Psyllid ID: psy10294


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MGPGFNSSFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAKSKQYRMSSNNNSEFLTQ
cccccccccccHHccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHEEccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccc
ccccccccHcEEEEEcHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHEHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHccccEEcccccccHccc
mgpgfnssfvsmRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLtvnkfgkrpmslwstGICFVFTIALAICSmnlhwpgwiplTIFCICFWisgygilalpwmlmseifpvRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTktyigidwhRYYWRVVLAKSKQyrmssnnnsefltq
mgpgfnssFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAKskqyrmssnnnsefltq
MGPGFNSSFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAKSKQYRMSSNNNSEFLTQ
********FVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAK*****************
MGPGFNSSFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLV*************************************
MGPGFNSSFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAKSKQYRMSSNNNSEFLTQ
****FNSSFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAKSKQYRM***********
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPGFNSSFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRIRGVACGICAAINSIVCFLVTKTYIGIDWHRYYWRVVLAKSKQYRMSSNNNSEFLTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q17NV8806 Facilitated trehalose tra N/A N/A 0.685 0.192 0.288 1e-16
B4LPX5911 Facilitated trehalose tra N/A N/A 0.659 0.163 0.285 2e-15
B3MG58866 Facilitated trehalose tra N/A N/A 0.659 0.172 0.291 4e-15
B4QBN2857 Facilitated trehalose tra N/A N/A 0.659 0.173 0.285 5e-15
Q291H8868 Facilitated trehalose tra yes N/A 0.659 0.171 0.279 6e-15
B4GAP7869 Facilitated trehalose tra N/A N/A 0.659 0.171 0.279 6e-15
B4P624856 Facilitated trehalose tra N/A N/A 0.659 0.174 0.279 7e-15
B4KR05863 Facilitated trehalose tra N/A N/A 0.659 0.172 0.267 2e-14
B4HNS0857 Facilitated trehalose tra N/A N/A 0.659 0.173 0.279 3e-14
B3NSE1856 Facilitated trehalose tra N/A N/A 0.659 0.174 0.279 7e-14
>sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 8/163 (4%)

Query: 15  YLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIA- 73
           Y V+IFQ  G  +      ++ GV+    + ++++ +++ G R M L+ + +  + T+  
Sbjct: 607 YTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATMLIDRLG-RKMLLYISDVAMIITLMT 665

Query: 74  ------LAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGIC 127
                 +     ++   GW+PL  F I       G   +PW++M EI P +IRG A  + 
Sbjct: 666 LGGFFYVKNSGQDVSQVGWLPLAAFVIYVLGFSLGFGPIPWLMMGEILPGKIRGSAASVA 725

Query: 128 AAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRI 170
            A N    F+VTKT+   I   G HGT +++  I  IG A  I
Sbjct: 726 TAFNWSCTFIVTKTFADIINAIGTHGTFWMFGSICVIGLAFVI 768




High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Aedes aegypti (taxid: 7159)
>sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 Back     alignment and function description
>sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 Back     alignment and function description
>sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 Back     alignment and function description
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
291461573 507 sugar transporter 7 [Nilaparvata lugens] 0.703 0.313 0.408 4e-25
193664559 530 PREDICTED: facilitated trehalose transpo 0.690 0.294 0.356 1e-24
347965559 577 AGAP001236-PA [Anopheles gambiae str. PE 0.712 0.279 0.342 9e-24
170043906 566 sugar transporter [Culex quinquefasciatu 0.703 0.280 0.357 6e-23
157125518 570 sugar transporter [Aedes aegypti] gi|108 0.703 0.278 0.335 1e-21
193664561 470 PREDICTED: facilitated trehalose transpo 0.668 0.321 0.314 2e-17
193669080 515 PREDICTED: facilitated trehalose transpo 0.703 0.308 0.347 2e-17
157104959 806 sugar transporter [Aedes aegypti] gi|122 0.685 0.192 0.288 6e-15
312372485 422 hypothetical protein AND_20100 [Anophele 0.513 0.274 0.345 6e-14
242003132 387 conserved hypothetical protein [Pediculu 0.685 0.400 0.312 6e-14
>gi|291461573|dbj|BAI83421.1| sugar transporter 7 [Nilaparvata lugens] Back     alignment and taxonomy information
 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 98/159 (61%)

Query: 8   SFVSMRPYLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGIC 67
           S + MRP+LV+IF+  G+P+ S WVLV++  L + GS+   LT++ FGKR ++  S  + 
Sbjct: 310 SLLGMRPFLVKIFEDMGMPMSSHWVLVISSGLQVVGSVTCMLTMHLFGKRHITFLSLSVS 369

Query: 68  FVFTIALAICSMNLHWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGIC 127
            V  I L I  M      WI   +F + F+ +G+G+  +PW+L+SEI+PV  RG+A G  
Sbjct: 370 VVSCILLGILLMMQAEHPWIAFFLFTLIFFATGFGVCPVPWVLLSEIYPVEGRGLAGGAS 429

Query: 128 AAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGF 166
           AA    + F+VTK+Y+  +  F ++GT FIYS    IGF
Sbjct: 430 AACYYFLGFIVTKSYINLVHLFDVYGTCFIYSAFGLIGF 468




Source: Nilaparvata lugens

Species: Nilaparvata lugens

Genus: Nilaparvata

Family: Delphacidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193664559|ref|XP_001946897.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|347965559|ref|XP_321919.5| AGAP001236-PA [Anopheles gambiae str. PEST] gi|333470456|gb|EAA01784.5| AGAP001236-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170043906|ref|XP_001849608.1| sugar transporter [Culex quinquefasciatus] gi|167867183|gb|EDS30566.1| sugar transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157125518|ref|XP_001654366.1| sugar transporter [Aedes aegypti] gi|108873601|gb|EAT37826.1| AAEL010219-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|193664561|ref|XP_001946962.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193669080|ref|XP_001943832.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157104959|ref|XP_001648649.1| sugar transporter [Aedes aegypti] gi|122069442|sp|Q17NV8.1|TRET1_AEDAE RecName: Full=Facilitated trehalose transporter Tret1 gi|108884141|gb|EAT48366.1| AAEL000567-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312372485|gb|EFR20437.1| hypothetical protein AND_20100 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|242003132|ref|XP_002422622.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505423|gb|EEB09884.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
UNIPROTKB|Q17NV8806 Tret1 "Facilitated trehalose t 0.676 0.189 0.284 1.1e-15
FB|FBgn0036316539 CG10960 [Drosophila melanogast 0.650 0.272 0.308 1.1e-15
UNIPROTKB|B4QBN3488 Tret1-2 "Facilitated trehalose 0.668 0.309 0.290 1.9e-15
FB|FBgn0033644488 Tret1-2 "Trehalose transporter 0.654 0.303 0.287 5.1e-15
UNIPROTKB|B4LPX5911 Tret1 "Facilitated trehalose t 0.654 0.162 0.287 7.1e-15
UNIPROTKB|B4P624856 Tret1 "Facilitated trehalose t 0.654 0.172 0.281 8.3e-15
UNIPROTKB|B4QBN2857 Tret1-1 "Facilitated trehalose 0.654 0.172 0.287 8.3e-15
UNIPROTKB|B3MG58866 Tret1 "Facilitated trehalose t 0.654 0.170 0.293 8.4e-15
UNIPROTKB|B4HNS1488 Tret1-2 "Facilitated trehalose 0.668 0.309 0.278 1.4e-14
UNIPROTKB|Q291H8868 Tret1 "Facilitated trehalose t 0.654 0.170 0.281 1.8e-14
UNIPROTKB|Q17NV8 Tret1 "Facilitated trehalose transporter Tret1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 208 (78.3 bits), Expect = 1.1e-15, P = 1.1e-15
 Identities = 47/165 (28%), Positives = 84/165 (50%)

Query:    15 YLVEIFQTFGVPLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIA- 73
             Y V+IFQ  G  +      ++ GV+    + ++++ +++ G++ M L+ + +  + T+  
Sbjct:   607 YTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATMLIDRLGRK-MLLYISDVAMIITLMT 665

Query:    74 ------LAICSMNLHWPGWIPLTIFCICFWISGY--GILALPWMLMSEIFPVRIRGVACG 125
                   +     ++   GW+PL  F I  ++ G+  G   +PW++M EI P +IRG A  
Sbjct:   666 LGGFFYVKNSGQDVSQVGWLPLAAFVI--YVLGFSLGFGPIPWLMMGEILPGKIRGSAAS 723

Query:   126 ICAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAIRI 170
             +  A N    F+VTKT+   I   G HGT +++  I  IG A  I
Sbjct:   724 VATAFNWSCTFIVTKTFADIINAIGTHGTFWMFGSICVIGLAFVI 768




GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS
GO:0015771 "trehalose transport" evidence=ISS
GO:0044459 "plasma membrane part" evidence=ISS
FB|FBgn0036316 CG10960 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B4QBN3 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0033644 Tret1-2 "Trehalose transporter 1-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B4LPX5 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B4P624 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B4QBN2 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B3MG58 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4HNS1 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|Q291H8 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 2e-12
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 2e-12
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 1e-07
TIGR00887502 TIGR00887, 2A0109, phosphate:H+ symporter 1e-04
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score = 65.4 bits (160), Expect = 2e-12
 Identities = 38/162 (23%), Positives = 69/162 (42%), Gaps = 10/162 (6%)

Query: 15  YLVEIFQTFGV-PLKSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIA 73
           Y   IF+  GV    +  V ++ G +    + V+   V++FG+RP+ L       +    
Sbjct: 306 YSPTIFENAGVSTDHAFLVSIIVGAVNFAFTFVAIFLVDRFGRRPLLLIGAAGMAICLFV 365

Query: 74  LAICSMNLHWP-----GWIPLTIFCICFWISGY--GILALPWMLMSEIFPVRIRGVACGI 126
           L I   +         G +   I  I  +I+ +  G   +PW+++SEIFP+ +R     I
Sbjct: 366 LGILGASFVTGSSKSSGNVA--IVFILLFIAFFAMGWGPVPWVIVSEIFPLSLRPKGISI 423

Query: 127 CAAINSIVCFLVTKTYVTSITWFGLHGTLFIYSFITGIGFAI 168
             A N +  F+V   + T +   G+ G    +  +  +G   
Sbjct: 424 AVAANWLANFIVGFLFPTMLESIGVGGVFIFFGGLNVLGLIF 465


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|129965 TIGR00887, 2A0109, phosphate:H+ symporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG0569|consensus485 99.81
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.71
KOG0254|consensus513 99.69
TIGR00893 399 2A0114 d-galactonate transporter. 99.67
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.65
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.63
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.63
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.63
PRK03545 390 putative arabinose transporter; Provisional 99.63
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.63
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.62
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.61
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.61
TIGR00895 398 2A0115 benzoate transport. 99.6
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.6
PRK11663 434 regulatory protein UhpC; Provisional 99.6
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.59
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.59
TIGR00891 405 2A0112 putative sialic acid transporter. 99.59
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.58
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.57
PRK10091 382 MFS transport protein AraJ; Provisional 99.57
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.57
TIGR00900 365 2A0121 H+ Antiporter protein. 99.56
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.56
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.55
TIGR00898 505 2A0119 cation transport protein. 99.54
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.54
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.54
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.53
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.52
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.52
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.51
PRK10642490 proline/glycine betaine transporter; Provisional 99.51
KOG0255|consensus 521 99.51
PRK09874 408 drug efflux system protein MdtG; Provisional 99.5
PRK10054 395 putative transporter; Provisional 99.5
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.49
PRK10504 471 putative transporter; Provisional 99.49
PRK11043 401 putative transporter; Provisional 99.49
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.48
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.47
KOG1330|consensus 493 99.47
PRK12307 426 putative sialic acid transporter; Provisional 99.47
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.47
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.46
PRK03893 496 putative sialic acid transporter; Provisional 99.46
PLN00028 476 nitrate transmembrane transporter; Provisional 99.46
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.46
PRK09705 393 cynX putative cyanate transporter; Provisional 99.45
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.45
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.45
PRK10642 490 proline/glycine betaine transporter; Provisional 99.45
KOG0252|consensus538 99.44
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.44
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.44
PRK03699 394 putative transporter; Provisional 99.43
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.42
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.42
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.41
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.41
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.41
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.4
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.4
PRK03893496 putative sialic acid transporter; Provisional 99.38
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.37
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.37
PRK12382 392 putative transporter; Provisional 99.37
TIGR00901 356 2A0125 AmpG-related permease. 99.37
PRK05122 399 major facilitator superfamily transporter; Provisi 99.36
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.36
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.36
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.35
PRK10489417 enterobactin exporter EntS; Provisional 99.34
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.34
PRK10489 417 enterobactin exporter EntS; Provisional 99.34
KOG0569|consensus 485 99.34
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.33
PRK09952 438 shikimate transporter; Provisional 99.33
PRK12307426 putative sialic acid transporter; Provisional 99.32
KOG0253|consensus528 99.31
PRK15075 434 citrate-proton symporter; Provisional 99.31
PRK15075434 citrate-proton symporter; Provisional 99.29
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.28
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.28
KOG2532|consensus 466 99.28
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.27
PRK11663434 regulatory protein UhpC; Provisional 99.27
PRK11902 402 ampG muropeptide transporter; Reviewed 99.26
PTZ00207 591 hypothetical protein; Provisional 99.26
PRK05122399 major facilitator superfamily transporter; Provisi 99.26
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.25
PRK09705393 cynX putative cyanate transporter; Provisional 99.25
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.25
TIGR00891405 2A0112 putative sialic acid transporter. 99.24
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.23
PRK12382392 putative transporter; Provisional 99.23
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.23
PRK03633 381 putative MFS family transporter protein; Provision 99.23
KOG0254|consensus 513 99.22
PRK15011 393 sugar efflux transporter B; Provisional 99.22
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.22
PRK09952438 shikimate transporter; Provisional 99.22
TIGR00897402 2A0118 polyol permease family. This family of prot 99.21
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.21
TIGR00898505 2A0119 cation transport protein. 99.21
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.21
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.2
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.2
PRK10133 438 L-fucose transporter; Provisional 99.2
PRK15011393 sugar efflux transporter B; Provisional 99.19
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.19
PRK09528420 lacY galactoside permease; Reviewed 99.18
TIGR00893399 2A0114 d-galactonate transporter. 99.18
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.18
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.17
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.17
KOG2615|consensus 451 99.16
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.16
PRK11010 491 ampG muropeptide transporter; Validated 99.15
KOG2504|consensus 509 99.13
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.13
PRK03545390 putative arabinose transporter; Provisional 99.12
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.1
KOG2533|consensus 495 99.1
PRK09528 420 lacY galactoside permease; Reviewed 99.09
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.09
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.08
KOG3764|consensus 464 99.08
TIGR00805 633 oat sodium-independent organic anion transporter. 99.07
PRK03633381 putative MFS family transporter protein; Provision 99.07
PRK03699394 putative transporter; Provisional 99.06
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.05
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.04
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.02
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.02
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.0
PRK09874408 drug efflux system protein MdtG; Provisional 99.0
TIGR00900365 2A0121 H+ Antiporter protein. 98.99
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.99
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.98
PLN00028476 nitrate transmembrane transporter; Provisional 98.96
TIGR00895398 2A0115 benzoate transport. 98.96
PRK10504471 putative transporter; Provisional 98.92
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.92
PRK11010491 ampG muropeptide transporter; Validated 98.9
KOG0253|consensus 528 98.9
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.89
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.88
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.83
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.82
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.82
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.81
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.81
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 98.77
TIGR00896355 CynX cyanate transporter. This family of proteins 98.77
COG2270438 Permeases of the major facilitator superfamily [Ge 98.76
PRK10091382 MFS transport protein AraJ; Provisional 98.76
KOG0252|consensus 538 98.76
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.75
PRK09669 444 putative symporter YagG; Provisional 98.73
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.71
PRK10429473 melibiose:sodium symporter; Provisional 98.7
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.68
PRK09848448 glucuronide transporter; Provisional 98.68
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.68
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 98.66
PRK14995495 methyl viologen resistance protein SmvA; Provision 98.66
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.64
PRK11902402 ampG muropeptide transporter; Reviewed 98.64
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.63
PF13347 428 MFS_2: MFS/sugar transport protein 98.62
PRK15402406 multidrug efflux system translocase MdfA; Provisio 98.6
TIGR00901356 2A0125 AmpG-related permease. 98.57
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.56
PRK11462 460 putative transporter; Provisional 98.56
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.56
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.56
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.53
PRK10429 473 melibiose:sodium symporter; Provisional 98.52
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.5
PRK11043401 putative transporter; Provisional 98.49
PRK11462460 putative transporter; Provisional 98.49
PRK10213394 nepI ribonucleoside transporter; Reviewed 98.49
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.46
COG2211467 MelB Na+/melibiose symporter and related transport 98.43
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.43
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 98.43
KOG2504|consensus509 98.42
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.42
PRK10133438 L-fucose transporter; Provisional 98.42
PRK10054395 putative transporter; Provisional 98.42
KOG0255|consensus521 98.41
PRK09669444 putative symporter YagG; Provisional 98.41
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 98.39
KOG4686|consensus459 98.39
KOG2816|consensus 463 98.37
KOG2532|consensus466 98.37
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.37
PRK11646400 multidrug resistance protein MdtH; Provisional 98.36
PF13347428 MFS_2: MFS/sugar transport protein 98.35
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.25
PRK11195393 lysophospholipid transporter LplT; Provisional 98.24
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.2
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.2
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.18
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.15
KOG2325|consensus 488 98.09
PRK09848 448 glucuronide transporter; Provisional 98.07
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.06
COG2211 467 MelB Na+/melibiose symporter and related transport 98.02
PF1283277 MFS_1_like: MFS_1 like family 98.0
KOG2533|consensus495 97.92
COG0477338 ProP Permeases of the major facilitator superfamil 97.91
PRK11652394 emrD multidrug resistance protein D; Provisional 97.91
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.9
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 97.87
KOG3762|consensus618 97.82
KOG2563|consensus 480 97.77
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.76
PRK10207489 dipeptide/tripeptide permease B; Provisional 97.52
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.51
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.46
COG0738422 FucP Fucose permease [Carbohydrate transport and m 97.45
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.45
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.36
PRK09584500 tppB putative tripeptide transporter permease; Rev 97.33
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.33
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.3
KOG2563|consensus480 97.21
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.17
PTZ00207591 hypothetical protein; Provisional 97.03
PRK15403413 multidrug efflux system protein MdtM; Provisional 97.0
COG2270 438 Permeases of the major facilitator superfamily [Ge 96.93
KOG1330|consensus493 96.51
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.28
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.27
PRK15462493 dipeptide/tripeptide permease D; Provisional 95.97
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 95.87
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 95.65
KOG3762|consensus 618 95.53
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 95.49
KOG3764|consensus464 95.48
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 95.44
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 95.16
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 94.99
KOG2816|consensus463 93.94
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 93.16
KOG2615|consensus451 93.03
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 93.0
KOG0637|consensus 498 92.42
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 92.42
KOG3098|consensus 461 91.78
KOG4686|consensus 459 91.78
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 91.28
KOG3626|consensus 735 91.02
TIGR00805633 oat sodium-independent organic anion transporter. 89.81
KOG4332|consensus 454 89.79
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 88.73
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 88.28
KOG1237|consensus 571 88.18
KOG3098|consensus461 88.06
KOG3574|consensus 510 85.94
PRK03612 521 spermidine synthase; Provisional 83.37
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 82.09
>KOG0569|consensus Back     alignment and domain information
Probab=99.81  E-value=1.2e-18  Score=152.10  Aligned_cols=182  Identities=19%  Similarity=0.309  Sum_probs=155.2

Q ss_pred             cccccccceecccHHHHHhhcCCCc-hHHHHHHHHHHHHHHHHHHHHHHhcccCChHHHHHHHHHHHHHHHHHHHH-hhc
Q psy10294          3 PGFNSSFVSMRPYLVEIFQTFGVPL-KSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAIC-SMN   80 (226)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~g~~~-~~~~~~~~~~~~~~~~~~~~~~l~d~~Grr~~~~~~~~~~~i~~~~~~~~-~~~   80 (226)
                      .+|++|.+.+.+|...++++.|++. ++.+.+...++...+.++++.++.||+|||++++.+..++.+..+.+... ...
T Consensus       280 ~qq~sGi~ai~~Yst~i~~~aG~~~~~a~~an~~~g~v~~~~t~~~~~lid~~gRRpLll~~~~~~~~~~~~~~~~~~l~  359 (485)
T KOG0569|consen  280 AQQFSGINAIFFYSTSIFKTAGFTPEEAQYANLGIGIVNLLSTLVSPFLIDRLGRRPLLLISLSLMAVALLLMSIALFLS  359 (485)
T ss_pred             HHHhcCcceeHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5789999999999999999999998 77899999999999999999999999999999999999998833222221 222


Q ss_pred             CC---CchHHHHHHHHHHHHHHhccccchhhHHhhccCCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhHHHH
Q psy10294         81 LH---WPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWFGLHGTLFI  157 (226)
Q Consensus        81 ~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~  157 (226)
                      +.   +..+..+...+.+...++.|.+|++|.+.+|++|++.|..+.++....+++..++....++.+.+.+|- ..|++
T Consensus       360 ~~~~~~~~y~~i~~~~~~~~~f~~G~gpi~~fi~aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g~-~~fil  438 (485)
T KOG0569|consen  360 NSFGSWLSYLCIAAIFLFIISFAIGPGPIPWFIGAELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIGP-YVFIL  438 (485)
T ss_pred             HHhhhHHHHHHHHHHHHHHHhhhcCCCchhHHHHHHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc-hhhHH
Confidence            11   223344566777888889999999999999999999999999999999999999999999999999886 67888


Q ss_pred             HHHHHHHhhhhhhcccccccccceeEEEEecc--CCCHHHHhhh
Q psy10294        158 YSFITGIGFAIRIRGVACGICAAINSIVCFLV--TKTYIGIDWH  199 (226)
Q Consensus       158 ~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~e--~~~~~~~~~~  199 (226)
                      +.+.+.+..              +..++++||  +|+.+|+.++
T Consensus       439 F~i~~~~~~--------------i~~~~~lPETkgr~~~eI~~~  468 (485)
T KOG0569|consen  439 FVIPLAIFL--------------IYLYRYLPETKGRTPYEIIEE  468 (485)
T ss_pred             HHHHHHHHH--------------HHHHHhCcccCCCCHHHHHHH
Confidence            888888887              788899999  7888888776



>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
4gby_A491 The Structure Of The Mfs (Major Facilitator Superfa 1e-06
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 49.7 bits (117), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 35/133 (26%), Positives = 70/133 (52%), Gaps = 10/133 (7%) Query: 15 YLVEIFQTFGVPLKSEWV-LVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIA 73 Y E+F+T G + ++ GV+ +T ++++ +TV+KFG++P+ I +A Sbjct: 299 YAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQ-----IIGALGMA 353 Query: 74 LAICSMNLHWPGWIP--LTIFCICFWISGYGILALP--WMLMSEIFPVRIRGVACGICAA 129 + + S+ + P + + + F+++ + + P W+L+SEIFP IRG A I A Sbjct: 354 IGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVA 413 Query: 130 INSIVCFLVTKTY 142 + + V+ T+ Sbjct: 414 AQWLANYFVSWTF 426 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.84
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.62
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.6
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.57
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.53
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.44
2xut_A 524 Proton/peptide symporter family protein; transport 99.41
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.36
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.15
2cfq_A417 Lactose permease; transport, transport mechanism, 99.14
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.96
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.73
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.37
2xut_A524 Proton/peptide symporter family protein; transport 98.13
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.84  E-value=3e-20  Score=162.09  Aligned_cols=182  Identities=21%  Similarity=0.261  Sum_probs=143.9

Q ss_pred             cccccccceecccHHHHHhhcCCCc-hHHHHHHHHHHHHHHHHHHHHHHhcccCChHHHHHHHHHHHHHHHHHHHHhhcC
Q psy10294          3 PGFNSSFVSMRPYLVEIFQTFGVPL-KSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNL   81 (226)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~g~~~-~~~~~~~~~~~~~~~~~~~~~~l~d~~Grr~~~~~~~~~~~i~~~~~~~~~~~~   81 (226)
                      +++.++.+.+..|.|.+.++.+.+. +.........+...++.++++++.||+|||+.++.+...+.+..+.... ....
T Consensus       287 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dr~Grr~~~~~~~~~~~~~~~~l~~-~~~~  365 (491)
T 4gc0_A          287 FQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGT-AFYT  365 (491)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHH-HHHT
T ss_pred             HHHHhhhhHHHhcchHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHhhcCcchhccchHHHHHHHHHHHH-HHhc
Confidence            4566778888899999999988876 5556677888889999999999999999999999888887774433333 1222


Q ss_pred             CCchHHHHHHHHHHHHHHhccccchhhHHhhccCCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHH------hhchhhHH
Q psy10294         82 HWPGWIPLTIFCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSIT------WFGLHGTL  155 (226)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~g~~~~~  155 (226)
                      ....+..+.....+..+++.+.+++.+.+.+|++|++.|+++.|+....+++++++++.+.+.+.+      ..++...+
T Consensus       366 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~R~~~~g~~~~~~~~~~~i~~~~~p~l~~~~~~~~~~~~~~~~  445 (491)
T 4gc0_A          366 QAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSY  445 (491)
T ss_dssp             TCCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTTHHHHHHHHHHHHHHHHHHHHTHHHHHCHHHHHHHHHTTCHHH
T ss_pred             ccchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHH
Confidence            344455555555666667777888999999999999999999999999999999999988876643      34455678


Q ss_pred             HHHHHHHHHhhhhhhcccccccccceeEEEEecc--CCCHHHHhhh
Q psy10294        156 FIYSFITGIGFAIRIRGVACGICAAINSIVCFLV--TKTYIGIDWH  199 (226)
Q Consensus       156 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~e--~~~~~~~~~~  199 (226)
                      +++++++++..              +..++++||  +|++||+|+.
T Consensus       446 ~i~~~~~~~~~--------------i~~~~~~PETkg~tLeei~~~  477 (491)
T 4gc0_A          446 WIYGCMGVLAA--------------LFMWKFVPETKGKTLEELEAL  477 (491)
T ss_dssp             HHHHHHHHHHH--------------HHHHHHCCCCTTCCHHHHGGG
T ss_pred             HHHHHHHHHHH--------------HHHHheecCCCCCCHHHHHHH
Confidence            88888888877              666778999  8999999887



>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.56
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.36
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.23
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.0
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.56  E-value=4.1e-15  Score=125.03  Aligned_cols=151  Identities=7%  Similarity=0.004  Sum_probs=108.6

Q ss_pred             cccHHHHHhhcCCCc-hHHHHHHHHHHHHHHHHHHHHHHhcccCChHHHHHHHHHHHHHHHHHHHHhhcCCCchHHHHHH
Q psy10294         13 RPYLVEIFQTFGVPL-KSEWVLVLTGVLAITGSLVSSLTVNKFGKRPMSLWSTGICFVFTIALAICSMNLHWPGWIPLTI   91 (226)
Q Consensus        13 ~~~~~~~~~~~g~~~-~~~~~~~~~~~~~~~~~~~~~~l~d~~Grr~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~   91 (226)
                      ....|. .+++|++. +.++..+...++..++++++|+++||+|||+++..+.++..+..+........  ......+..
T Consensus        45 ~~~~p~-~~~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~  121 (447)
T d1pw4a_          45 ALAMPY-LVEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWA--TSSIAVMFV  121 (447)
T ss_dssp             HHHHHH-TTSSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHH--HSSSSHHHH
T ss_pred             HHHHHH-HHHhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchh--hhhHHHHHH
Confidence            334454 45679988 88899999999999999999999999999999999988887743333220000  112222222


Q ss_pred             HHHHHHHHhccccchhhHHhhccCCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHhh-chhhHHHHHHHHHHHhh
Q psy10294         92 FCICFWISGYGILALPWMLMSEIFPVRIRGVACGICAAINSIVCFLVTKTYVTSITWF-GLHGTLFIYSFITGIGF  166 (226)
Q Consensus        92 ~~~~~~~~~~~~~~~~~~~~~e~~p~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-g~~~~~~~~~~~~~i~~  166 (226)
                      .....+.......+....+++|.+|+++|+++.++.+....+|..+++.+.....+.. +|++.+++.+.+..+..
T Consensus       122 ~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~  197 (447)
T d1pw4a_         122 LLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVA  197 (447)
T ss_dssp             HHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHH
T ss_pred             HHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHH
Confidence            3332232222334556678999999999999999999999999999998887766654 78888888777766655



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure