKTVGFKPAGGVRTAEDAQKYLAIADELF  223 (250)
T ss_dssp             CSHHHHHHHHHHHHHTTCSEEECCCSCSSCCCCHHHHHHHHHHHHHH--TCTTTCEEECBSSCCSHHHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHHcCcCeEEecCCcCCCCCCHHHHHHHHHHhhhh--ccCcceeeEecCCCCCHHHHHHHHHHHHHHh
Confidence            55443468999999999999999999999999999999999888766  3578999999999999999999999999999


Q ss_pred             CCCccCCCcceeeccchHHHHHHHHh
Q psy10250        360 GPDWLNKDLFRIGASSLLNNILQELE  385 (387)
Q Consensus       360 Ga~w~~~~~~RIGtSs~~~il~~~~~  385 (387)
                      |.+|++|++||||+||++++|+++|.
T Consensus       224 G~~~~~~~~fRiGaSs~l~~l~~~l~  249 (250)
T d1p1xa_         224 GADWADARHYRFGASSLLASLLKALG  249 (250)
T ss_dssp             CTTSCSTTTBCEEESTHHHHHHHHHT
T ss_pred             CccccccCceeeeHHHHHHHHHHHhc
Confidence            99999999999999999999999885
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure