Psyllid ID: psy10285

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---
DGSNPGDQESSNDKDRISTSGQPTQESKVSDPHKALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEDGSNPGDQESSNDKDRISTSGQPTQESKVSDPHKALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAREVNIV
ccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccEEEEEcHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHccccccccccEEEEccccccEEcHHHHHHHHHHHHHHcccEEEEcEEEEEEEEEccEEEEEEccccccEEEccEEEEcccccEEEEEccEEEEcccccHHHHHHHcccccccccccccccccccEEEcEEEEEEEccccccccccEEEcccccEEEEEccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccEEEEcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccccccccccc
ccccccccccccccccEccccccccccccccccHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccEEcccccccccccccccccccccEccccccccccccccccHHcHcccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHcccccccccccccccccccEEEEcccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccEccccEEEEEcHHHHHHHHHHHHHHHHccccEEEccHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEcEEEEEEEEEccEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEEEcccHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccccccccEEEccccEEEEEcccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHccEEEcccccccccccccccEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccHHccc
dgsnpgdqessndkdristsgqptqeskvsdphkalkettnrysfndaeapsgyvdpaktdehYHIKRAMRILKLDFQKLWrnvqdpesryqgntlfptHVDILIIGGGAIGSSIAYFIKEKvldgcrvavvdrdftvnydldedgsnpgdqessndkdristsgqptqeskvsdphkalkettnrysfndaeapsgyvdpaktdehYHIKRAMRILKLDFQKLWrnvqdpesryqgntlfptHVDILIIGGGAIGSSIAYFIKEKvldgcrvavvdrdftvnydldeyarasttlsvgglrqqfslreniEMSLFGAEFLRNIKHHchvigedepdvnftpngylfcasqdgaaTLEKNHQLQKELgaknvllgpeqlkakfpwlntdDIALACLglekegwfdpWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNnqvhyegyddgeyhsvnecvvrdekgelkTITFAICVIAAGAYSGQVARMLKIGdknqeqgflfvplpveprkryvycfesprgpgvntpmvidttgtyfrreglgnyyicgksptpeqeppvdnldvdyeyfnenvwPHLAHRVKAFEELKVSNawagyydfnyfdenaiiglhpsyhnihfatgfsghgiqqaPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAREVNIV
dgsnpgdqessndkdristsgqptqeskvsdphkalkettnrysfndaeapsgyvdpakTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVnydldedgsnpgdqessndkdristsgqptqeskvsdphkalkettnrysfndaeapsgyvdpakTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDeyarasttlsvgglrqQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHyegyddgeyhsVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCfesprgpgvntpmvIDTTGTYFRREGLGNYyicgksptpeqEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVarrqearevniv
DGSNPGDQESSNDKDRISTSGQPTQESKVSDPHKALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILiigggaigssiaYFIKEKVLDGCRVAVVDRDFTVNYDLDEDGSNPGDQESSNDKDRISTSGQPTQESKVSDPHKALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILiigggaigssiaYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLervarrqearevNIV
************************************************************DEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDL**************************************************************DEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGK**********DNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERV************
***************************************************************YHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLD****************************************************************YHIKRAMRILKLDFQ*********************HVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAREVNIV
**********************************ALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDED*********************************ALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQ********
******************************************Y*FN*****SGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLD***************************************************************HYHIKRAMRILKLDFQKLWRNVQDPE****GNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAR*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DGSNPGDQESSNDKDRISTSGQPTQESKVSDPHKALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEDGSNPGDQESSNDKDRISTSGQPTQESKVSDPHKALKETTNRYSFNDAEAPSGYVDPAKTDEHYHIKRAMRILKLDFQKLWRNVQDPESRYQGNTLFPTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAREVNIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query673 2.2.26 [Sep-21-2011]
Q6DCP1499 FAD-dependent oxidoreduct N/A N/A 0.601 0.811 0.496 1e-118
Q5EA45486 FAD-dependent oxidoreduct yes N/A 0.601 0.833 0.501 1e-116
Q4R510486 FAD-dependent oxidoreduct N/A N/A 0.631 0.874 0.491 1e-113
Q96CU9486 FAD-dependent oxidoreduct yes N/A 0.625 0.866 0.487 1e-111
Q3TQB2487 FAD-dependent oxidoreduct yes N/A 0.644 0.891 0.451 1e-107
Q99LB7 919 Sarcosine dehydrogenase, no N/A 0.543 0.398 0.219 5e-10
Q64380 919 Sarcosine dehydrogenase, yes N/A 0.551 0.403 0.221 9e-10
Q9UL12 918 Sarcosine dehydrogenase, no N/A 0.578 0.423 0.217 1e-06
P40854389 Monomeric sarcosine oxida N/A N/A 0.509 0.881 0.24 1e-05
P23342387 Monomeric sarcosine oxida N/A N/A 0.093 0.162 0.390 6e-05
>sp|Q6DCP1|FXRD1_XENLA FAD-dependent oxidoreductase domain-containing protein 1 OS=Xenopus laevis GN=foxred1 PE=2 SV=1 Back     alignment and function desciption
 Score =  427 bits (1098), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/421 (49%), Positives = 286/421 (67%), Gaps = 16/421 (3%)

Query: 258 SIAYFIKEK--VLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSL 315
           SIAY++K+K       +V VV+RD T       Y+RAST LS GG+RQQFS  ENI+MSL
Sbjct: 90  SIAYWLKQKENRRGALKVVVVERDPT-------YSRASTVLSAGGIRQQFSRPENIQMSL 142

Query: 316 FGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLG 375
           F A+FLRNI  H  V+ ED  D+ F P+GYLF AS++GA  +E+N+ +Q+E GA+  L+ 
Sbjct: 143 FSAQFLRNINEHLGVVNEDRIDIQFNPSGYLFLASEEGATIMEENYNVQRECGAQVTLML 202

Query: 376 PEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRR 435
           P+QLK KFPW+NT+ +ALA  GLE EGWFDPW  LNA ++KA+S+G     GEV DF   
Sbjct: 203 PDQLKKKFPWINTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYQCHGEVTDFSTA 262

Query: 436 RNNQVHYEGYDDGEYHSVNECVVRDEKG-ELKTITFAICVIAAGAYSGQVARMLKIGD-- 492
           +   +  +G D   +  +    V+     E +++  ++ + AAGA+S +VA +  IG   
Sbjct: 263 KREMITADG-DPVTFSRIGHVTVQMPNSLESQSVECSLVINAAGAWSSKVAELAGIGTGP 321

Query: 493 KNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSP 552
            N  +G   + LPVEP+KRYVY    P GPG++ P++ID +G YFRREGLG  YI GKSP
Sbjct: 322 SNSLEG---IKLPVEPKKRYVYVVHCPNGPGLDCPLLIDNSGAYFRREGLGGNYIAGKSP 378

Query: 553 TPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLH 612
             E+EP + N++VD+++F E VWP LAHRV AFE LKV  +WAGYYD+N +D+N ++G+H
Sbjct: 379 AEEEEPDISNMEVDHDFFQEKVWPLLAHRVPAFESLKVKTSWAGYYDYNTYDQNGVVGMH 438

Query: 613 PSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAREVNI 672
           P  +N+ FATGFSGHG+Q +PA+GRAV+ELI+D  FKT++LS F   R   ++   E NI
Sbjct: 439 PLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGGFKTLNLSSFSFRRFWSQEPLLERNI 498

Query: 673 V 673
           V
Sbjct: 499 V 499

Xenopus laevis (taxid: 8355)
>sp|Q5EA45|FXRD1_BOVIN FAD-dependent oxidoreductase domain-containing protein 1 OS=Bos taurus GN=FOXRED1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R510|FXRD1_MACFA FAD-dependent oxidoreductase domain-containing protein 1 OS=Macaca fascicularis GN=FOXRED1 PE=2 SV=1 Back     alignment and function description
>sp|Q96CU9|FXRD1_HUMAN FAD-dependent oxidoreductase domain-containing protein 1 OS=Homo sapiens GN=FOXRED1 PE=1 SV=2 Back     alignment and function description
>sp|Q3TQB2|FXRD1_MOUSE FAD-dependent oxidoreductase domain-containing protein 1 OS=Mus musculus GN=Foxred1 PE=2 SV=1 Back     alignment and function description
>sp|Q99LB7|SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus GN=Sardh PE=1 SV=1 Back     alignment and function description
>sp|Q64380|SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Sardh PE=1 SV=2 Back     alignment and function description
>sp|Q9UL12|SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens GN=SARDH PE=1 SV=1 Back     alignment and function description
>sp|P40854|MSOX_STRSB Monomeric sarcosine oxidase OS=Streptomyces sp. (strain KB210-8SY) GN=soxA PE=1 SV=2 Back     alignment and function description
>sp|P23342|MSOX_BACSN Monomeric sarcosine oxidase OS=Bacillus sp. (strain NS-129) GN=soxA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query673
156543967517 PREDICTED: FAD-dependent oxidoreductase 0.671 0.874 0.539 1e-147
328724746501 PREDICTED: FAD-dependent oxidoreductase 0.690 0.928 0.509 1e-141
427794787520 Hypothetical protein, partial [Rhipiceph 0.673 0.871 0.512 1e-138
383863338 824 PREDICTED: FAD-dependent oxidoreductase 0.627 0.512 0.544 1e-135
170037285507 FAD oxidoreductase [Culex quinquefasciat 0.705 0.936 0.501 1e-133
307168159 844 FAD-dependent oxidoreductase domain-cont 0.668 0.533 0.518 1e-133
157138729514 fad oxidoreductase [Aedes aegypti] gi|10 0.667 0.873 0.526 1e-132
157131506514 fad oxidoreductase [Aedes aegypti] gi|10 0.667 0.873 0.526 1e-132
289743413513 FAD oxidoreductase [Glossina morsitans m 0.673 0.883 0.508 1e-131
346467923492 hypothetical protein [Amblyomma maculatu 0.661 0.904 0.501 1e-129
>gi|156543967|ref|XP_001604478.1| PREDICTED: FAD-dependent oxidoreductase domain-containing protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 255/473 (53%), Positives = 329/473 (69%), Gaps = 21/473 (4%)

Query: 210 IKRAMRILKLDFQKLWRNVQDPESRYQGN----------TLFPTHVDILIIGGGAIGSSI 259
           +KR + ++K +  K W+N ++P    + N           +FP H D++IIGGGAIGS++
Sbjct: 55  VKRDVALMKKNV-KFWKNEENPAIDKKTNRVIDWDDPNAPIFPNHCDVVIIGGGAIGSAV 113

Query: 260 AYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAE 319
           AY+ K+ +    RV V+++D         Y + ST LSVGGLRQQFSL ENIEMSLFGAE
Sbjct: 114 AYWCKKILRGSLRVVVIEKD-------PYYTQCSTVLSVGGLRQQFSLEENIEMSLFGAE 166

Query: 320 FLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQL 379
           F+RN   +  + GE   D+ F P GYL  A+++    L++NH+LQK LGAKNV+L   QL
Sbjct: 167 FIRNANEYLGIEGEPVVDLQFHPYGYLSLATEESVHILKRNHELQKSLGAKNVILNKNQL 226

Query: 380 KAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQ 439
           K+KFPWL+TDDI L CLGL+ EGWFDPWL L ++K+KA+S+G EY+      F  + N  
Sbjct: 227 KSKFPWLSTDDIELGCLGLQNEGWFDPWLLLCSLKRKAMSMGVEYITATAKGFNFKVNPN 286

Query: 440 VHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGF 499
           VH  G   GEY  +   VV  E G L+ ITF+ C++AAGA+SG++A+M +IG     +G 
Sbjct: 287 VHLAGVPPGEYEQLEYLVVETEDGTLRPITFSKCIVAAGAFSGEIAKMARIGTG---RGI 343

Query: 500 LFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPP 559
           L +PLPVEPRKRYVYCF +P GPG+NTP+ ID TG YFRREGL N YICG+SP   +EP 
Sbjct: 344 LKIPLPVEPRKRYVYCFHAPDGPGLNTPLTIDPTGVYFRREGLANNYICGRSPEEHEEPT 403

Query: 560 VDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIH 619
           VDNLDVD E+F  NVWP LA RVKAFE LKV ++WAGYY+FN  DEN +IG HP + N+ 
Sbjct: 404 VDNLDVDPEFFENNVWPVLAKRVKAFENLKVKSSWAGYYEFNTLDENGVIGYHPYHQNLL 463

Query: 620 FATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSRFLLERVARRQEAREVNI 672
           FATGFSGHGIQ+APA+GRA+SELI+D  FKTIDLSR   +R    +  +E+NI
Sbjct: 464 FATGFSGHGIQKAPAVGRAISELIVDNNFKTIDLSRLSFQRFITSESVKEINI 516

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328724746|ref|XP_001945836.2| PREDICTED: FAD-dependent oxidoreductase domain-containing protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|427794787|gb|JAA62845.1| Hypothetical protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|383863338|ref|XP_003707138.1| PREDICTED: FAD-dependent oxidoreductase domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|170037285|ref|XP_001846489.1| FAD oxidoreductase [Culex quinquefasciatus] gi|167880398|gb|EDS43781.1| FAD oxidoreductase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307168159|gb|EFN61438.1| FAD-dependent oxidoreductase domain-containing protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157138729|ref|XP_001664310.1| fad oxidoreductase [Aedes aegypti] gi|108869421|gb|EAT33646.1| AAEL014077-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157131506|ref|XP_001662263.1| fad oxidoreductase [Aedes aegypti] gi|108871516|gb|EAT35741.1| AAEL012120-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|289743413|gb|ADD20454.1| FAD oxidoreductase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|346467923|gb|AEO33806.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query673
ZFIN|ZDB-GENE-080204-64492 foxred1 "FAD-dependent oxidore 0.598 0.819 0.510 6.4e-108
UNIPROTKB|E2RNI5486 FOXRED1 "Uncharacterized prote 0.638 0.884 0.477 2.5e-106
UNIPROTKB|Q5EA45486 FOXRED1 "FAD-dependent oxidore 0.613 0.849 0.489 5.1e-106
UNIPROTKB|F1S6H4486 FOXRED1 "Uncharacterized prote 0.615 0.851 0.490 2.2e-105
FB|FBgn0002021515 l(2)37Bb "lethal (2) 37Bb" [Dr 0.589 0.770 0.459 6.6e-102
UNIPROTKB|Q96CU9486 FOXRED1 "FAD-dependent oxidore 0.624 0.864 0.465 7.9e-101
FB|FBgn0033093440 CG3270 [Drosophila melanogaste 0.514 0.786 0.537 9.1e-100
UNIPROTKB|F1P104437 FOXRED1 "Uncharacterized prote 0.595 0.917 0.472 7.7e-97
MGI|MGI:2446262487 Foxred1 "FAD-dependent oxidore 0.619 0.856 0.439 3.4e-93
UNIPROTKB|B4DXM1316 FOXRED1 "cDNA FLJ52799" [Homo 0.463 0.987 0.479 4.2e-79
ZFIN|ZDB-GENE-080204-64 foxred1 "FAD-dependent oxidoreductase domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1045 (372.9 bits), Expect = 6.4e-108, Sum P(2) = 6.4e-108
 Identities = 215/421 (51%), Positives = 279/421 (66%)

Query:   242 PTHVDILXXXXXXXXXXXXYFIK--EKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVG 299
             P   D++            Y+IK  E+     RV VV++D T       Y++AST LS G
Sbjct:    67 PERADVVIIGGGVVGWSIAYWIKRKERTRGALRVVVVEKDPT-------YSQASTVLSCG 119

Query:   300 GLRQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEK 359
             G+RQQFSL+ENI +SL  A+FLRNI  H  V  ED  D+ F  +GYLF AS+  A  +E+
Sbjct:   120 GIRQQFSLKENILLSLESADFLRNINKHLWVTNEDPVDLQFNHSGYLFLASEKSAHVMEE 179

Query:   360 NHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAVKKKAIS 419
             N+  Q+  GAK VLL P QLK +FPW+NT+ +ALA LGLE EGWFDPW  LNA ++KA+S
Sbjct:   180 NYSTQRYAGAKVVLLSPSQLKERFPWMNTEGVALASLGLENEGWFDPWSLLNAFRRKALS 239

Query:   420 LGAEYVRGEVVDFLRRRNNQVHY--EGYDDGEYHSVNECV-VRDEKG-ELKTITFAICVI 475
             +G     GEV  F  R + Q+    EG D  ++  + +CV VR     E + +   + V 
Sbjct:   240 MGVYQCFGEVTGF--RYSTQIAEVAEG-DFVDFRRI-KCVNVRMPNSLEYQPVECPVVVN 295

Query:   476 AAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGT 535
             AAGA SG++A ML IG    E+    +P PVEPRKR+VY    P GPG++TP +ID +G 
Sbjct:   296 AAGANSGKIAAMLGIG-LGPEESVSGIPFPVEPRKRFVYVVHCPDGPGLDTPFLIDYSGV 354

Query:   536 YFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWA 595
             Y RREGLG  YI G SP   +EP + NLDVD+E+F E VW HLAHR+ AFE+LKVS+AWA
Sbjct:   355 YLRREGLGGNYIAGMSPEETEEPDISNLDVDHEFFQEKVWHHLAHRIPAFEKLKVSSAWA 414

Query:   596 GYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKTIDLSR 655
             G+YD+N FD+N I+GLHP   N++FATGFSGHG+QQ+PA+GRA++ELILD  +KTIDLS 
Sbjct:   415 GFYDYNTFDQNGILGLHPLVANMYFATGFSGHGLQQSPAVGRAIAELILDRGYKTIDLSA 474

Query:   656 F 656
             F
Sbjct:   475 F 475
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
UNIPROTKB|E2RNI5 FOXRED1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA45 FOXRED1 "FAD-dependent oxidoreductase domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6H4 FOXRED1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0002021 l(2)37Bb "lethal (2) 37Bb" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q96CU9 FOXRED1 "FAD-dependent oxidoreductase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0033093 CG3270 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P104 FOXRED1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2446262 Foxred1 "FAD-dependent oxidoreductase domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXM1 FOXRED1 "cDNA FLJ52799" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3TQB2FXRD1_MOUSENo assigned EC number0.45160.64480.8911yesN/A
Q96CU9FXRD1_HUMANNo assigned EC number0.48750.62550.8662yesN/A
Q5EA45FXRD1_BOVINNo assigned EC number0.50110.60170.8333yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query673
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 9e-51
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 2e-24
PRK11259376 PRK11259, solA, N-methyltryptophan oxidase; Provis 3e-12
TIGR02352337 TIGR02352, thiamin_ThiO, glycine oxidase ThiO 5e-09
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 5e-09
TIGR01377380 TIGR01377, soxA_mon, sarcosine oxidase, monomeric 3e-08
COG0578 532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 2e-07
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 6e-06
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 8e-05
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  180 bits (459), Expect = 9e-51
 Identities = 103/437 (23%), Positives = 158/437 (36%), Gaps = 66/437 (15%)

Query: 242 PTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGL 301
              +D++IIGGG +G S AY++ E+   G  V V++          E    +   + GG+
Sbjct: 2   SMKMDVVIIGGGIVGLSAAYYLAER---GADVTVLEAG--------EAGGGAAGRNAGGI 50

Query: 302 RQQFSLRENIEMSLFGAE-----FLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDG--- 353
              ++           A+     +    +      G           G L  A+++G   
Sbjct: 51  LAPWASPGGELEVRPLADLSLALWRELSEELGTGAG-------LRRRGLLDLAAREGLKG 103

Query: 354 AATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKEGWFDPWLYLNAV 413
            A LE+     +  G    LL   +     P L  D +    L     G  DP L   A+
Sbjct: 104 LAQLERLAAELEAAGEDAELLDAAEAAELEPALGPDFVCGG-LFDPTGGHLDPRLLTRAL 162

Query: 414 KKKAISLGAEYVRGEV-VDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAI 472
              A  LG   + G   V  L R    V                 V  + G   TI    
Sbjct: 163 AAAAEELGVVIIEGGTPVTSLERDGRVV----------------GVETDGG---TIEADK 203

Query: 473 CVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRG----PGVNTPM 528
            V+AAGA++G++A  L             +PLP+ P +      E P G          +
Sbjct: 204 VVLAAGAWAGELAATLGE-----------LPLPLRPVRGQALTTEPPEGLLADGLAPVVL 252

Query: 529 VIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYEYFNENVWPHLAHRVKAFEEL 588
           V+D  G Y R  G G   + G       +P     +   +     +       +    + 
Sbjct: 253 VVDDGGGYIRPRGDGRLRVGGTDEEGGDDPSDPERE---DLVIAELLRVARALLPGLADA 309

Query: 589 KVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEF 648
            +  AWAG       D   +IG      N++ ATG  GHG   APA+GR +++LIL  E 
Sbjct: 310 GIEAAWAGLRPPTTPDGLPVIGRAAPLPNLYVATGHGGHGFTLAPALGRLLADLILGGE- 368

Query: 649 KTIDLSRFLLERVARRQ 665
             +DL   LL+R A  +
Sbjct: 369 PELDLRPLLLDRFAPGR 385

Length = 387
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|236887 PRK11259, solA, N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233831 TIGR02352, thiamin_ThiO, glycine oxidase ThiO Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130444 TIGR01377, soxA_mon, sarcosine oxidase, monomeric form Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 673
KOG2853|consensus509 100.0
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 100.0
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 100.0
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 100.0
PRK11259376 solA N-methyltryptophan oxidase; Provisional 100.0
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 100.0
KOG2844|consensus 856 100.0
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 100.0
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 100.0
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 100.0
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 100.0
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 100.0
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 100.0
KOG2820|consensus399 100.0
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 100.0
PRK11728393 hydroxyglutarate oxidase; Provisional 99.97
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.97
KOG2852|consensus380 99.96
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.93
COG0579429 Predicted dehydrogenase [General function predicti 99.92
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.92
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.9
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.89
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.86
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.86
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.86
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.86
KOG3923|consensus342 99.85
PRK05257494 malate:quinone oxidoreductase; Validated 99.84
KOG2665|consensus453 99.72
KOG0042|consensus 680 99.7
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.49
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.39
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.38
PRK06116450 glutathione reductase; Validated 99.38
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.37
PRK06370463 mercuric reductase; Validated 99.32
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.31
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.31
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.3
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.3
PRK14694468 putative mercuric reductase; Provisional 99.3
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.29
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.28
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.28
PLN02507499 glutathione reductase 99.28
PTZ00058561 glutathione reductase; Provisional 99.28
TIGR02053463 MerA mercuric reductase. This model represents the 99.27
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.27
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.27
PRK13748561 putative mercuric reductase; Provisional 99.24
PRK14727479 putative mercuric reductase; Provisional 99.23
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 99.22
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.21
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.21
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.2
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.19
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.18
PRK06185407 hypothetical protein; Provisional 99.17
PLN02697529 lycopene epsilon cyclase 99.16
PLN02546558 glutathione reductase 99.15
PRK10157428 putative oxidoreductase FixC; Provisional 99.15
PTZ00052499 thioredoxin reductase; Provisional 99.14
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.13
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.13
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.13
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.12
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.1
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.1
COG2081408 Predicted flavoproteins [General function predicti 99.09
PRK07121492 hypothetical protein; Validated 99.08
PLN02463447 lycopene beta cyclase 99.08
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.07
PRK08274466 tricarballylate dehydrogenase; Validated 99.07
PRK07846451 mycothione reductase; Reviewed 99.06
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.06
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.05
KOG1335|consensus506 99.05
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.05
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.02
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.02
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.01
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.0
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.99
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.99
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.99
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.97
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.97
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.97
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.96
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.96
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.95
PRK07804 541 L-aspartate oxidase; Provisional 98.94
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.93
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.93
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
PRK07233434 hypothetical protein; Provisional 98.91
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.91
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.91
KOG2853|consensus509 98.91
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.88
PRK08071 510 L-aspartate oxidase; Provisional 98.88
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
PTZ00153659 lipoamide dehydrogenase; Provisional 98.88
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.88
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.87
PRK06175433 L-aspartate oxidase; Provisional 98.86
PRK06847375 hypothetical protein; Provisional 98.86
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.86
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.86
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.85
PLN02815 594 L-aspartate oxidase 98.85
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.85
PRK08244 493 hypothetical protein; Provisional 98.84
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.84
PRK10262321 thioredoxin reductase; Provisional 98.83
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.83
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.83
PRK07395 553 L-aspartate oxidase; Provisional 98.83
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.83
PRK06834 488 hypothetical protein; Provisional 98.83
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.82
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.82
PRK06184 502 hypothetical protein; Provisional 98.82
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.82
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.81
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.81
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.81
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.81
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.8
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.8
PRK12839 572 hypothetical protein; Provisional 98.8
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.79
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.79
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.79
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.79
PRK07512 513 L-aspartate oxidase; Provisional 98.79
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.79
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.78
PRK09077 536 L-aspartate oxidase; Provisional 98.78
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.77
PRK13512438 coenzyme A disulfide reductase; Provisional 98.76
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.76
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.75
PRK10015429 oxidoreductase; Provisional 98.75
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.75
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.75
PRK08275 554 putative oxidoreductase; Provisional 98.74
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.74
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.73
PRK08401466 L-aspartate oxidase; Provisional 98.73
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.72
PRK06126 545 hypothetical protein; Provisional 98.71
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.71
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.7
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.7
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.7
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.7
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.7
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.69
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.69
PLN02985 514 squalene monooxygenase 98.69
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.68
KOG1298|consensus 509 98.67
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.67
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.67
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.66
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.65
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.63
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.63
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.63
PRK08163396 salicylate hydroxylase; Provisional 98.62
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.62
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.61
PRK12831464 putative oxidoreductase; Provisional 98.61
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.6
PRK09126392 hypothetical protein; Provisional 98.6
PRK08013400 oxidoreductase; Provisional 98.59
PRK06996398 hypothetical protein; Provisional 98.57
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.56
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.55
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.55
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.55
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.55
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.54
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.53
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.52
PRK07208479 hypothetical protein; Provisional 98.52
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.52
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.52
PRK12779944 putative bifunctional glutamate synthase subunit b 98.51
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.51
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.5
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.49
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.48
PRK07045388 putative monooxygenase; Reviewed 98.48
COG0579429 Predicted dehydrogenase [General function predicti 98.47
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.46
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.45
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.44
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.44
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.44
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.44
PLN02661357 Putative thiazole synthesis 98.44
PRK065671028 putative bifunctional glutamate synthase subunit b 98.43
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.43
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.43
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.42
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.42
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.41
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.41
PRK05868372 hypothetical protein; Validated 98.41
PRK13977576 myosin-cross-reactive antigen; Provisional 98.4
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.4
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.4
PLN02612567 phytoene desaturase 98.4
PRK11728393 hydroxyglutarate oxidase; Provisional 98.39
PRK07190 487 hypothetical protein; Provisional 98.38
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.38
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.38
KOG0404|consensus322 98.37
PLN02487569 zeta-carotene desaturase 98.37
PRK11445351 putative oxidoreductase; Provisional 98.36
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.36
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.36
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.33
PRK06753373 hypothetical protein; Provisional 98.32
PLN02852491 ferredoxin-NADP+ reductase 98.31
PLN02661357 Putative thiazole synthesis 98.31
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.3
KOG0405|consensus478 98.3
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.3
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.3
KOG4716|consensus503 98.29
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.29
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.28
PRK07588391 hypothetical protein; Provisional 98.28
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.27
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.27
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.27
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.26
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.26
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.25
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.25
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.23
PLN02576496 protoporphyrinogen oxidase 98.23
PRK08294 634 phenol 2-monooxygenase; Provisional 98.2
KOG2404|consensus477 98.18
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.18
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.17
PRK05257494 malate:quinone oxidoreductase; Validated 98.17
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.17
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.16
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.16
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 98.16
PRK02106 560 choline dehydrogenase; Validated 98.16
KOG1399|consensus448 98.15
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.15
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.14
PRK12814652 putative NADPH-dependent glutamate synthase small 98.14
PLN02507499 glutathione reductase 98.12
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.11
KOG2960|consensus328 98.1
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.09
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.09
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.09
KOG2665|consensus453 98.08
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.08
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.08
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.07
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.07
PRK06116450 glutathione reductase; Validated 98.06
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.06
PLN02546558 glutathione reductase 98.06
PRK07236386 hypothetical protein; Provisional 98.06
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.04
KOG2820|consensus399 98.04
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.04
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.04
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.03
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.03
PRK06475400 salicylate hydroxylase; Provisional 98.03
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.03
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.02
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.01
PRK14694468 putative mercuric reductase; Provisional 98.0
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.99
KOG1336|consensus478 97.98
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.98
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.97
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.97
KOG2415|consensus 621 97.96
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.95
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.95
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.94
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.93
PRK12416463 protoporphyrinogen oxidase; Provisional 97.93
PRK07538413 hypothetical protein; Provisional 97.9
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.9
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.89
PTZ00367 567 squalene epoxidase; Provisional 97.88
PRK09897 534 hypothetical protein; Provisional 97.88
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.88
PTZ00058561 glutathione reductase; Provisional 97.88
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.87
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.86
PLN02464627 glycerol-3-phosphate dehydrogenase 97.86
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.85
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.85
PRK06370463 mercuric reductase; Validated 97.84
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 97.82
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.81
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.8
PRK13748561 putative mercuric reductase; Provisional 97.8
KOG2844|consensus 856 97.79
PRK10262321 thioredoxin reductase; Provisional 97.78
PRK10015429 oxidoreductase; Provisional 97.77
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.76
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.76
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.74
KOG2614|consensus420 97.73
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.73
PRK13984604 putative oxidoreductase; Provisional 97.73
PRK10157428 putative oxidoreductase FixC; Provisional 97.73
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.72
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.72
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.71
COG2081408 Predicted flavoproteins [General function predicti 97.71
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.7
PRK14727479 putative mercuric reductase; Provisional 97.7
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.69
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.69
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.68
TIGR02053463 MerA mercuric reductase. This model represents the 97.68
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.67
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.67
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.67
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.67
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.66
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.66
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.65
PLN02785 587 Protein HOTHEAD 97.65
PLN02463447 lycopene beta cyclase 97.65
COG3573 552 Predicted oxidoreductase [General function predict 97.65
PRK08274466 tricarballylate dehydrogenase; Validated 97.65
PLN02676487 polyamine oxidase 97.64
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.64
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.63
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.63
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.63
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.62
PRK09126392 hypothetical protein; Provisional 97.62
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.61
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.61
PRK07208479 hypothetical protein; Provisional 97.61
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 97.6
PRK08013400 oxidoreductase; Provisional 97.6
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.6
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.59
PRK06185407 hypothetical protein; Provisional 97.59
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.58
PRK07121492 hypothetical protein; Validated 97.57
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.57
KOG1399|consensus448 97.57
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.57
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 97.56
KOG1298|consensus509 97.55
PLN02568 539 polyamine oxidase 97.54
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.54
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.53
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.53
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.53
PRK07846451 mycothione reductase; Reviewed 97.52
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.52
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.5
PLN02697529 lycopene epsilon cyclase 97.5
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.49
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.48
PRK07045388 putative monooxygenase; Reviewed 97.48
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.48
PLN02985514 squalene monooxygenase 97.48
KOG4254|consensus561 97.48
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.45
PRK08244493 hypothetical protein; Provisional 97.45
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.45
PRK08163396 salicylate hydroxylase; Provisional 97.44
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.44
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.43
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.43
PRK06184502 hypothetical protein; Provisional 97.43
PRK06847375 hypothetical protein; Provisional 97.42
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.42
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.42
KOG1335|consensus506 97.41
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.41
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.4
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.4
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.39
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.39
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.39
KOG0029|consensus501 97.39
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.39
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.39
PRK07804541 L-aspartate oxidase; Provisional 97.39
KOG2311|consensus 679 97.38
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.38
PTZ00052499 thioredoxin reductase; Provisional 97.38
PRK07233434 hypothetical protein; Provisional 97.37
KOG2415|consensus621 97.37
PRK07236386 hypothetical protein; Provisional 97.36
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.36
PTZ00367567 squalene epoxidase; Provisional 97.35
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.35
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.34
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.34
PRK06126545 hypothetical protein; Provisional 97.33
PRK07190487 hypothetical protein; Provisional 97.33
KOG2852|consensus380 97.32
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 97.31
PRK06834488 hypothetical protein; Provisional 97.31
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.3
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.3
PRK12842574 putative succinate dehydrogenase; Reviewed 97.29
PRK08294634 phenol 2-monooxygenase; Provisional 97.28
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.26
PTZ00188506 adrenodoxin reductase; Provisional 97.26
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 97.26
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.26
PRK06753373 hypothetical protein; Provisional 97.25
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 97.24
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.24
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.24
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 97.24
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 97.22
PRK07588391 hypothetical protein; Provisional 97.22
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 97.21
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.2
PLN02268435 probable polyamine oxidase 97.19
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.18
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 97.18
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 97.18
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.17
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.17
PRK07538413 hypothetical protein; Provisional 97.15
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.15
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.15
PRK06996398 hypothetical protein; Provisional 97.15
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.14
PRK07395553 L-aspartate oxidase; Provisional 97.13
PRK11445351 putative oxidoreductase; Provisional 97.13
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 97.12
COG3349485 Uncharacterized conserved protein [Function unknow 97.12
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.12
PRK06175433 L-aspartate oxidase; Provisional 97.12
PRK05868372 hypothetical protein; Validated 97.11
PLN02576496 protoporphyrinogen oxidase 97.1
PLN02815594 L-aspartate oxidase 97.09
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.06
PRK08626657 fumarate reductase flavoprotein subunit; Provision 97.06
PRK08401466 L-aspartate oxidase; Provisional 97.05
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.04
PRK02106560 choline dehydrogenase; Validated 97.04
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 97.04
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.03
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 97.03
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.02
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.01
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 96.98
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.98
PRK06475400 salicylate hydroxylase; Provisional 96.96
PRK12839572 hypothetical protein; Provisional 96.96
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.94
PRK09231582 fumarate reductase flavoprotein subunit; Validated 96.93
PLN02529 738 lysine-specific histone demethylase 1 96.93
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.93
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.93
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 96.92
PRK13977576 myosin-cross-reactive antigen; Provisional 96.9
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.9
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 96.9
COG3573552 Predicted oxidoreductase [General function predict 96.89
PLN02568539 polyamine oxidase 96.88
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.87
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 96.86
PRK12416463 protoporphyrinogen oxidase; Provisional 96.85
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.82
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.8
PRK08275554 putative oxidoreductase; Provisional 96.79
COG3349485 Uncharacterized conserved protein [Function unknow 96.78
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 96.78
COG4529474 Uncharacterized protein conserved in bacteria [Fun 96.78
PLN02676487 polyamine oxidase 96.76
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.76
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 96.75
KOG4716|consensus503 96.74
PRK08071510 L-aspartate oxidase; Provisional 96.73
KOG1238|consensus 623 96.73
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 96.73
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.73
>KOG2853|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.6e-56  Score=436.88  Aligned_cols=423  Identities=54%  Similarity=0.953  Sum_probs=389.0

Q ss_pred             CCCcccEEEECCcHHHHHHHHHHHhhc-cCCCeEEEEecCCCCCCCcccccccccccccCceecccCcchhhHHHHHHHH
Q psy10285        241 FPTHVDILIIGGGAIGSSIAYFIKEKV-LDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAE  319 (673)
Q Consensus       241 ~~~~~~v~iiG~G~~g~~~A~~l~~~~-~~g~~v~~ie~~~~~~~~~~~~~~~st~~~~g~i~~~~~~~~~~~~~~~~~~  319 (673)
                      .+.+++|+|||||..|.++|++|.++. +.|.+|.++||+..       ..+.+|..+.|++.++|..+++.+++.++.+
T Consensus        83 f~~~~dVvIIGGG~~GsS~AfWLKer~rd~gl~VvVVErddt-------ytqssT~lSvGGi~QQFSlpEnIqmSLF~a~  155 (509)
T KOG2853|consen   83 FPYHCDVVIIGGGGSGSSTAFWLKERARDEGLNVVVVERDDT-------YTQSSTMLSVGGICQQFSLPENIQMSLFTAE  155 (509)
T ss_pred             cccccCEEEECCCccchhhHHHHHHHhhcCCceEEEEeccCc-------ccccceeeeecceeeecccchhhhhhhHHHH
Confidence            457899999999999999999998543 45799999999998       7899999999999999999999999999999


Q ss_pred             HHHHHHhhccccCCCCCCcceeecCeEEEeccchHHHHHHHHHHHHHcCCcceeeCHhhHHhhCCCCCcccceeEEeccC
Q psy10285        320 FLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLE  399 (673)
Q Consensus       320 ~~~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~g~~~~~  399 (673)
                      |++...+++.++..+..+..|.++|++.++++++.+.++...+.+.+.|...++++++++.+++||++.+.+..++++.+
T Consensus       156 Flr~a~ehl~~~d~~~vdl~f~P~GyL~LA~ee~ae~m~s~~kvQ~e~GAk~eLls~d~Lt~rfPwlntegVaLa~lG~e  235 (509)
T KOG2853|consen  156 FLRNAREHLGILDSEQVDLNFFPTGYLRLASEEEAEMMRSNSKVQNELGAKVELLSPDELTKRFPWLNTEGVALASLGVE  235 (509)
T ss_pred             HHHHHHHhhccccCCCCCcccCCCceEEEcchhhHHHHHHhHHHHHhhcchhcccCHHHHhhhCCcccccceeeeecccc
Confidence            99999999999999999999999999999998888999999999999999999999999999999999999999999999


Q ss_pred             CceeeCHHHHHHHHHHHHHHcCCeEEEeceeEEEecCCccccccCCCC---CCccceeeEEEEcCCCCeeEEecCEEEEc
Q psy10285        400 KEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDD---GEYHSVNECVVRDEKGELKTITFAICVIA  476 (673)
Q Consensus       400 ~~g~i~~~~~~~~l~~~~~~~Gv~i~~~~V~~i~~~~~~~~~~~~~~~---~~~~~v~gv~V~t~~G~~~~i~ad~VVlA  476 (673)
                      ++||+||..++..+.+.+...|+.+..++|+.++.+..--+|+-+-+.   .-+.++.++.|+.+++..+.++|+.+|+|
T Consensus       236 ~EGwfdpw~LLs~~rrk~~~lGv~f~~GeV~~Fef~sqr~v~~~tDd~t~~~~~~~i~~vvV~m~d~~~r~vk~al~V~a  315 (509)
T KOG2853|consen  236 KEGWFDPWALLSGIRRKAITLGVQFVKGEVVGFEFESQRAVHAFTDDGTAKLRAQRISGVVVRMNDALARPVKFALCVNA  315 (509)
T ss_pred             cccccCHHHHHHHHHHHhhhhcceEecceEEEEEEecccceeeecccchhhhhhcccceeEEecCchhcCceeEEEEEec
Confidence            999999999999999999999999999999999876321233322222   24557889999988887789999999999


Q ss_pred             CCCCcHHHHHHcCCCCCcccccccccccCcceeeeeEEEEeCCCCCCCCCCeEEcCCCceEEEecCCceEEecCCCCCCC
Q psy10285        477 AGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQ  556 (673)
Q Consensus       477 tG~~s~~l~~~~g~~~~~~~~~~~~~~lp~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~g~~i~G~~~~~~~  556 (673)
                      +|+|+.+++++.|+..+   .+....++|+.|.|.|++.+.+|+.|+++.|+++|+.++|+|+.+.++.+++|.++....
T Consensus       316 AGa~s~QvArlAgIG~g---~g~L~vplPiepRKRyvyvi~~~~~PGl~~Pl~iDpsG~f~Rrdglg~nfl~grsp~ed~  392 (509)
T KOG2853|consen  316 AGAWSGQVARLAGIGKG---PGLLAVPLPIEPRKRYVYVIFAPDVPGLDTPLTIDPSGVFFRRDGLGGNFLCGRSPSEDE  392 (509)
T ss_pred             cCccHHHHHHHhccCCC---CceeeecccCCccceeEEEEeCCCCCCCCCceeECCCccEEEecCCCCceecccCCcccc
Confidence            99999999999998744   355558999999999999999999999999999999999999999999999999988888


Q ss_pred             CCCCCCCCCChhHHHHhHHHHHhhhccccccccccceeeeeccCCCCCCCceeecCCCCCcEEEEEccCCccccchhHHH
Q psy10285        557 EPPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIG  636 (673)
Q Consensus       557 ~~~~~~~~~~~~~~~~~l~~~~~~~~P~l~~~~i~~~w~G~~~~~t~d~~Piig~~~~~~~l~~~~G~~g~G~~~ap~~g  636 (673)
                      .++..+++++++.+.+.++.++..++|.+..+++.+.|+|+++..|-|..++||++|-+.|+|+++||+|||+.++|++|
T Consensus       393 ~~d~~nldVD~d~F~qkiwP~L~nRVP~fetakVqsaWaGyyD~NtfD~ngViG~HP~y~Nly~atGFsghGvqqs~avg  472 (509)
T KOG2853|consen  393 EPDHSNLDVDHDYFYQKIWPHLANRVPAFETAKVQSAWAGYYDHNTFDDNGVIGEHPLYTNLYMATGFSGHGVQQSPAVG  472 (509)
T ss_pred             CCCccccccChHHHHhhhhHHHHhcccccceeeeeehhcccccccccccCCcccCCcceeeeeeeecccccchhcchHHH
Confidence            88888899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCCccCCccccccccccCccccccCCC
Q psy10285        637 RAVSELILDAEFKTIDLSRFLLERVARRQEAREVNIV  673 (673)
Q Consensus       637 ~~va~~i~~~~~~~~d~~~f~~~Rf~~~~~~~~~~~~  673 (673)
                      +.+||+|++|....+|+++|+.+|+...++..|.+||
T Consensus       473 RAiaElIldG~f~tidLsrf~f~Rlv~~qpi~E~n~v  509 (509)
T KOG2853|consen  473 RAIAELILDGAFITIDLSRFDFRRLVKMQPITEPNIV  509 (509)
T ss_pred             HHHHHHHhcCceeEEeccccchhHHhccCcccccccC
Confidence            9999999999998999999999999999999999997

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query673
1y56_B382 Crystal Structure Of L-Proline Dehydrogenase From P 2e-18
3vqr_A447 Structure Of A Dye-Linked L-Proline Dehydrogenase M 6e-07
3axb_A448 Structure Of A Dye-Linked L-Proline Dehydrogenase F 1e-06
3nye_A381 Crystal Structure Of Pseudomonas Aeruginosa D-Argin 6e-06
3m0o_A389 Crystal Structure Of The Lys265met Mutant Of Monome 2e-04
1el9_A389 Complex Of Monomeric Sarcosine Oxidase With The Inh 2e-04
1l9c_A389 Role Of Histidine 269 In Catalysis By Monomeric Sar 2e-04
3m12_A389 Crystal Structure Of The Lys265arg Phosphate-Crytsa 2e-04
3bhf_A390 Crystal Structure Of R49k Mutant Of Monomeric Sarco 2e-04
1el5_A389 Complex Of Monomeric Sarcosine Oxidase With The Inh 2e-04
1zov_A386 Crystal Structure Of Monomeric Sarcosine Oxidase Fr 4e-04
>pdb|1Y56|B Chain B, Crystal Structure Of L-Proline Dehydrogenase From P.Horikoshii Length = 382 Back     alignment and structure 
Iteration: 1

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 147/381 (38%), Gaps = 51/381 (13%)
Query: 270 GCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLRNIKHHCH 329
           G  V V+++ F            ST     G+RQQF+   N+ +     E  +       
Sbjct: 28  GEEVTVIEKRFI--------GSGSTFRCGTGIRQQFNDEANVRVMKRSVELWKKY----- 74
Query: 330 VIGEDEPDVNFTPNGYLFCASQDG-AATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNT 388
               +E   +F   GYLF    D    T ++N ++Q + G    L+ PE+ K   P L+ 
Sbjct: 75  ---SEEYGFSFKQTGYLFLLYDDEEVKTFKRNIEIQNKFGVPTKLITPEEAKEIVPLLDI 131
Query: 389 DDIALACLGLEKEGWFDPWLYLNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDG 448
            ++  A      +G  DP+    A   KA   GA+ +    V      NN++        
Sbjct: 132 SEVIAASWN-PTDGKADPFEATTAFAVKAKEYGAKLLEYTEVKGFLIENNEIK------- 183
Query: 449 EYHSVNECVVRDEKGELKTITFAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEP 508
                    V+  KG +KT    I V A  A++  +  M  I  K          +P+EP
Sbjct: 184 --------GVKTNKGIIKT---GIVVNATNAWANLINAMAGIKTK----------IPIEP 222
Query: 509 RKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVDNLDVDYE 568
            K        P   G   PMVI  +  Y        ++         +  P  +L   YE
Sbjct: 223 YKHQA-VITQPIKRGTINPMVI--SFKYGHAYLTQTFHGGIIGGIGYEIGPTYDLTPTYE 279
Query: 569 YFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHG 628
           +  E  + +    + A + L +   WAGYY     D N  IG     ++ + A GFSGHG
Sbjct: 280 FLREVSY-YFTKIIPALKNLLILRTWAGYYA-KTPDSNPAIGRIEELNDYYIAAGFSGHG 337
Query: 629 IQQAPAIGRAVSELILDAEFK 649
              APA+G  V+ELI   + K
Sbjct: 338 FMMAPAVGEMVAELITKGKTK 358
>pdb|3VQR|A Chain A, Structure Of A Dye-Linked L-Proline Dehydrogenase Mutant From The Aerobic Hyperthermophilic Archaeon, Aeropyrum Pernix Length = 447 Back     alignment and structure
>pdb|3AXB|A Chain A, Structure Of A Dye-Linked L-Proline Dehydrogenase From The Aerobic Hyperthermophilic Archaeon, Aeropyrum Pernix Length = 448 Back     alignment and structure
>pdb|3NYE|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa D-Arginine Dehydrogenase In Complex With Imino-Arginine Length = 381 Back     alignment and structure
>pdb|3M0O|A Chain A, Crystal Structure Of The Lys265met Mutant Of Monomeric Sarcosine Oxidase Length = 389 Back     alignment and structure
>pdb|1EL9|A Chain A, Complex Of Monomeric Sarcosine Oxidase With The Inhibitor [methylthio]acetate Length = 389 Back     alignment and structure
>pdb|1L9C|A Chain A, Role Of Histidine 269 In Catalysis By Monomeric Sarcosine Oxidase Length = 389 Back     alignment and structure
>pdb|3M12|A Chain A, Crystal Structure Of The Lys265arg Phosphate-Crytsallized Mu Monomeric Sarcosine Oxidase Length = 389 Back     alignment and structure
>pdb|3BHF|A Chain A, Crystal Structure Of R49k Mutant Of Monomeric Sarcosine Oxidase Crystallized In Peg As Precipitant Length = 390 Back     alignment and structure
>pdb|1EL5|A Chain A, Complex Of Monomeric Sarcosine Oxidase With The Inhibitor Dimethylglycine Length = 389 Back     alignment and structure
>pdb|1ZOV|A Chain A, Crystal Structure Of Monomeric Sarcosine Oxidase From Bacillus Sp. Ns- 129 Length = 386 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query673
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 1e-129
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 1e-07
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 2e-98
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 5e-06
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 2e-65
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 2e-05
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 6e-64
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 3e-05
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 2e-59
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 1e-04
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 2e-59
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 1e-05
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 1e-58
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 2e-05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 3e-56
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 5e-05
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 6e-52
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 4e-07
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 2e-23
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 7e-21
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3dme_A369 Conserved exported protein; structural genomics, P 1e-08
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 1e-06
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 7e-06
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 6e-05
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 1e-04
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 8e-04
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
 Score =  387 bits (995), Expect = e-129
 Identities = 80/455 (17%), Positives = 155/455 (34%), Gaps = 65/455 (14%)

Query: 242 PTHVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGL 301
               D +++G G +G + AY++K     G  V VVD                +  S+   
Sbjct: 21  MPRFDYVVVGAGVVGLAAAYYLKV--WSGGSVLVVDAGHA-------PGSGDSGRSMAAF 71

Query: 302 RQQFSLRENIEMSLFGAEFLRNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNH 361
           R  FS   N  ++        + +           D+    +GYLF   ++    +E+  
Sbjct: 72  RTFFSSTMNRLVAGSTVRLFEDAQ-------RGGEDLGLVKSGYLFVYDRERWREVEEPL 124

Query: 362 QLQKELGAKNVLLGPEQLKAKFPW------------LNTDDIALACLGLEKEGWFDPWLY 409
           +   E G   +++ PE+L+ +               L   D+    + +   G+ D    
Sbjct: 125 REAGEEGRDYLIIPPEELERRLGMNTRVSDGEEAEVLGVGDVE-GAVLIRSAGFLDAEKV 183

Query: 410 LNAVKKKAISLGAEYVRGEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTIT 469
           ++   ++A   G E++ G  V  +  +         +   +            G    + 
Sbjct: 184 VDYYYRRASGAGVEFIFGRRVVGVELKPRVELGIEGEPLPWQEARASAAVLSDGTRVEVG 243

Query: 470 FAICVIAAGAYSGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGP------- 522
             + V+AAG +S ++   L I                 P+KR V+   +           
Sbjct: 244 EKL-VVAAGVWSNRLLNPLGI------------DTFSRPKKRMVFRVSASTEGLRRIMRE 290

Query: 523 -----GVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPVD-NLDVDYEYFNENVWP 576
                    P++I       R       +    S    +   ++ +   +  Y++  + P
Sbjct: 291 GDLAGAGAPPLIILPKRVLVRPAPREGSFWVQLSDNLGRPFALEEDPQPEEHYYSLAILP 350

Query: 577 HLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIG 636
            L+  +  F++   S  WAG+YD + FD N ++   P    I  A G SG GI ++ +IG
Sbjct: 351 ILSLYLPQFQDAYPSGGWAGHYDIS-FDANPVVF-EPWESGIVVAAGTSGSGIMKSDSIG 408

Query: 637 RAVSELILDAEFKT--------IDLSRFLLERVAR 663
           R  + + L  E           +        R  +
Sbjct: 409 RVAAAVALGMESVELYGGVEMPVKWMGLEGRRYEQ 443
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Length = 676 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Length = 689 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query673
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 100.0
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 100.0
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 100.0
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 100.0
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 100.0
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 100.0
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 100.0
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 100.0
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 100.0
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 100.0
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 100.0
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 100.0
3dme_A369 Conserved exported protein; structural genomics, P 100.0
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.97
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.96
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.96
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.94
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.93
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.91
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.41
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.38
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.34
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.34
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.33
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.33
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.32
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.32
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.32
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.31
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.3
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.29
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.28
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.27
4dna_A463 Probable glutathione reductase; structural genomic 99.26
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.25
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.25
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.25
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.25
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.25
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.24
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.24
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.24
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.23
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.23
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.23
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 99.22
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.21
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.21
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.21
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.2
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.2
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.2
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.2
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.2
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.19
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.19
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.19
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.19
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.18
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.18
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.17
3atr_A 453 Conserved archaeal protein; saturating double bond 99.17
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.17
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.16
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.16
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.16
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.15
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.15
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.15
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.15
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.15
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.14
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.14
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.12
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.12
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.12
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.11
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.11
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.11
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.11
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.1
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.1
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.09
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.09
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.09
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.09
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.09
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.07
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.07
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.07
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.06
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.06
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.06
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.06
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.05
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.04
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.04
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.03
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.03
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.03
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.02
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.01
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.01
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.01
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.0
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.99
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.97
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.96
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.95
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.95
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.93
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.91
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.91
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.91
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.9
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.9
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.9
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.89
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.89
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.88
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.86
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.86
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.86
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.84
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.84
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.82
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.81
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.81
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.8
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.78
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.73
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 98.73
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.73
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.72
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.71
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.65
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.65
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.64
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.61
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.61
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.61
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.61
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.6
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.6
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.58
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.57
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.56
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.55
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.55
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.54
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.54
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.53
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.52
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.51
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.48
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.48
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.47
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.46
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.45
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.43
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.43
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.43
2cul_A232 Glucose-inhibited division protein A-related PROT 98.42
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.41
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.4
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.4
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.4
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.4
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.36
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.36
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.35
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.34
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.33
3dme_A369 Conserved exported protein; structural genomics, P 98.33
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.33
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.31
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.31
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.3
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.3
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.29
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.29
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.28
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.25
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.25
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.25
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.25
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.24
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.24
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.24
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.23
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 98.22
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.22
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.22
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.21
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.2
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.2
2bry_A497 NEDD9 interacting protein with calponin homology a 98.2
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.16
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.15
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.15
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.14
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 98.12
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.12
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.11
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.11
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.09
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.09
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.08
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.06
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.05
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.04
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.04
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.04
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.03
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.02
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.02
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.99
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.99
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.99
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.99
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.98
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.97
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.97
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.96
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 97.94
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.92
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.91
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.9
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.9
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.89
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.87
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.85
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.85
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.85
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.84
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.83
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.83
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.82
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.81
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.81
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.81
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.8
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.8
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 97.79
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.78
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.78
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.78
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.77
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.77
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.76
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.76
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.75
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.75
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.75
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.75
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.74
4dna_A463 Probable glutathione reductase; structural genomic 97.74
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.74
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.73
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.73
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.73
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.72
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.72
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.71
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.69
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.69
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.69
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.68
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.66
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.65
2cul_A232 Glucose-inhibited division protein A-related PROT 97.65
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.65
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.64
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.61
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.61
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.61
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.61
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.6
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.6
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.6
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.59
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.59
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.58
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.58
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.57
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.57
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.57
3atr_A453 Conserved archaeal protein; saturating double bond 97.57
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.56
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.55
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.55
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.54
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.53
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.52
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.52
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.52
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.52
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.51
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.51
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.51
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.51
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.5
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.5
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.49
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.48
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.48
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 97.47
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.47
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.47
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.46
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.46
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.46
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.45
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.45
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.44
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.44
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.43
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.43
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.43
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 97.43
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.42
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 97.42
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.42
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.42
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.41
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.4
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.4
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.39
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.37
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.37
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.36
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.36
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.34
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.34
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.33
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.33
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.32
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.32
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.31
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.31
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.31
2bry_A497 NEDD9 interacting protein with calponin homology a 97.3
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.3
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.29
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.26
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.25
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.25
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.24
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.24
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 97.24
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.22
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.22
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 97.21
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.2
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.19
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.19
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.19
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.18
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.17
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.16
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.15
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.15
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.13
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.13
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.12
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.1
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.1
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.06
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.02
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.02
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.02
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.99
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.99
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 96.97
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 96.92
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.91
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.83
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.8
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.72
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.71
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.7
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.69
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.67
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.64
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 96.58
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.54
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.48
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 96.44
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.43
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 96.42
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 96.42
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 96.41
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 96.32
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.26
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.24
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.16
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.12
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 96.09
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.08
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 95.96
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 95.93
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.92
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 95.63
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 95.13
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.07
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 94.98
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 94.83
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.76
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 94.76
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 94.69
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 94.48
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 94.31
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.3
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 94.23
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 94.17
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 94.1
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.09
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.07
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 94.01
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 93.81
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 93.39
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.03
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.95
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 92.81
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.6
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.41
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.26
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 92.02
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 91.85
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 91.72
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.51
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.07
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 90.75
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.55
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.41
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 90.2
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.15
3c85_A183 Putative glutathione-regulated potassium-efflux S 89.29
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.91
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 88.24
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 88.09
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.07
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.0
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 87.99
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.46
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 87.42
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 87.19
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 87.03
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 86.89
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 86.6
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 86.59
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 86.57
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 86.32
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 86.28
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 86.24
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 86.06
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 85.7
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 85.29
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 85.22
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 85.05
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 85.0
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 84.86
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 84.84
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 84.83
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 84.75
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 84.74
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 84.69
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 84.53
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 84.46
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.28
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 84.03
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 83.65
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 83.54
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 83.52
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 83.47
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 83.37
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 83.33
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 83.27
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 83.14
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 83.08
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 82.94
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 82.78
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 82.69
4g65_A461 TRK system potassium uptake protein TRKA; structur 82.65
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 82.54
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 82.53
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 82.49
3tl2_A315 Malate dehydrogenase; center for structural genomi 82.48
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 82.43
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 82.4
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 82.35
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 82.19
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 82.04
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 81.99
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 81.89
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 81.68
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 81.68
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
Probab=100.00  E-value=4e-40  Score=355.57  Aligned_cols=373  Identities=28%  Similarity=0.420  Sum_probs=295.6

Q ss_pred             CcccEEEECCcHHHHHHHHHHHhhccCCCeEEEEecCCCCCCCcccccccccccccCceecccCcchhhHHHHHHHHHHH
Q psy10285        243 THVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFSLRENIEMSLFGAEFLR  322 (673)
Q Consensus       243 ~~~~v~iiG~G~~g~~~A~~l~~~~~~g~~v~~ie~~~~~~~~~~~~~~~st~~~~g~i~~~~~~~~~~~~~~~~~~~~~  322 (673)
                      ..+||+|||+|++|+++|++|+   +.|.+|+|+|+...        +.+++..+.|.++..+.......+...+.++|+
T Consensus         4 ~~~dVvIIGgGi~Gl~~A~~La---~~G~~V~lle~~~~--------~~gas~~~~g~~~~~~~~~~~~~l~~~~~~~~~   72 (382)
T 1y56_B            4 EKSEIVVIGGGIVGVTIAHELA---KRGEEVTVIEKRFI--------GSGSTFRCGTGIRQQFNDEANVRVMKRSVELWK   72 (382)
T ss_dssp             SBCSEEEECCSHHHHHHHHHHH---HTTCCEEEECSSST--------TCSHHHHCCCCCCCCCSSHHHHHHHHHHHHHHH
T ss_pred             CcCCEEEECCCHHHHHHHHHHH---HCCCeEEEEeCCCC--------CCCccccccCeeeecCCChHHHHHHHHHHHHHH
Confidence            4589999999999999999999   78999999999866        566777788888877777666777788888888


Q ss_pred             HHHhhccccCCCCCCcceeecCeEEEe-ccchHHHHHHHHHHHHHcCCcceeeCHhhHHhhCCCCCcccceeEEeccCCc
Q psy10285        323 NIKHHCHVIGEDEPDVNFTPNGYLFCA-SQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKE  401 (673)
Q Consensus       323 ~l~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~~~~l~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~g~~~~~~~  401 (673)
                      .+.+...      .  .+...|.+... ++...+.+....+.+++.|.+.++++++++.+.+|.+....+..+.+ .+.+
T Consensus        73 ~l~~~~~------~--~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~~~~-~~~~  143 (382)
T 1y56_B           73 KYSEEYG------F--SFKQTGYLFLLYDDEEVKTFKRNIEIQNKFGVPTKLITPEEAKEIVPLLDISEVIAASW-NPTD  143 (382)
T ss_dssp             HHHHHHT------C--CEECCCEEEEECSHHHHHHHHHHHHHHHHTTCCCEEECHHHHHHSSTTCCCTTCCEEEE-ETTC
T ss_pred             HHHHHhC------C--CeeccceEEEEeCHHHHHHHHHHHHHHHhcCCCcEEeCHHHHHHhCCCCCcccceEEEE-cCCC
Confidence            8876554      2  56778888887 66667777788888888999999999999999899876545555666 6889


Q ss_pred             eeeCHHHHHHHHHHHHHHcCCeEEE-eceeEEEecCCccccccCCCCCCccceeeEEEEcCCCCeeEEecCEEEEcCCCC
Q psy10285        402 GWFDPWLYLNAVKKKAISLGAEYVR-GEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAY  480 (673)
Q Consensus       402 g~i~~~~~~~~l~~~~~~~Gv~i~~-~~V~~i~~~~~~~~~~~~~~~~~~~~v~gv~V~t~~G~~~~i~ad~VVlAtG~~  480 (673)
                      ++++|..++..|.+.+++.|++++. ++|++|+.++              +++.+  |++.+|   +++||.||+|+|.|
T Consensus       144 ~~~~~~~l~~~l~~~~~~~Gv~i~~~~~v~~i~~~~--------------~~v~g--v~~~~g---~i~a~~VV~A~G~~  204 (382)
T 1y56_B          144 GKADPFEATTAFAVKAKEYGAKLLEYTEVKGFLIEN--------------NEIKG--VKTNKG---IIKTGIVVNATNAW  204 (382)
T ss_dssp             CEECHHHHHHHHHHHHHHTTCEEECSCCEEEEEESS--------------SBEEE--EEETTE---EEECSEEEECCGGG
T ss_pred             eeECHHHHHHHHHHHHHHCCCEEECCceEEEEEEEC--------------CEEEE--EEECCc---EEECCEEEECcchh
Confidence            9999999999999999999999996 5999999876              33444  777777   79999999999999


Q ss_pred             cHHHHHHcCCCCCcccccccccccCcceeeeeEEEEeCCCCCCCCCCeEEcC--CCceEEEecCCceEEec-CCCCCCCC
Q psy10285        481 SGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDT--TGTYFRREGLGNYYICG-KSPTPEQE  557 (673)
Q Consensus       481 s~~l~~~~g~~~~~~~~~~~~~~lp~~~~r~~~~~~~~~~~~~~~~~~~~~~--~~~y~~~~~~~g~~i~G-~~~~~~~~  557 (673)
                      +..|++.+++.          ..+|+.+.+++++.++... +....+++++.  ...|++|..+ + +++| .+......
T Consensus       205 s~~l~~~~g~~----------~~~~~~~~~g~~~~~~~~~-~~~~~~~~~~~~~~~~y~~p~~~-g-~~iG~~~~~~~~~  271 (382)
T 1y56_B          205 ANLINAMAGIK----------TKIPIEPYKHQAVITQPIK-RGTINPMVISFKYGHAYLTQTFH-G-GIIGGIGYEIGPT  271 (382)
T ss_dssp             HHHHHHHHTCC----------SCCCCEEEEEEEEEECCCS-TTSSCSEEEESTTTTEEEECCSS-S-CCEEECSCCBSSC
T ss_pred             HHHHHHHcCCC----------cCcCCCeeEeEEEEEccCC-cccCCCeEEecCCCeEEEEEeCC-e-EEEecCCCCCCCC
Confidence            99998877642          0168899999988876432 22223666654  4789999864 5 5444 32221111


Q ss_pred             CCCCCCCCChhHHHHhHHHHHhhhccccccccccceeeeeccCCCCCCCceeecCCCCCcEEEEEccCCccccchhHHHH
Q psy10285        558 PPVDNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGR  637 (673)
Q Consensus       558 ~~~~~~~~~~~~~~~~l~~~~~~~~P~l~~~~i~~~w~G~~~~~t~d~~Piig~~~~~~~l~~~~G~~g~G~~~ap~~g~  637 (673)
                      .   +...+.+. .+.+++.+.++||.+.+.++...|+|+|+. |+|+.|+||++|..+|+|+++||+|+||+++|++|+
T Consensus       272 ~---~~~~~~~~-~~~l~~~~~~~~p~l~~~~~~~~~~g~r~~-t~d~~p~ig~~~~~~~~~~~~G~~g~G~~~a~~~g~  346 (382)
T 1y56_B          272 Y---DLTPTYEF-LREVSYYFTKIIPALKNLLILRTWAGYYAK-TPDSNPAIGRIEELNDYYIAAGFSGHGFMMAPAVGE  346 (382)
T ss_dssp             C---CCCCCHHH-HHHHHHHHHHHCGGGGGSEEEEEEEEEEEE-CTTSCCEEEEESSSBTEEEEECCTTCHHHHHHHHHH
T ss_pred             C---CCCCCHHH-HHHHHHHHHHhCCCcCCCCceEEEEecccc-CCCCCcEeccCCCCCCEEEEEecCcchHhhhHHHHH
Confidence            1   12233344 488889999999999988999999999996 999999999999889999999999999999999999


Q ss_pred             HHHHHHHcCCCCccCCccccccccccCccccccCCC
Q psy10285        638 AVSELILDAEFKTIDLSRFLLERVARRQEAREVNIV  673 (673)
Q Consensus       638 ~va~~i~~~~~~~~d~~~f~~~Rf~~~~~~~~~~~~  673 (673)
                      .+|++|.++. +..+++.|+|+||..++++.|.+|+
T Consensus       347 ~la~~i~~~~-~~~~~~~~~~~Rf~~~~~~~~~~~~  381 (382)
T 1y56_B          347 MVAELITKGK-TKLPVEWYDPYRFERGELRTAALQM  381 (382)
T ss_dssp             HHHHHHHHSS-CSSCGGGGCGGGTTTTCCC------
T ss_pred             HHHHHHhCCC-CcCcccccCHhhhccCCCCCccccC
Confidence            9999999887 4567899999999999999999875
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 673
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-12
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-10
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 8e-07
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 7e-11
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 4e-04
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 8e-11
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 1e-09
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 3e-09
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-06
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 5e-09
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 7e-05
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 5e-04
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 6e-04
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 5e-04
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.003
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 6e-04
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 6e-04
d2g5ca2171 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA { 8e-04
d2g5ca2171 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA { 8e-04
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.002
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.003
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 0.002
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.002
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.002
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 0.003
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 0.003
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 0.003
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 0.003
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 0.004
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 0.004
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.004
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.004
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Sarcosine oxidase
species: Bacillus sp., strain b0618 [TaxId: 1409]

 Score = 66.7 bits (161), Expect = 1e-12
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 591 SNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVSELILDAEFKT 650
           ++      + +  DE+ II LHP + N+  A GFSGHG + +  +G  +S+L L  + + 
Sbjct: 205 NSKLLSKLNLDIPDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTE- 263

Query: 651 IDLSRFLLERVARRQ 665
            D+S F + R A ++
Sbjct: 264 HDISIFSINRPALKE 278
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Length = 171 Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Length = 171 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query673
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.96
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.95
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.93
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.54
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 99.52
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.5
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.44
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.4
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.18
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.16
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.08
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.06
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.04
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.95
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.89
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.85
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.78
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.77
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.77
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.69
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.65
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.62
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.56
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.55
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.54
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.53
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.51
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.5
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.5
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.47
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.42
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.42
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.38
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.36
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.36
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.35
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.35
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.33
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.32
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.32
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.32
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.32
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.32
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.31
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.29
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.28
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.28
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.27
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 98.27
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.26
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.25
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.25
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.23
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.23
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.23
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.22
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.21
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.2
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.19
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.18
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.18
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.18
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.18
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.17
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.16
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.16
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 98.15
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.15
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.13
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.13
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.11
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.11
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.1
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.08
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.07
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.06
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.06
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.05
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.05
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.04
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.04
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.02
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.01
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.01
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.01
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.01
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.99
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.98
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.97
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.97
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.95
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.93
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.92
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.91
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.91
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.89
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.85
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.85
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.84
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.82
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.82
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.82
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.82
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.81
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.79
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.77
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.76
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.76
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.72
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.7
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.69
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.69
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.68
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.67
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.64
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.61
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.57
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.56
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.55
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.55
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.51
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.5
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.48
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.48
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.47
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.45
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.41
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.36
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.34
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.31
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.3
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.27
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.21
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.21
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.2
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.2
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.2
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.14
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.1
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.06
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.05
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.05
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.03
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.03
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.92
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.84
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.84
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.8
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 96.79
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.71
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.65
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.63
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.63
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.62
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.62
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.61
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.59
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.55
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.49
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.47
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.45
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.43
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.33
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 96.33
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.3
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 96.18
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.14
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.14
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.11
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.1
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.03
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.88
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.79
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 95.78
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.76
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.61
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.6
d1pj5a3119 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.6
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.48
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.41
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.36
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 95.32
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.21
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.15
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.12
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.88
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.69
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.48
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.4
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.39
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.34
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.34
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.27
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.17
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.08
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.97
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.95
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.91
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.54
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.45
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.27
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.21
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.15
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 92.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.94
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.91
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.51
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.41
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.35
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.77
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.4
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.21
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.09
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.82
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.78
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.71
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 90.67
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.65
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 90.38
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 90.35
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.29
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.26
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 90.0
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 89.4
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.38
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 89.38
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 89.28
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.87
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.69
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 88.64
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 88.49
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 88.4
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 88.39
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 88.38
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.28
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 88.24
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 88.22
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.16
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 87.85
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 87.75
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 87.59
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 87.44
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.4
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.37
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.0
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 86.82
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.5
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 86.34
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 86.12
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 85.87
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.18
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.09
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.05
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.95
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.88
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.72
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 84.35
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 84.25
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.24
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 83.92
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 83.86
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 83.85
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.78
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 83.56
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 83.54
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 83.51
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 83.49
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.4
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.31
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.06
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 83.05
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 82.84
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 82.68
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.55
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 82.52
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 82.42
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 82.41
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 82.34
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.09
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 82.06
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 81.93
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 81.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 81.81
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 81.78
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 81.68
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 81.43
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 81.37
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 81.2
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 80.87
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.39
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 80.23
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Sarcosine oxidase
species: Bacillus sp., strain b0618 [TaxId: 1409]

Probab=99.96  E-value=1.5e-28  Score=250.93  Aligned_cols=276  Identities=24%  Similarity=0.379  Sum_probs=219.2

Q ss_pred             CcccEEEECCcHHHHHHHHHHHhhccCCCeEEEEecCCCCCCCcccccccccccccCceecccC-cchhhHHHHHHHHHH
Q psy10285        243 THVDILIIGGGAIGSSIAYFIKEKVLDGCRVAVVDRDFTVNYDLDEYARASTTLSVGGLRQQFS-LRENIEMSLFGAEFL  321 (673)
Q Consensus       243 ~~~~v~iiG~G~~g~~~A~~l~~~~~~g~~v~~ie~~~~~~~~~~~~~~~st~~~~g~i~~~~~-~~~~~~~~~~~~~~~  321 (673)
                      .++||+|||||++|+++|++|+   ++|.+|+|||+....      ...+++....+.++..+. .....++...+.++|
T Consensus         2 ~~yDvvIIGaGi~Gls~A~~La---~~G~~V~viE~~~~~------~~~~s~~~~~~~~~~~~~~~~~~~~l~~~s~~~~   72 (281)
T d2gf3a1           2 THFDVIVVGAGSMGMAAGYQLA---KQGVKTLLVDAFDPP------HTNGSHHGDTRIIRHAYGEGREYVPLALRSQELW   72 (281)
T ss_dssp             CCEEEEEECCSHHHHHHHHHHH---HTTCCEEEECSSCSS------CSSSSSCSSEEEECSSCTTCGGGHHHHHHHHHHH
T ss_pred             CcCCEEEECcCHHHHHHHHHHH---HCCCcEEEEeCCCCC------CcccccCCCcceeecccCCcchhhhhccccccee
Confidence            5799999999999999999999   889999999997761      123333333444444443 345567788888999


Q ss_pred             HHHHhhccccCCCCCCcceeecCeEEEeccchHHHHHHHHHHHHHcCCcceeeCHhhHHhhCCCCCcccceeEEeccCCc
Q psy10285        322 RNIKHHCHVIGEDEPDVNFTPNGYLFCASQDGAATLEKNHQLQKELGAKNVLLGPEQLKAKFPWLNTDDIALACLGLEKE  401 (673)
Q Consensus       322 ~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~g~~~~~~~  401 (673)
                      +.+.++..      .++ +...|.+......+...+++..+..+..+.+.+.++.+++.+.+|.+..+....+.+ .+.+
T Consensus        73 ~~l~~e~~------~~~-~~~~g~l~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~e~~~~~p~~~~~~~~~~~~-~~~~  144 (281)
T d2gf3a1          73 YELEKETH------HKI-FTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENYNAIF-EPNS  144 (281)
T ss_dssp             HHHHHHCS------SCC-EECCCEEEEEETTCCHHHHHHHHHHHHTTCCCEEEETHHHHHHSTTCCCCTTEEEEE-ETTC
T ss_pred             ecchhhhh------hcc-ccccceeeeeecchhhhhhhhhhhhccccchhhhhhhHhhhhhhhcccccccceeee-cccc
Confidence            88877654      443 667788777644444567777888889999999999999999999988766665665 6889


Q ss_pred             eeeCHHHHHHHHHHHHHHcCCeEEE-eceeEEEecCCccccccCCCCCCccceeeEEEEcCCCCeeEEecCEEEEcCCCC
Q psy10285        402 GWFDPWLYLNAVKKKAISLGAEYVR-GEVVDFLRRRNNQVHYEGYDDGEYHSVNECVVRDEKGELKTITFAICVIAAGAY  480 (673)
Q Consensus       402 g~i~~~~~~~~l~~~~~~~Gv~i~~-~~V~~i~~~~~~~~~~~~~~~~~~~~v~gv~V~t~~G~~~~i~ad~VVlAtG~~  480 (673)
                      ++++|..++..|.+.+++.|++++. ++|++|+.+++                 ++.|.|++|   +++||.||+|+|+|
T Consensus       145 g~~~p~~~~~~l~~~a~~~Gv~i~~~~~V~~i~~~~~-----------------~v~V~t~~g---~i~a~~VViAaG~~  204 (281)
T d2gf3a1         145 GVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPD-----------------SVKIETANG---SYTADKLIVSMGAW  204 (281)
T ss_dssp             EEEEHHHHHHHHHHHHHHTTCEEECSCCEEEEEECSS-----------------CEEEEETTE---EEEEEEEEECCGGG
T ss_pred             ccccccccccccccccccccccccCCcEEEEEEEECC-----------------EEEEEECCc---EEEcCEEEECCCCc
Confidence            9999999999999999999999995 69999998875                 577999988   79999999999999


Q ss_pred             cHHHHHHcCCCCCcccccccccccCcceeeeeEEEEeCCCCCCCCCCeEEcCCCceEEEecCCceEEecCCCCCCCCCCC
Q psy10285        481 SGQVARMLKIGDKNQEQGFLFVPLPVEPRKRYVYCFESPRGPGVNTPMVIDTTGTYFRREGLGNYYICGKSPTPEQEPPV  560 (673)
Q Consensus       481 s~~l~~~~g~~~~~~~~~~~~~~lp~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~g~~i~G~~~~~~~~~~~  560 (673)
                      +..|++++|+.            +                                                        
T Consensus       205 s~~l~~~lg~~------------~--------------------------------------------------------  216 (281)
T d2gf3a1         205 NSKLLSKLNLD------------I--------------------------------------------------------  216 (281)
T ss_dssp             HHHHGGGGTEE------------C--------------------------------------------------------
T ss_pred             chhhHHhcCCc------------c--------------------------------------------------------
Confidence            99998765421            0                                                        


Q ss_pred             CCCCCChhHHHHhHHHHHhhhccccccccccceeeeeccCCCCCCCceeecCCCCCcEEEEEccCCccccchhHHHHHHH
Q psy10285        561 DNLDVDYEYFNENVWPHLAHRVKAFEELKVSNAWAGYYDFNYFDENAIIGLHPSYHNIHFATGFSGHGIQQAPAIGRAVS  640 (673)
Q Consensus       561 ~~~~~~~~~~~~~l~~~~~~~~P~l~~~~i~~~w~G~~~~~t~d~~Piig~~~~~~~l~~~~G~~g~G~~~ap~~g~~va  640 (673)
                                                                ++..+.++..|..++++++.|++||||.++|..|+.++
T Consensus       217 ------------------------------------------~~~~~~~~~~P~~~~~~~~~g~~g~g~~~~p~~G~~~~  254 (281)
T d2gf3a1         217 ------------------------------------------PDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLS  254 (281)
T ss_dssp             ------------------------------------------CTSCCEEEEETTEEEEEEEECCTTCCGGGHHHHHHHHH
T ss_pred             ------------------------------------------ccccceeccccCCCCEEEEeccCCcccccChhHHHHHH
Confidence                                                      01122344445567889999999999999999999999


Q ss_pred             HHHHcCCCCccCCccccccccccCcc
Q psy10285        641 ELILDAEFKTIDLSRFLLERVARRQE  666 (673)
Q Consensus       641 ~~i~~~~~~~~d~~~f~~~Rf~~~~~  666 (673)
                      +++..+. ++.|++.|+++|+.-++-
T Consensus       255 ~~~~~~~-~~~d~~~f~~~R~~~~~~  279 (281)
T d2gf3a1         255 QLALTGK-TEHDISIFSINRPALKES  279 (281)
T ss_dssp             HHHHHSC-CSSCCGGGCTTCGGGTCE
T ss_pred             HHHhcCC-CCCCchhhCCCCccchhc
Confidence            9999888 568999999999986553
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure