Psyllid ID: psy10387

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRERY
ccEEEcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccEEcccccccccEEEEEccccccccccccccccccccccccccccEEcccccEEEccccccccccHHHHHHHHHHHHHHHHHccEEEccccccccccccccccccccccEEEEEEEcc
ccEEEccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHHHHccccccccEEccccEEEccEEEccccEEEEcHHHHHcccccccccccccHHHHEcccccEcccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEccccEEEEEcccc
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDehlgsrrptlddkhhLHYVQAIIHEVFrintiapitvphccmenttfydyfipkdTMIFISLWSLfhdeknfeepskfkperflspegkfdksnpnainfgigrrscagdfvaQNVMFLYVTTFFQKYsvhrdpnnpdlstkamsgfttapqpFKAIIRERY
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFkperflspegkfdksnpNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDlstkamsgfttapqpfkaiirery
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRERY
******GYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG***PTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHD****************************AINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVH*******************************
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRERY
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRERY
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRER*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRERY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q92148515 Cytochrome P450 1A1 OS=Mi N/A N/A 0.869 0.335 0.403 4e-39
Q92109522 Cytochrome P450 1A3 OS=On N/A N/A 0.869 0.331 0.397 3e-38
Q92110522 Cytochrome P450 1A1 OS=On N/A N/A 0.869 0.331 0.397 8e-38
Q92113509 Steroid 17-alpha-hydroxyl N/A N/A 0.989 0.387 0.351 8e-38
O42457521 Cytochrome P450 1A1 OS=Sp N/A N/A 0.869 0.332 0.392 1e-37
O42231521 Cytochrome P450 1A1 OS=Li N/A N/A 0.869 0.332 0.386 2e-37
Q92095521 Cytochrome P450 1A1 OS=Op N/A N/A 0.984 0.376 0.366 2e-37
P79716520 Cytochrome P450 1A1 OS=Di N/A N/A 0.869 0.332 0.392 5e-37
Q9W683521 Cytochrome P450 1A1 OS=Li N/A N/A 0.869 0.332 0.386 6e-37
P79760530 Cytochrome P450 1A4 OS=Ga yes N/A 0.864 0.324 0.388 9e-37
>sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 Back     alignment and function desciption
 Score =  160 bits (406), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 121/176 (68%), Gaps = 3/176 (1%)

Query: 2   DIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAII 60
           D+F AG++T+S++++++V+Y++ +P IQ +LHQE+ + +G SR P L D+H+L  ++A I
Sbjct: 314 DLFGAGFDTVSTALSWSVMYLVAHPEIQERLHQEIKDKVGLSRSPVLTDRHNLPILEAFI 373

Query: 61  HEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERF 120
            E+FR ++  P T+PHC  ++T+   YFIPKDT +FI+ W + HD + ++EPS F P+RF
Sbjct: 374 FEIFRHSSFLPFTIPHCATKDTSLDGYFIPKDTCVFINQWQINHDPELWKEPSTFNPDRF 433

Query: 121 LSPEG-KFDK-SNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNP 174
           LS +  + +K +    + FG+G+R C G+ VA+N +FL++    Q+ + H  P  P
Sbjct: 434 LSADASELNKLAGEKVMLFGMGKRRCIGEMVARNEVFLFLAILVQRLTFHAVPGEP 489
Cytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Microgadus tomcod (taxid: 34823)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 4EC: .EC: 1
>sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 Back     alignment and function description
>sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 Back     alignment and function description
>sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 Back     alignment and function description
>sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 Back     alignment and function description
>sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 Back     alignment and function description
>sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 Back     alignment and function description
>sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 Back     alignment and function description
>sp|P79760|CP1A4_CHICK Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
225548285 487 cytochrome p450 [Reticulitermes flavipes 0.994 0.406 0.4 5e-43
431898684 511 Cytochrome P450 1A1 [Pteropus alecto] 0.954 0.371 0.401 9e-40
327263435 505 PREDICTED: cytochrome P450 1A4-like [Ano 0.954 0.376 0.401 2e-39
42398143 493 cytochrome P450 CYP15A1 [Diploptera punc 0.964 0.389 0.396 2e-38
395514975 481 PREDICTED: cytochrome P450 1A1-like [Sar 0.984 0.407 0.378 3e-38
242005833 476 cytochrome P450, putative [Pediculus hum 0.994 0.415 0.386 3e-38
321478723 485 hypothetical protein DAPPUDRAFT_310332 [ 0.984 0.404 0.398 9e-38
209155392 522 Cytochrome P450 1A1 [Salmo salar] gi|223 0.869 0.331 0.403 1e-37
242004391 503 cytochrome P-450, putative [Pediculus hu 0.984 0.389 0.41 2e-37
334333060 478 PREDICTED: cytochrome P450 1A5 [Monodelp 0.989 0.412 0.371 2e-37
>gi|225548285|gb|ACN93794.1| cytochrome p450 [Reticulitermes flavipes] Back     alignment and taxonomy information
 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 134/200 (67%), Gaps = 2/200 (1%)

Query: 1   MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAI 59
           +D+F+AG ET++ S+ F++LYM+++P +Q  + +ELD  +G  RRPTL D+  LHY +A+
Sbjct: 289 LDLFTAGGETMAMSLGFSLLYMLVHPNVQKAVQKELDAVVGRDRRPTLQDRASLHYTEAV 348

Query: 60  IHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPER 119
           + E+ R++++AP+T PH   ++T    YFIPKD+MI ++L+SLF D++++ +P  F+PER
Sbjct: 349 LSELIRVSSVAPVTPPHRATQDTKLNGYFIPKDSMIMVNLYSLFQDQEHWGDPEVFRPER 408

Query: 120 FLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTK 179
           FL  +G + K +   I FG G+R C G+ +A+N +FL+ T+  Q +       +P+ S  
Sbjct: 409 FLDADGNYVKDD-WMIPFGAGKRVCIGEVLARNTVFLFFTSLLQAFWFSLPEGDPEPSLV 467

Query: 180 AMSGFTTAPQPFKAIIRERY 199
            + GFT AP PF+    +R+
Sbjct: 468 PLPGFTIAPAPFRVKATKRF 487

Source: Reticulitermes flavipes

Species: Reticulitermes flavipes

Genus: Reticulitermes

Family: Rhinotermitidae

Order: Isoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|431898684|gb|ELK07064.1| Cytochrome P450 1A1 [Pteropus alecto] Back     alignment and taxonomy information
>gi|327263435|ref|XP_003216525.1| PREDICTED: cytochrome P450 1A4-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|42398143|gb|AAS13464.1| cytochrome P450 CYP15A1 [Diploptera punctata] Back     alignment and taxonomy information
>gi|395514975|ref|XP_003761684.1| PREDICTED: cytochrome P450 1A1-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|242005833|ref|XP_002423765.1| cytochrome P450, putative [Pediculus humanus corporis] gi|212506967|gb|EEB11027.1| cytochrome P450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321478723|gb|EFX89680.1| hypothetical protein DAPPUDRAFT_310332 [Daphnia pulex] Back     alignment and taxonomy information
>gi|209155392|gb|ACI33928.1| Cytochrome P450 1A1 [Salmo salar] gi|223648924|gb|ACN11220.1| Cytochrome P450 1A1 [Salmo salar] Back     alignment and taxonomy information
>gi|242004391|ref|XP_002423075.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212506006|gb|EEB10337.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|334333060|ref|XP_001373113.2| PREDICTED: cytochrome P450 1A5 [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
ZFIN|ZDB-GENE-041114-179512 cyp1d1 "cytochrome P450, famil 0.989 0.384 0.38 1.3e-36
UNIPROTKB|F1NMG8527 CYP1A4 "Cytochrome P450 1A4" [ 0.854 0.322 0.398 1.9e-35
UNIPROTKB|F1P054530 CYP1A4 "Cytochrome P450 1A4" [ 0.854 0.320 0.398 1.9e-35
UNIPROTKB|P79760530 CYP1A4 "Cytochrome P450 1A4" [ 0.854 0.320 0.393 6.5e-35
ZFIN|ZDB-GENE-110114-1506 cyp2r1 "cytochrome P450, famil 0.974 0.383 0.38 1.3e-34
UNIPROTKB|F1NDB5514 CYP17A1 "Steroid 17-alpha-hydr 0.994 0.385 0.366 2.2e-34
UNIPROTKB|F1NYI7508 CYP17A1 "Steroid 17-alpha-hydr 0.994 0.389 0.366 2.2e-34
UNIPROTKB|P04798512 CYP1A1 "Cytochrome P450 1A1" [ 0.824 0.320 0.379 2.8e-34
ZFIN|ZDB-GENE-030902-1526 cyp1b1 "cytochrome P450, famil 0.974 0.368 0.356 4.6e-34
ZFIN|ZDB-GENE-041001-157492 cyp2ad6 "cytochrome P450, fami 0.984 0.398 0.358 4.6e-34
ZFIN|ZDB-GENE-041114-179 cyp1d1 "cytochrome P450, family 1, subfamily D, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 394 (143.8 bits), Expect = 1.3e-36, P = 1.3e-36
 Identities = 76/200 (38%), Positives = 122/200 (61%)

Query:     1 MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAI 59
             +DIF AG++T+ + + +++LY+I +P IQ K+ QE+D  +G  R P   D+ ++ Y +A 
Sbjct:   313 IDIFGAGFDTIITGLQWSLLYLIKFPNIQDKIVQEIDNQVGMDRLPQFKDRPNMPYTEAF 372

Query:    60 IHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPER 119
             I+EVFR  +  P T+PHC  EN T   YFIPKDT +FI+ + + HD + +++P  F+PER
Sbjct:   373 INEVFRHASYMPFTIPHCTTENITLNGYFIPKDTCVFINQYQVNHDIEIWDDPESFRPER 432

Query:   120 FLSPEGKFDKS-NPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLST 178
             FL+  G  +KS     + FG+G R C GD +A+  MF+++TT   +  +   P   +L  
Sbjct:   433 FLTLSGHLNKSLTEKVMIFGMGIRRCLGDNIARLEMFVFLTTLLHRLHIENVPGQ-ELDL 491

Query:   179 KAMSGFTTAPQPFKAIIRER 198
              +  G T  P+P++  I  R
Sbjct:   492 SSTFGLTMKPRPYRIKIIPR 511
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1NMG8 CYP1A4 "Cytochrome P450 1A4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P054 CYP1A4 "Cytochrome P450 1A4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P79760 CYP1A4 "Cytochrome P450 1A4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110114-1 cyp2r1 "cytochrome P450, family 2, subfamily R, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDB5 CYP17A1 "Steroid 17-alpha-hydroxylase/17,20 lyase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYI7 CYP17A1 "Steroid 17-alpha-hydroxylase/17,20 lyase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P04798 CYP1A1 "Cytochrome P450 1A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030902-1 cyp1b1 "cytochrome P450, family 1, subfamily B, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-157 cyp2ad6 "cytochrome P450, family 2, subfamily AD, polypeptide 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.14.15.1LOW CONFIDENCE prediction!
4th Layer4.2.1.92LOW CONFIDENCE prediction!
3rd Layer4.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
pfam00067461 pfam00067, p450, Cytochrome P450 4e-56
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-37
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-27
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 8e-26
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 9e-26
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 8e-24
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 4e-22
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-22
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-21
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 9e-20
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 3e-18
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 7e-17
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-16
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-16
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 4e-15
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 6e-13
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-11
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 4e-09
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 6e-09
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 9e-08
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 1e-07
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 2e-06
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-05
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-04
PLN02648480 PLN02648, PLN02648, allene oxide synthase 6e-04
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  183 bits (467), Expect = 4e-56
 Identities = 66/193 (34%), Positives = 111/193 (57%), Gaps = 2/193 (1%)

Query: 1   MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSRR-PTLDDKHHLHYVQAI 59
           +++F AG +T SS++++A+  +  +P +Q KL +E+DE +G +R PT DD  ++ Y+ A+
Sbjct: 267 LELFFAGTDTTSSTLSWALYELAKHPEVQEKLREEIDEVIGDKRSPTYDDLQNMPYLDAV 326

Query: 60  IHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPER 119
           I E  R++ + P+ +P    ++T    Y IPK T++ ++L++L  D + F  P +F PER
Sbjct: 327 IKETLRLHPVVPLLLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPER 386

Query: 120 FLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTK 179
           FL   GKF KS    + FG G R+C G+ +A+  M L++ T  Q + V   P        
Sbjct: 387 FLDENGKFRKSFAF-LPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGTDPPDID 445

Query: 180 AMSGFTTAPQPFK 192
              G    P+P+K
Sbjct: 446 ETPGLLLPPKPYK 458

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG0158|consensus499 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
KOG0156|consensus489 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
KOG0157|consensus497 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0159|consensus519 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0684|consensus486 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>KOG0158|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-53  Score=354.32  Aligned_cols=195  Identities=30%  Similarity=0.483  Sum_probs=174.6

Q ss_pred             cEeeecchhHHHHHHHHHHHHHhChHHHHHHHHHHHHHhC-CCCCCccccccChhHHHHHHHHhcCCCCCCCCcceeccc
Q psy10387          2 DIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCME   80 (199)
Q Consensus         2 ~l~~ag~~tt~~~~~~~l~~L~~~p~~~~~l~~Ei~~~~~-~~~~~~~~~~~~~~l~a~i~E~lRl~~~~~~~~~r~~~~   80 (199)
                      .|++||.||||+++++++|+|++||++|+||++||++++. ...+++|.+.+|+||++||+||||+||+++. ..|.|++
T Consensus       301 vFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~-~~R~C~k  379 (499)
T KOG0158|consen  301 VFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPAPF-LNRECTK  379 (499)
T ss_pred             HHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCccc-ccceecC
Confidence            3678999999999999999999999999999999999977 3339999999999999999999999999997 9999999


Q ss_pred             Cceec-cEEeCCCCEEEeChhhhhcCCCCCCCCCCCCCCCcCCCCCCCCCCCCCccccCCCCCccccHHHHHHHHHHHHH
Q psy10387         81 NTTFY-DYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVT  159 (199)
Q Consensus        81 d~~~~-g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~l~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~l~  159 (199)
                      |+++. ++.|+||+.|.++.+++||||++||||++|+||||++++.+.. .+..|+|||.|||+|+|.+||.+|+|+.|+
T Consensus       380 ~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~-~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~  458 (499)
T KOG0158|consen  380 DYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNKSR-HPGAYLPFGVGPRNCIGMRFALMEAKLALA  458 (499)
T ss_pred             ceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccccc-CCccccCCCCCccccHHHHHHHHHHHHHHH
Confidence            99999 9999999999999999999999999999999999998876533 378999999999999999999999999999


Q ss_pred             HHHHhceeeeCCCCCCCCCCccCCceecCc-ceeEEEEec
Q psy10387        160 TFFQKYSVHRDPNNPDLSTKAMSGFTTAPQ-PFKAIIRER  198 (199)
Q Consensus       160 ~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~~~~R  198 (199)
                      +||++|+++.++...........+++..|. ++++++.+|
T Consensus       459 ~lL~~f~~~~~~~t~~~~~~~~~~~~l~pk~gi~Lkl~~r  498 (499)
T KOG0158|consen  459 HLLRNFSFEVCPTTIIPLEGDPKGFTLSPKGGIWLKLEPR  498 (499)
T ss_pred             HHHhhCEEecCCcccCcccCCccceeeecCCceEEEEEeC
Confidence            999999999988332221111236666675 699999988

>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 9e-37
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 9e-33
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-32
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-32
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-32
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 5e-32
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 5e-32
3pm0_A507 Structural Characterization Of The Complex Between 5e-32
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 8e-32
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 9e-32
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-31
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-31
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-31
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 5e-31
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 5e-31
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-30
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-30
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-30
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-30
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-30
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-30
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-30
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-30
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 3e-29
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 3e-29
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 6e-29
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 5e-28
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 4e-17
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 5e-17
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 5e-17
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-16
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 2e-11
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 7e-11
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 3e-10
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-08
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-08
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 3e-08
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 4e-08
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 5e-08
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-07
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-07
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 1e-07
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-07
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 1e-07
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 1e-07
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-07
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-07
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-07
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-07
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-07
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-07
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-07
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-07
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 1e-07
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 2e-07
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 3e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 3e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 3e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 4e-07
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 4e-07
1fah_A471 Structure Of Cytochrome P450 Length = 471 4e-07
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 4e-07
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 4e-07
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 4e-07
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 4e-07
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 4e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 4e-07
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-07
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 5e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 5e-07
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 5e-07
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 6e-07
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 9e-07
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-06
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-06
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 7e-06
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 3e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 8e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 8e-05
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 9e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 9e-05
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 1e-04
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-04
1ulw_A402 Crystal Structure Of P450nor Ser73gly/ser75gly Muta 3e-04
1xqd_A403 Crystal Structure Of P450nor Complexed With 3- Pyri 3e-04
1f25_A402 Crystal Structure Of No Complex Of Thr243asn Mutant 3e-04
1cl6_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 3e-04
1f26_A402 Crystal Structure Of No Complex Of Thr243val Mutant 3e-04
1f24_A402 Crystal Structure Of No Complex Of Thr243ala Mutant 3e-04
1ehe_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 3e-04
1jfb_A404 X-Ray Structure Of Nitric Oxide Reductase (Cytochro 3e-04
1cmn_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 5e-04
1cmj_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 5e-04
1ehg_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 5e-04
1ehf_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 5e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure 
Iteration: 1

 Score =  149 bits (376), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
Query: 1   MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAI 59
           +D+F AG++T++++++++++Y+++ P +Q K+ +ELD  +G SRRP L D+ HL Y++A 
Sbjct: 285 LDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAF 344
Query: 60  IHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPER 119
           I E FR ++  P T+PH    +T+   ++IPK   +F++ W + HD+K +  PS+F PER
Sbjct: 345 ILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPER 404
Query: 120 FLSPEGKFDKS-NPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQK 164
           FL+P+G  DK  +   I FG+G+R C G+ +A+  +FL++    Q+
Sbjct: 405 FLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAILLQR 450
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|1ULW|A Chain A, Crystal Structure Of P450nor Ser73gly/ser75gly Mutant Length = 402 Back     alignment and structure
>pdb|1XQD|A Chain A, Crystal Structure Of P450nor Complexed With 3- Pyridinealdehyde Adenine Dinucleotide Length = 403 Back     alignment and structure
>pdb|1F25|A Chain A, Crystal Structure Of No Complex Of Thr243asn Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1CL6|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Its Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1F26|A Chain A, Crystal Structure Of No Complex Of Thr243val Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1F24|A Chain A, Crystal Structure Of No Complex Of Thr243ala Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1EHE|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1JFB|A Chain A, X-Ray Structure Of Nitric Oxide Reductase (Cytochrome P450nor) In The Ferric Resting State At Atomic Resolution Length = 404 Back     alignment and structure
>pdb|1CMN|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1CMJ|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1EHG|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1EHF|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 6e-82
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-81
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 8e-81
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-79
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-79
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 4e-77
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-77
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-76
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-76
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-75
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-55
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-44
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-38
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-38
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-38
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-37
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-36
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-36
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 7e-36
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-34
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-34
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-33
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-31
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-30
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-29
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 7e-27
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-25
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 9e-25
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-24
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 4e-04
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 4e-04
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
 Score =  250 bits (641), Expect = 6e-82
 Identities = 64/200 (32%), Positives = 116/200 (58%), Gaps = 2/200 (1%)

Query: 1   MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAI 59
            DIF AG ET +S + + + +++  P ++ KL++E+D+++G SR PT+ D++ L  ++A 
Sbjct: 279 GDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEAT 338

Query: 60  IHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPER 119
           I EV R+  +AP+ +PH    +++  ++ + K T + I+LW+L H+EK + +P +F PER
Sbjct: 339 IREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPER 398

Query: 120 FLSPEGKFDKSNPNA-INFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLST 178
           FL+P G    S   + + FG G RSC G+ +A+  +FL +    Q++ +    +    S 
Sbjct: 399 FLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSL 458

Query: 179 KAMSGFTTAPQPFKAIIRER 198
           + +         FK  I+ R
Sbjct: 459 EGIPKVVFLIDSFKVKIKVR 478
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-55  Score=370.06  Aligned_cols=196  Identities=36%  Similarity=0.668  Sum_probs=181.4

Q ss_pred             cEeeecchhHHHHHHHHHHHHHhChHHHHHHHHHHHHHhC-CCCCCccccccChhHHHHHHHHhcCCCCCCCCcceeccc
Q psy10387          2 DIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCME   80 (199)
Q Consensus         2 ~l~~ag~~tt~~~~~~~l~~L~~~p~~~~~l~~Ei~~~~~-~~~~~~~~~~~~~~l~a~i~E~lRl~~~~~~~~~r~~~~   80 (199)
                      ++++||+|||+++++|++++|++||++|+||++|++++++ ++.++.+++.+|||++|||+|++|++|+++....|.+.+
T Consensus       279 ~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~  358 (479)
T 3tbg_A          279 DLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSR  358 (479)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSS
T ss_pred             HHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccccceeecCC
Confidence            4678999999999999999999999999999999999998 778999999999999999999999999999877778889


Q ss_pred             CceeccEEeCCCCEEEeChhhhhcCCCCCCCCCCCCCCCcCCCCCCCCCCCCCccccCCCCCccccHHHHHHHHHHHHHH
Q psy10387         81 NTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTT  160 (199)
Q Consensus        81 d~~~~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~l~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~l~~  160 (199)
                      |++++|+.||||+.|+++.+++|+||++|+||++|+||||+++++.... +..|+|||+|+|.|+|++||++|++++++.
T Consensus       359 d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~-~~~~~pFG~G~R~C~G~~lA~~e~~~~la~  437 (479)
T 3tbg_A          359 DIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVK-PEAFLPFSAGRRACLGEPLARMELFLFFTS  437 (479)
T ss_dssp             CEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCC-CTTCCTTCCSTTSCTTHHHHHHHHHHHHHH
T ss_pred             CceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCC-CCceecCCCCCcCChhHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999988766554 678999999999999999999999999999


Q ss_pred             HHHhceeeeCCCCCCCCCCccCCceecCcceeEEEEec
Q psy10387        161 FFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRER  198 (199)
Q Consensus       161 ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R  198 (199)
                      |+++|+|+++++.+.+......+++..|.+++|++++|
T Consensus       438 ll~~f~~~~~~~~~~~~~~~~~~~~~~P~~~~v~~~pR  475 (479)
T 3tbg_A          438 LLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR  475 (479)
T ss_dssp             HHHHEEEECCTTSCCCCSCEEESSSEEECCCCBEEEEC
T ss_pred             HHHccEEEeCCCCCCccccccceeeecCCCeEEEEEEC
Confidence            99999999988765555555567788888999999999
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-35
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-34
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-27
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-26
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-19
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-16
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-12
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-11
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-11
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 3e-11
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 7e-10
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-09
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-09
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 4e-09
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 5e-09
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-08
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-08
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-08
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-08
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 4e-08
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 4e-07
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  126 bits (316), Expect = 4e-35
 Identities = 70/200 (35%), Positives = 110/200 (55%), Gaps = 3/200 (1%)

Query: 1   MDIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLGSR-RPTLDDKHHLHYVQAI 59
            ++  AG ET ++ + +A+L+M LYP IQ ++ +E+D  +G   +P+ DDK  + Y +A+
Sbjct: 266 GELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAV 325

Query: 60  IHEVFRINTIAPITVPHCCMENTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPER 119
           +HEV R   I P+ + H   E+     Y IPK T +  +L+S+  DEK + +P  F PER
Sbjct: 326 LHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPER 385

Query: 120 FLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTTFFQKYSVHRDPNNPDLSTK 179
           FL   G F K     + F +GRR C G+ +A+  MFL+ T   Q++ +H  P+      K
Sbjct: 386 FLDSSGYFAKKEAL-VPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHF-PHELVPDLK 443

Query: 180 AMSGFTTAPQPFKAIIRERY 199
              G T  PQP+      R+
Sbjct: 444 PRLGMTLQPQPYLICAERRH 463
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-52  Score=346.62  Aligned_cols=196  Identities=35%  Similarity=0.670  Sum_probs=180.9

Q ss_pred             cEeeecchhHHHHHHHHHHHHHhChHHHHHHHHHHHHHhC-CCCCCccccccChhHHHHHHHHhcCCCCCCCCcceeccc
Q psy10387          2 DIFSAGYETLSSSMAFAVLYMILYPAIQTKLHQELDEHLG-SRRPTLDDKHHLHYVQAIIHEVFRINTIAPITVPHCCME   80 (199)
Q Consensus         2 ~l~~ag~~tt~~~~~~~l~~L~~~p~~~~~l~~Ei~~~~~-~~~~~~~~~~~~~~l~a~i~E~lRl~~~~~~~~~r~~~~   80 (199)
                      .+++||+|||+.+++|++++|++||++|+||++|++.+.+ ...++.+++.+||||+|+++|++|++|+++....|.+.+
T Consensus       267 ~~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lp~l~a~~~Et~Rl~~~~~~~~~r~~~~  346 (463)
T d3czha1         267 ELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSE  346 (463)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSCEECSS
T ss_pred             HHHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCCCHHHHHhhhhcccccceeeeeeccccccceecccC
Confidence            4678999999999999999999999999999999999998 678999999999999999999999999999878899999


Q ss_pred             CceeccEEeCCCCEEEeChhhhhcCCCCCCCCCCCCCCCcCCCCCCCCCCCCCccccCCCCCccccHHHHHHHHHHHHHH
Q psy10387         81 NTTFYDYFIPKDTMIFISLWSLFHDEKNFEEPSKFKPERFLSPEGKFDKSNPNAINFGIGRRSCAGDFVAQNVMFLYVTT  160 (199)
Q Consensus        81 d~~~~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~l~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~l~~  160 (199)
                      |+.++|+.||||+.|.++.+++|+||++|+||++|+||||++++..... +..|+|||+|+|.|+|++||++|++++++.
T Consensus       347 ~~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~-~~~~~~FG~G~r~C~G~~~A~~~~~~~la~  425 (463)
T d3czha1         347 DAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAK-KEALVPFSLGRRHCLGEHLARMEMFLFFTA  425 (463)
T ss_dssp             CEEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSCBCC-CTTCCTTCCSTTCCTTHHHHHHHHHHHHHH
T ss_pred             CcccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCccccCC-CCceeCCCCCCcCCchHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999988765544 678999999999999999999999999999


Q ss_pred             HHHhceeeeCCCCCCCCCCccCCceecCcceeEEEEecC
Q psy10387        161 FFQKYSVHRDPNNPDLSTKAMSGFTTAPQPFKAIIRERY  199 (199)
Q Consensus       161 ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~  199 (199)
                      |+++|+|+++++. .++.....+++..|.++.|++++||
T Consensus       426 ll~~f~~~~~~~~-~~~~~~~~~~~~~p~~~~v~~~~R~  463 (463)
T d3czha1         426 LLQRFHLHFPHEL-VPDLKPRLGMTLQPQPYLICAERRH  463 (463)
T ss_dssp             HHHHEEEECGGGC-CCCCCCCSSSSCCCCCCCBEEEECC
T ss_pred             HHHhcEEEeCCCC-CCCceeccCeEEeccCcEEEEEeCc
Confidence            9999999997654 3455566778878889999999997
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure