Psyllid ID: psy10429

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL
ccHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccHHHHHHcccccEEEEcccHHHHHHHHHHHHcccccEEEEEcHHcccccccccccccccccEEEcccEEEEEccccccc
ccHHHHHHHHHHHHHHccccEEEEEccHcccccEEEHcHHHHHHHccccEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccHHccccHHHHHHcccccEEEEcccHHHHHHHHHHHHcccccEEEEccHHHcccccccccccccccEEEEcccEEEEEccccEcc
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLwkkygdkrvldtpiteIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFymsagtvnvpivfrgpngaasgVAAQHsqcfgawftqcpglkvvspynseDAKGLLKaairdpdpvvflenellygvqypmgdealskdfvlpigkakVEKQVIMKTL
mtvrdalnsaldeemardEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL
*******************KVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKV*********
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMK*L
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVI*KT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
O44451 352 Pyruvate dehydrogenase E1 yes N/A 0.966 0.568 0.8 1e-95
P49432 359 Pyruvate dehydrogenase E1 yes N/A 0.971 0.559 0.781 2e-94
Q9D051 359 Pyruvate dehydrogenase E1 yes N/A 0.971 0.559 0.781 2e-94
P11177 359 Pyruvate dehydrogenase E1 yes N/A 0.971 0.559 0.781 1e-93
Q5RE79 359 Pyruvate dehydrogenase E1 yes N/A 0.971 0.559 0.781 1e-93
P11966 359 Pyruvate dehydrogenase E1 yes N/A 0.971 0.559 0.771 2e-93
Q38799 363 Pyruvate dehydrogenase E1 yes N/A 0.971 0.553 0.736 4e-88
Q0J0H4 376 Pyruvate dehydrogenase E1 yes N/A 0.971 0.534 0.741 5e-87
Q6Z1G7 374 Pyruvate dehydrogenase E1 no N/A 0.971 0.537 0.741 7e-87
Q09171 366 Pyruvate dehydrogenase E1 yes N/A 0.966 0.546 0.73 3e-86
>sp|O44451|ODPB_CAEEL Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C04C3.3 PE=1 SV=2 Back     alignment and function desciption
 Score =  348 bits (894), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 183/200 (91%)

Query: 1   MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
           MTVRDALN A+DEE+ RD++VFL+GEEVA YDGAYK+S+GLWKK+GDKRV+DTPITE+GF
Sbjct: 25  MTVRDALNQAMDEEIKRDDRVFLMGEEVAQYDGAYKISKGLWKKHGDKRVVDTPITEMGF 84

Query: 61  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
           AGIAVGAA AGLRP+CEFMTFNFSMQAID IINSAAKT+YMSAG V VPIVFRGPNGAA+
Sbjct: 85  AGIAVGAAFAGLRPICEFMTFNFSMQAIDQIINSAAKTYYMSAGRVPVPIVFRGPNGAAA 144

Query: 121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
           GVAAQHSQ F AW+  CPGLKVV PY++EDAKGLLKAAIRD +PVVFLENE+LYG  +P+
Sbjct: 145 GVAAQHSQDFSAWYAHCPGLKVVCPYSAEDAKGLLKAAIRDDNPVVFLENEILYGQSFPV 204

Query: 181 GDEALSKDFVLPIGKAKVEK 200
           GDE LS DFV+PIGKAK+E+
Sbjct: 205 GDEVLSDDFVVPIGKAKIER 224
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 1
>sp|P49432|ODPB_RAT Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Rattus norvegicus GN=Pdhb PE=1 SV=2 Back     alignment and function description
>sp|Q9D051|ODPB_MOUSE Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Mus musculus GN=Pdhb PE=1 SV=1 Back     alignment and function description
>sp|P11177|ODPB_HUMAN Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens GN=PDHB PE=1 SV=3 Back     alignment and function description
>sp|Q5RE79|ODPB_PONAB Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Pongo abelii GN=PDHB PE=2 SV=1 Back     alignment and function description
>sp|P11966|ODPB_BOVIN Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Bos taurus GN=PDHB PE=1 SV=2 Back     alignment and function description
>sp|Q38799|ODPB1_ARATH Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial OS=Arabidopsis thaliana GN=PDH2 PE=1 SV=2 Back     alignment and function description
>sp|Q0J0H4|ODPB2_ORYSJ Pyruvate dehydrogenase E1 component subunit beta-2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os09g0509200 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z1G7|ODPB1_ORYSJ Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial OS=Oryza sativa subsp. japonica GN=Os08g0536000 PE=2 SV=1 Back     alignment and function description
>sp|Q09171|ODPB_SCHPO Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdb1 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
307178049 353 Pyruvate dehydrogenase E1 component subu 0.966 0.566 0.925 1e-108
383851961 353 PREDICTED: pyruvate dehydrogenase E1 com 0.966 0.566 0.92 1e-108
380026447 353 PREDICTED: pyruvate dehydrogenase E1 com 0.966 0.566 0.91 1e-107
335892820 353 pyruvate dehydrogenase E1 component subu 0.966 0.566 0.91 1e-107
322783990 381 hypothetical protein SINV_15490 [Solenop 0.966 0.524 0.905 1e-107
307195718 359 Pyruvate dehydrogenase E1 component subu 0.966 0.557 0.91 1e-107
340710181 352 PREDICTED: pyruvate dehydrogenase E1 com 0.966 0.568 0.915 1e-107
328714666 361 PREDICTED: pyruvate dehydrogenase E1 com 0.971 0.556 0.870 1e-105
350413618 352 PREDICTED: pyruvate dehydrogenase E1 com 0.966 0.568 0.9 1e-105
58381888 355 AGAP010421-PA [Anopheles gambiae str. PE 0.966 0.563 0.875 1e-103
>gi|307178049|gb|EFN66894.1| Pyruvate dehydrogenase E1 component subunit beta, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/200 (92%), Positives = 194/200 (97%)

Query: 1   MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
           MTVRDALNSALDEEM +DE+VF+LGEEVALYDGAYKVSRGLWKKYGDKRV+DTPITE GF
Sbjct: 25  MTVRDALNSALDEEMEKDERVFILGEEVALYDGAYKVSRGLWKKYGDKRVIDTPITEAGF 84

Query: 61  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
           AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAG VNVPIVFRGPNGAA+
Sbjct: 85  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGRVNVPIVFRGPNGAAA 144

Query: 121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
           GVAAQHSQCFGAW++ CPGLKVVSPYNSEDAKGLLKAAIRDPDPVV LENE+LYGVQYPM
Sbjct: 145 GVAAQHSQCFGAWYSHCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVVLENEILYGVQYPM 204

Query: 181 GDEALSKDFVLPIGKAKVEK 200
            DEALSKDFVLPIGKAKVE+
Sbjct: 205 SDEALSKDFVLPIGKAKVER 224

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383851961|ref|XP_003701499.1| PREDICTED: pyruvate dehydrogenase E1 component subunit beta, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380026447|ref|XP_003696963.1| PREDICTED: pyruvate dehydrogenase E1 component subunit beta, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|335892820|ref|NP_001229442.1| pyruvate dehydrogenase E1 component subunit beta, mitochondrial [Apis mellifera] Back     alignment and taxonomy information
>gi|322783990|gb|EFZ11142.1| hypothetical protein SINV_15490 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307195718|gb|EFN77558.1| Pyruvate dehydrogenase E1 component subunit beta, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340710181|ref|XP_003393673.1| PREDICTED: pyruvate dehydrogenase E1 component subunit beta, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328714666|ref|XP_001948556.2| PREDICTED: pyruvate dehydrogenase E1 component subunit beta, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350413618|ref|XP_003490054.1| PREDICTED: pyruvate dehydrogenase E1 component subunit beta, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|58381888|ref|XP_311527.2| AGAP010421-PA [Anopheles gambiae str. PEST] gi|55242737|gb|EAA07168.2| AGAP010421-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
FB|FBgn0039635 365 CG11876 [Drosophila melanogast 0.956 0.542 0.843 1.5e-90
ZFIN|ZDB-GENE-040426-2173 359 pdhb "pyruvate dehydrogenase ( 0.971 0.559 0.805 8.6e-88
UNIPROTKB|F1N823 360 PDHB "Uncharacterized protein" 1.0 0.575 0.787 6e-87
WB|WBGene00015413 352 pdhb-1 [Caenorhabditis elegans 0.966 0.568 0.8 3.3e-86
RGD|1359146 359 Pdhb "pyruvate dehydrogenase ( 0.971 0.559 0.781 1.8e-85
MGI|MGI:1915513 359 Pdhb "pyruvate dehydrogenase ( 0.971 0.559 0.781 3e-85
UNIPROTKB|C9J634 350 PDHB "Pyruvate dehydrogenase E 0.971 0.574 0.781 6.2e-85
UNIPROTKB|F8WF02251 PDHB "Pyruvate dehydrogenase E 0.971 0.800 0.781 6.2e-85
UNIPROTKB|P11177 359 PDHB "Pyruvate dehydrogenase E 0.971 0.559 0.781 6.2e-85
UNIPROTKB|Q5RE79 359 PDHB "Pyruvate dehydrogenase E 0.971 0.559 0.781 6.2e-85
FB|FBgn0039635 CG11876 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 903 (322.9 bits), Expect = 1.5e-90, P = 1.5e-90
 Identities = 167/198 (84%), Positives = 186/198 (93%)

Query:     1 MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
             MTVRDALNSALD+E+ARD++VF+LGEEVA YDGAYKVSRGLWKKYGDKRV+DTPITE+GF
Sbjct:    29 MTVRDALNSALDDELARDDRVFILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGF 88

Query:    61 AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
             AGIAVGAAMAGLRPVCEFMT+NFSMQAIDHIINSAAKTFYMSAG VNVPIVFRGPNGAAS
Sbjct:    89 AGIAVGAAMAGLRPVCEFMTWNFSMQAIDHIINSAAKTFYMSAGAVNVPIVFRGPNGAAS 148

Query:   121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
             GVAAQHSQCF AW+  CPGLKV+SPY++EDA+GLLK+AIRDPDPVVFLENEL+YG  +P+
Sbjct:   149 GVAAQHSQCFAAWYAHCPGLKVLSPYDAEDARGLLKSAIRDPDPVVFLENELVYGTAFPV 208

Query:   181 GDEALSKDFVLPIGKAKV 198
              D    KDF++PIGKAKV
Sbjct:   209 ADNVADKDFLVPIGKAKV 226
GO:0004739 "pyruvate dehydrogenase (acetyl-transferring) activity" evidence=ISS
GO:0045254 "pyruvate dehydrogenase complex" evidence=ISS
GO:0006090 "pyruvate metabolic process" evidence=ISS
GO:0006086 "acetyl-CoA biosynthetic process from pyruvate" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0031122 "cytoplasmic microtubule organization" evidence=IMP
ZFIN|ZDB-GENE-040426-2173 pdhb "pyruvate dehydrogenase (lipoamide) beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N823 PDHB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00015413 pdhb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1359146 Pdhb "pyruvate dehydrogenase (lipoamide) beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915513 Pdhb "pyruvate dehydrogenase (lipoamide) beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9J634 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8WF02 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P11177 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RE79 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P37941ODBB_BACSU1, ., 2, ., 4, ., 40.45770.95650.6055yesN/A
P11966ODPB_BOVIN1, ., 2, ., 4, ., 10.77110.97100.5598yesN/A
Q5SLR3ODBB_THET81, ., 2, ., 4, ., 40.45270.95650.6111yesN/A
Q5HQ75ODPB_STAEQ1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
Q72GU2ODBB_THET21, ., 2, ., 4, ., 40.44770.95650.6111yesN/A
P32473ODPB_YEAST1, ., 2, ., 4, ., 10.67160.96610.5464yesN/A
Q8CPN2ODPB_STAES1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
Q0J0H4ODPB2_ORYSJ1, ., 2, ., 4, ., 10.74120.97100.5345yesN/A
Q6GAC0ODPB_STAAS1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
Q5HGZ0ODPB_STAAC1, ., 2, ., 4, ., 10.39300.95650.6092yesN/A
P11177ODPB_HUMAN1, ., 2, ., 4, ., 10.78100.97100.5598yesN/A
Q9R9N4ODPB_RHIME1, ., 2, ., 4, ., 10.66330.94200.4239yesN/A
O44451ODPB_CAEEL1, ., 2, ., 4, ., 10.80.96610.5681yesN/A
O66113ODPB_ZYMMO1, ., 2, ., 4, ., 10.6550.95160.4264yesN/A
Q86HX0ODPB_DICDI1, ., 2, ., 4, ., 10.66160.97100.5646yesN/A
Q6GHZ1ODPB_STAAR1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
Q09171ODPB_SCHPO1, ., 2, ., 4, ., 10.730.96610.5464yesN/A
Q38799ODPB1_ARATH1, ., 2, ., 4, ., 10.73630.97100.5537yesN/A
Q5RE79ODPB_PONAB1, ., 2, ., 4, ., 10.78100.97100.5598yesN/A
Q9D051ODPB_MOUSE1, ., 2, ., 4, ., 10.78100.97100.5598yesN/A
Q1RJX3ODPB_RICBR1, ., 2, ., 4, ., 10.64170.95160.6061yesN/A
Q68XA8ODPB_RICTY1, ., 2, ., 4, ., 10.63680.95160.6042yesN/A
P99063ODPB_STAAN1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
Q4UKQ7ODPB_RICFE1, ., 2, ., 4, ., 10.62180.95160.6042yesN/A
P49432ODPB_RAT1, ., 2, ., 4, ., 10.78100.97100.5598yesN/A
Q92IS2ODPB_RICCN1, ., 2, ., 4, ., 10.63540.94200.5981yesN/A
P0A0A2ODPB_STAAW1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
Q9ZDR3ODPB_RICPR1, ., 2, ., 4, ., 10.64170.95160.6042yesN/A
P0A0A3ODPB_STAAU1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A
P0A0A1ODPB_STAAM1, ., 2, ., 4, ., 10.38800.95650.6092yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.40.921
4th Layer1.2.4.10.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
PLN02683 356 PLN02683, PLN02683, pyruvate dehydrogenase E1 comp 1e-138
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 1e-131
PTZ00182 355 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydro 1e-121
PRK09212 327 PRK09212, PRK09212, pyruvate dehydrogenase subunit 1e-116
COG0022 324 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogena 1e-114
cd07036167 cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PY 1e-109
CHL00144 327 CHL00144, odpB, pyruvate dehydrogenase E1 componen 4e-69
pfam02779172 pfam02779, Transket_pyr, Transketolase, pyrimidine 4e-54
smart00861136 smart00861, Transket_pyr, Transketolase, pyrimidin 8e-31
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 3e-27
cd07033156 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) bin 5e-18
COG3958 312 COG3958, COG3958, Transketolase, C-terminal subuni 4e-04
PRK05444 580 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate 0.002
>gnl|CDD|215368 PLN02683, PLN02683, pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information 
 Score =  390 bits (1003), Expect = e-138
 Identities = 152/201 (75%), Positives = 174/201 (86%)

Query: 1   MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
           MTVRDALNSALDEEM+ D KVF++GEEV  Y GAYK+++GL +KYG  RVLDTPITE GF
Sbjct: 27  MTVRDALNSALDEEMSADPKVFIMGEEVGEYQGAYKITKGLLQKYGPDRVLDTPITEAGF 86

Query: 61  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
            GI VGAA AGL+PV EFMTFNFSMQAIDHIINSAAKT YMSAG ++VPIVFRGPNGAA+
Sbjct: 87  TGIGVGAAYAGLKPVVEFMTFNFSMQAIDHIINSAAKTNYMSAGQISVPIVFRGPNGAAA 146

Query: 121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
           GV AQHSQCF AW++  PGLKV++PY+SEDA+GLLKAAIRDPDPVVFLENELLYG  +P+
Sbjct: 147 GVGAQHSQCFAAWYSSVPGLKVLAPYSSEDARGLLKAAIRDPDPVVFLENELLYGESFPV 206

Query: 181 GDEALSKDFVLPIGKAKVEKQ 201
             E L   FVLPIGKAK+E++
Sbjct: 207 SAEVLDSSFVLPIGKAKIERE 227

Length = 356
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|185502 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169719 PRK09212, PRK09212, pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|223101 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132919 cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>gnl|CDD|177066 CHL00144, odpB, pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>gnl|CDD|217226 pfam02779, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|214865 smart00861, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|132916 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>gnl|CDD|226467 COG3958, COG3958, Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|235470 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
COG0022 324 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 100.0
CHL00144 327 odpB pyruvate dehydrogenase E1 component beta subu 100.0
PRK09212 327 pyruvate dehydrogenase subunit beta; Validated 100.0
PLN02683 356 pyruvate dehydrogenase E1 component subunit beta 100.0
KOG0524|consensus 359 100.0
PTZ00182 355 3-methyl-2-oxobutanate dehydrogenase; Provisional 100.0
COG3958 312 Transketolase, C-terminal subunit [Carbohydrate tr 100.0
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 100.0
KOG0525|consensus 362 100.0
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 100.0
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 100.0
PLN02234641 1-deoxy-D-xylulose-5-phosphate synthase 100.0
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 100.0
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 100.0
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 100.0
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 100.0
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 100.0
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 100.0
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 100.0
PRK05899 624 transketolase; Reviewed 100.0
smart00861168 Transket_pyr Transketolase, pyrimidine binding dom 100.0
PTZ00089 661 transketolase; Provisional 100.0
PRK12753 663 transketolase; Reviewed 100.0
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 100.0
PRK12754 663 transketolase; Reviewed 100.0
PLN02790 654 transketolase 100.0
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 100.0
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 100.0
KOG0523|consensus 632 99.97
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 99.97
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 99.96
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 99.95
COG0021 663 TktA Transketolase [Carbohydrate transport and met 99.89
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.53
PRK05261 785 putative phosphoketolase; Provisional 99.43
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 98.34
PRK08659 376 2-oxoglutarate ferredoxin oxidoreductase subunit a 98.31
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 98.27
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 98.26
COG4231 640 Indolepyruvate ferredoxin oxidoreductase, alpha an 98.26
PRK07119 352 2-ketoisovalerate ferredoxin reductase; Validated 98.18
TIGR03710 562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 98.09
PRK09627 375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 98.07
PRK08366 390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 97.87
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 97.83
PRK09622 407 porA pyruvate flavodoxin oxidoreductase subunit al 97.8
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 97.79
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 97.75
PF03894179 XFP: D-xylulose 5-phosphate/D-fructose 6-phosphate 97.7
PRK08367 394 porA pyruvate ferredoxin oxidoreductase subunit al 97.52
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 97.48
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 97.44
KOG0451|consensus 913 97.44
KOG0450|consensus 1017 97.26
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.24
TIGR03297 361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 97.15
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 97.07
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 96.85
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 96.84
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 96.68
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 96.64
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 96.45
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 96.41
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 96.39
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 96.35
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 96.33
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 96.31
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 96.28
COG0674 365 PorA Pyruvate:ferredoxin oxidoreductase and relate 96.16
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 95.97
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 95.95
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 95.94
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 95.85
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 95.78
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 95.76
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase 95.74
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 95.69
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 95.65
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 95.6
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 95.59
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 95.54
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 95.52
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 95.51
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 95.5
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 95.5
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 95.42
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 95.39
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 95.38
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 95.36
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 95.33
PRK07092 530 benzoylformate decarboxylase; Reviewed 95.32
PLN02470 585 acetolactate synthase 95.31
PRK08155564 acetolactate synthase catalytic subunit; Validated 95.3
PRK08199 557 thiamine pyrophosphate protein; Validated 95.27
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 95.24
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 95.23
PRK08322 547 acetolactate synthase; Reviewed 95.23
PRK08155 564 acetolactate synthase catalytic subunit; Validated 95.21
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 95.2
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 95.12
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 95.03
PRK08611 576 pyruvate oxidase; Provisional 94.92
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 94.88
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 94.83
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 94.77
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 94.7
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 94.68
PRK05858 542 hypothetical protein; Provisional 94.47
PRK07586 514 hypothetical protein; Validated 94.46
PRK11269 591 glyoxylate carboligase; Provisional 94.42
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 94.41
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 94.41
PRK06163202 hypothetical protein; Provisional 94.24
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 94.18
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 94.17
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 94.14
PRK07064 544 hypothetical protein; Provisional 94.06
PRK09124 574 pyruvate dehydrogenase; Provisional 94.06
PRK06457 549 pyruvate dehydrogenase; Provisional 94.03
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 94.01
PRK08617 552 acetolactate synthase; Reviewed 93.98
PRK06112 578 acetolactate synthase catalytic subunit; Validated 93.95
PRK07449 568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 93.94
PRK06457549 pyruvate dehydrogenase; Provisional 93.9
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 93.83
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 93.79
PRK08617552 acetolactate synthase; Reviewed 93.75
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 93.74
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 93.59
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 93.59
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 93.56
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 93.55
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 93.31
PRK08266542 hypothetical protein; Provisional 93.18
PRK07524 535 hypothetical protein; Provisional 93.17
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 92.97
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 92.88
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 92.81
PRK05858542 hypothetical protein; Provisional 92.74
PRK12474 518 hypothetical protein; Provisional 92.69
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 92.6
PRK08322547 acetolactate synthase; Reviewed 92.58
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 92.56
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 92.5
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 92.44
PRK06546578 pyruvate dehydrogenase; Provisional 92.43
PRK06546 578 pyruvate dehydrogenase; Provisional 92.42
PRK08266 542 hypothetical protein; Provisional 92.37
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 92.21
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 92.1
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 92.09
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 92.06
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 91.75
TIGR00173 432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 91.55
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 91.42
PRK08273 597 thiamine pyrophosphate protein; Provisional 91.32
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 91.3
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 91.28
PRK06112578 acetolactate synthase catalytic subunit; Validated 91.13
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 91.04
PRK07092530 benzoylformate decarboxylase; Reviewed 91.02
PRK07064544 hypothetical protein; Provisional 90.97
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 90.79
PRK09124574 pyruvate dehydrogenase; Provisional 90.68
TIGR03393 539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 90.68
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 90.44
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 90.4
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 90.39
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 90.22
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 90.19
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 90.1
PRK07524535 hypothetical protein; Provisional 89.98
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 89.89
PRK08273597 thiamine pyrophosphate protein; Provisional 89.79
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 89.74
PRK06154565 hypothetical protein; Provisional 89.62
PRK08199557 thiamine pyrophosphate protein; Validated 89.6
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 89.44
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 89.42
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 89.2
PRK08327 569 acetolactate synthase catalytic subunit; Validated 89.15
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 88.94
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 88.65
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 88.49
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 88.39
PRK11269591 glyoxylate carboligase; Provisional 88.06
PRK12474518 hypothetical protein; Provisional 87.37
PRK07586514 hypothetical protein; Validated 87.22
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 87.11
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 87.06
PRK06154 565 hypothetical protein; Provisional 86.97
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 86.88
CHL00099585 ilvB acetohydroxyacid synthase large subunit 86.59
PLN02470585 acetolactate synthase 85.99
PLN02573 578 pyruvate decarboxylase 85.79
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 85.35
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 85.26
PRK08327569 acetolactate synthase catalytic subunit; Validated 84.8
PRK08611576 pyruvate oxidase; Provisional 84.69
PRK05899 624 transketolase; Reviewed 84.37
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 83.46
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 83.29
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 83.06
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 82.82
KOG0225|consensus394 82.35
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 81.19
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 80.13
>COG0022 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-63  Score=418.52  Aligned_cols=203  Identities=53%  Similarity=0.857  Sum_probs=196.9

Q ss_pred             CcHHHHHHHHHHHHHhcCCcEEEEecCCCccCCchhhchhhhhhcCCCceeeccchhHHHHHHHHHHHhcCCccEEEech
Q psy10429          1 MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMT   80 (207)
Q Consensus         1 ~~~~~a~~~~L~~~~~~~~~vv~~~~D~~~~~g~~~~~~~l~~~~g~~r~~~~gIaE~~~vg~A~GlA~~G~~pi~~~~~   80 (207)
                      ++|++|++++|.+.|++|++++++|+|++..||+|++|++|.++||++|++||||+|.+++|+|.|+|+.|+||++++||
T Consensus         2 ~~~~eAi~~Am~~eM~rD~~V~v~GEDVg~~GGvf~~T~GL~~kfG~~RV~DTPiaE~gi~G~avGaA~~GlrPivEiqf   81 (324)
T COG0022           2 MTMIEAINEAMDEEMERDERVVVLGEDVGVYGGVFRVTKGLQEKFGEERVIDTPIAESGIAGIAVGAALTGLRPIVEIQF   81 (324)
T ss_pred             ccHHHHHHHHHHHHHhcCCCEEEEcccccccCChhhhchhHHHHhCccceecCccchhhhHHHHHHHHHcCCcceEEEEe
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHhhhhhhccCCccCCEEEEeCCCCCCCCCCCCchhHhHHHcCCCCcEEEeeCCHHHHHHHHHHHHc
Q psy10429         81 FNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIR  160 (207)
Q Consensus        81 ~~~~~ra~dqi~~~~a~~~~~~~~~~~~pvvi~~~~G~~~g~~~hhs~~~~a~~~~iPgl~v~~P~~~~e~~~ll~~a~~  160 (207)
                      .+|++.|+|||.|+++|++|||||+.++|+++|++.|+..+++.||||+.++++.++||+||++||+|+|+++||++|++
T Consensus        82 ~dF~~~a~dqi~n~aAk~ryrsgG~~~~PiviR~p~G~g~~~~~~HSqs~ea~f~h~PGlKVV~PStpyDAKGLL~aAIr  161 (324)
T COG0022          82 ADFIYPAFDQIVNQAAKIRYRSGGQFTVPIVIRTPNGGGIGGGAQHSQSLEALFAHIPGLKVVMPSTPYDAKGLLKAAIR  161 (324)
T ss_pred             cchhHHHHHHHHHHHHHHhhhcCCceeCCEEEEcCCCCCCCchhhccCCHHHHHhcCCCceEEecCChHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEEECccccc-ccCCCCcccCCCCccccCCceEEEEeCCceec
Q psy10429        161 DPDPVVFLENELLYG-VQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL  207 (207)
Q Consensus       161 ~~~P~~i~~~k~l~~-~~~~~~~~~~~~~~~~~~Gka~v~r~G~dvti  207 (207)
                      +++||+|+|||.||+ .+++    +++++|.+|+|||+|+|+|+||||
T Consensus       162 d~dPViflE~k~lY~~~~~e----VP~~~Y~iPlGkA~i~reG~DvTi  205 (324)
T COG0022         162 DPDPVIFLEHKRLYRSFKGE----VPEEDYTIPLGKAKIVREGSDVTI  205 (324)
T ss_pred             CCCCEEEEecHHHhcccccC----CCCCCccccccceeeEecCCceEE
Confidence            999999999999998 4444    457899999999999999999997

>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>PLN02683 pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>KOG0524|consensus Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>KOG0525|consensus Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>KOG0523|consensus Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PF03894 XFP: D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase; InterPro: IPR005593 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>KOG0451|consensus Back     alignment and domain information
>KOG0450|consensus Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>KOG0225|consensus Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2ozl_B 341 Human Pyruvate Dehydrogenase S264e Variant Length = 1e-94
3exe_B 329 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-94
1ni4_B 341 Human Pyruvate Dehydrogenase Length = 341 1e-82
1um9_B 324 Branched-chain 2-oxo Acid Dehydrogenase (e1) From T 6e-41
1ik6_A 369 3d Structure Of The E1beta Subunit Of Pyruvate Dehy 6e-41
1w85_B 324 The Crystal Structure Of Pyruvate Dehydrogenase E1 1e-36
3duf_B 325 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 1e-36
2bp7_B 339 New Crystal Form Of The Pseudomonas Putida Branched 5e-33
1qs0_B 338 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 3e-32
1dtw_B 342 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 4e-29
2j9f_B 350 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 5e-29
1olx_B 342 Roles Of His291-alpha And His146-beta' In The Reduc 7e-28
>pdb|2OZL|B Chain B, Human Pyruvate Dehydrogenase S264e Variant Length = 341 Back     alignment and structure 
Iteration: 1

 Score =  341 bits (875), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 181/201 (90%)
Query: 1   MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
           +TVRDA+N  +DEE+ RDEKVFLLGEEVA YDGAYKVSRGLWKKYGDKR++DTPI+E+GF
Sbjct: 15  VTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGF 74
Query: 61  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
           AGIAVGAAMAGLRP+CEFMTFNFSMQAID +INSAAKT+YMS G   VPIVFRGPNGA++
Sbjct: 75  AGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASA 134
Query: 121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
           GVAAQHSQCF AW+  CPGLKVVSP+NSEDAKGL+K+AIRD +PVV LENEL+YGV +  
Sbjct: 135 GVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEF 194
Query: 181 GDEALSKDFVLPIGKAKVEKQ 201
             EA SKDF++PIGKAK+E+Q
Sbjct: 195 PPEAQSKDFLIPIGKAKIERQ 215
>pdb|3EXE|B Chain B, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 329 Back     alignment and structure
>pdb|1NI4|B Chain B, Human Pyruvate Dehydrogenase Length = 341 Back     alignment and structure
>pdb|1UM9|B Chain B, Branched-chain 2-oxo Acid Dehydrogenase (e1) From Thermus Thermophilus Hb8 In Apo-form Length = 324 Back     alignment and structure
>pdb|1IK6|A Chain A, 3d Structure Of The E1beta Subunit Of Pyruvate Dehydrogenase From The Archeon Pyrobaculum Aerophilum Length = 369 Back     alignment and structure
>pdb|1W85|B Chain B, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 324 Back     alignment and structure
>pdb|3DUF|B Chain B, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 325 Back     alignment and structure
>pdb|2BP7|B Chain B, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 339 Back     alignment and structure
>pdb|1QS0|B Chain B, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 338 Back     alignment and structure
>pdb|1DTW|B Chain B, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 342 Back     alignment and structure
>pdb|2J9F|B Chain B, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 350 Back     alignment and structure
>pdb|1OLX|B Chain B, Roles Of His291-alpha And His146-beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-chain Alpha-ketoacid Dehydrogenase Length = 342 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2ozl_B 341 PDHE1-B, pyruvate dehydrogenase E1 component subun 1e-138
1w85_B 324 Pyruvate dehydrogenase E1 component, beta subunit; 1e-102
1umd_B 324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 1e-101
1ik6_A 369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 4e-97
1qs0_B 338 2-oxoisovalerate dehydrogenase beta-subunit; heter 2e-92
2bfd_B 342 2-oxoisovalerate dehydrogenase beta subunit; oxido 1e-87
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Length = 341 Back     alignment and structure
 Score =  389 bits (1002), Expect = e-138
 Identities = 157/201 (78%), Positives = 181/201 (90%)

Query: 1   MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
           +TVRDA+N  +DEE+ RDEKVFLLGEEVA YDGAYKVSRGLWKKYGDKR++DTPI+E+GF
Sbjct: 15  VTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGF 74

Query: 61  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
           AGIAVGAAMAGLRP+CEFMTFNFSMQAID +INSAAKT+YMS G   VPIVFRGPNGA++
Sbjct: 75  AGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASA 134

Query: 121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
           GVAAQHSQCF AW+  CPGLKVVSP+NSEDAKGL+K+AIRD +PVV LENEL+YGV +  
Sbjct: 135 GVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEF 194

Query: 181 GDEALSKDFVLPIGKAKVEKQ 201
             EA SKDF++PIGKAK+E+Q
Sbjct: 195 PPEAQSKDFLIPIGKAKIERQ 215
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Length = 324 Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Length = 324 Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Length = 369 Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Length = 338 Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
1w85_B 324 Pyruvate dehydrogenase E1 component, beta subunit; 100.0
1ik6_A 369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 100.0
2ozl_B 341 PDHE1-B, pyruvate dehydrogenase E1 component subun 100.0
1umd_B 324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 100.0
1qs0_B 338 2-oxoisovalerate dehydrogenase beta-subunit; heter 100.0
2bfd_B 342 2-oxoisovalerate dehydrogenase beta subunit; oxido 100.0
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 100.0
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 100.0
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 100.0
3l84_A 632 Transketolase; TKT, structural genomics, center fo 100.0
3uk1_A 711 Transketolase; structural genomics, seattle struct 100.0
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 100.0
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 100.0
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 100.0
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 100.0
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 100.0
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 100.0
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 100.0
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 100.0
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 100.0
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 100.0
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 99.96
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 99.91
1yd7_A 395 2-keto acid:ferredoxin oxidoreductase subunit alph 99.45
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.88
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 96.07
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 96.04
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 95.53
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 94.98
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 94.93
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 94.73
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 94.59
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 94.54
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 94.52
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 94.39
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 94.3
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 94.11
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 94.08
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 93.97
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 93.91
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 93.3
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 93.08
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 93.0
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 92.94
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 92.8
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 92.68
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 92.26
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 92.17
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 92.06
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 91.91
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 91.78
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 91.62
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 91.27
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 90.55
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 90.37
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 90.03
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 89.67
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 89.65
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 89.27
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 89.21
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 88.58
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 88.56
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 88.5
3uk1_A 711 Transketolase; structural genomics, seattle struct 86.12
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 85.64
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 84.54
3l84_A 632 Transketolase; TKT, structural genomics, center fo 84.53
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 84.51
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 83.33
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 83.05
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 83.05
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 82.97
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 82.23
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 82.03
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 81.39
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 80.59
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
Probab=100.00  E-value=9.4e-49  Score=340.88  Aligned_cols=204  Identities=38%  Similarity=0.661  Sum_probs=185.2

Q ss_pred             CcHHHHHHHHHHHHHhcCCcEEEEecCCCccCCchhhchhhhhhcCCCceeeccchhHHHHHHHHHHHhcCCccEEEech
Q psy10429          1 MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMT   80 (207)
Q Consensus         1 ~~~~~a~~~~L~~~~~~~~~vv~~~~D~~~~~g~~~~~~~l~~~~g~~r~~~~gIaE~~~vg~A~GlA~~G~~pi~~~~~   80 (207)
                      +++|++++++|.+++++||+++++++|++.++|+++.+++|+++|||+||+|+||+|++|+++|+|+|++|++||+++++
T Consensus         3 ~~~~~a~~~~L~~l~~~~~~vv~~~~d~~~~~g~~~~~~~~~~~~gp~r~~~~gIaE~~~v~~a~G~A~~G~rp~~~~t~   82 (324)
T 1w85_B            3 MTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGLQAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQF   82 (324)
T ss_dssp             ECHHHHHHHHHHHHHHHCTTEEEEETTCSTTCCTTSTTTTHHHHHCTTTEEECCSCHHHHHHHHHHHHHTTCEEEEBCSS
T ss_pred             chHHHHHHHHHHHHHhHCcCEEEEcCcccccCCcchhHHHHHHHhCCCcEEEcchhHHHHHHHHHHHHhCCCEEEEEecc
Confidence            47999999999999999999999999998888998888999999977999999999999999999999999999999655


Q ss_pred             hhHHHHHHHHHHHHHhhhhhhccCCccCCEEEEeCCCCCCCCCCCCchhHhHHHcCCCCcEEEeeCCHHHHHHHHHHHHc
Q psy10429         81 FNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIR  160 (207)
Q Consensus        81 ~~~~~ra~dqi~~~~a~~~~~~~~~~~~pvvi~~~~G~~~g~~~hhs~~~~a~~~~iPgl~v~~P~~~~e~~~ll~~a~~  160 (207)
                      ..|++|++|||++++++++|+++|++++|++++.+.|....+++||+++++++++++|||+|++|+|+.|+++++++|++
T Consensus        83 ~~F~~~a~dqi~~~~a~~~~~~~g~~~~pvv~~~~~g~~~~~g~~hs~~~~a~~~~iP~l~V~~Psd~~e~~~~l~~a~~  162 (324)
T 1w85_B           83 FGFVYEVMDSICGQMARIRYRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLISAIR  162 (324)
T ss_dssp             GGGGGGTHHHHHTTGGGHHHHTTTSSCCCCEEEEEECSSSCCCTTSSCCCHHHHTTSTTCEEECCSSHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHhhhccCCCcCCEEEEEeccCCCCCCCcccccHHHHHccCCCCEEEeeCCHHHHHHHHHHHHH
Confidence            56789999999999999999999999999999976555555678999999999999999999999999999999999999


Q ss_pred             CCCcEEEEECcccccccCCCCcccCCCCccccCCceEEEEeCCceec
Q psy10429        161 DPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQVIMKTL  207 (207)
Q Consensus       161 ~~~P~~i~~~k~l~~~~~~~~~~~~~~~~~~~~Gka~v~r~G~dvti  207 (207)
                      .++|++||+||.+++...+   .++++++.+++||++++++|+|++|
T Consensus       163 ~~~Pv~i~~p~~l~r~~~~---~~~~~~~~~~~Gk~~~~~~g~dv~i  206 (324)
T 1w85_B          163 DNDPVIFLEHLKLYRSFRQ---EVPEGEYTIPIGKADIKREGKDITI  206 (324)
T ss_dssp             SSSCEEEEEETTTSSSCCE---ECCSSCCCCCTTCCEEEECCSSEEE
T ss_pred             cCCCEEEEechHhcCCCCC---CCCCccccccCCceEEEecCCCEEE
Confidence            9999999999999875221   2345667799999999999999986
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d2ozlb1192 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate deh 6e-66
d1qs0b1204 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase 6e-60
d1w85b1192 c.36.1.7 (B:1-192) Pyruvate dehydrogenase E1-beta, 1e-58
d1ik6a1191 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate deh 1e-53
d2bfdb1203 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid 1e-52
d1umdb1186 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid 3e-45
d2r8oa1195 c.36.1.6 (A:333-527) Transketolase (TK), Pyr modul 5e-05
>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase Pyr module
domain: E1-beta subunit of pyruvate dehydrogenase, Pyr module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  199 bits (507), Expect = 6e-66
 Identities = 149/189 (78%), Positives = 169/189 (89%)

Query: 1   MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGF 60
           +TVRDA+N  +DEE+ RDEKVFLLGEEVA YDGAYKVSRGLWKKYGDKR++DTPI+E+GF
Sbjct: 4   VTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGF 63

Query: 61  AGIAVGAAMAGLRPVCEFMTFNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAAS 120
           AGIAVGAAMAGLRP+CEFMTFNFSMQAID +INSAAKT+YMS G   VPIVFRGPNGA++
Sbjct: 64  AGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASA 123

Query: 121 GVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPM 180
           GVAAQHSQCF AW+  CPGLKVVSP+NSEDAKGL+K+AIRD +PVV LENEL+YGV +  
Sbjct: 124 GVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEF 183

Query: 181 GDEALSKDF 189
             EA SKDF
Sbjct: 184 PPEAQSKDF 192
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Length = 204 Back     information, alignment and structure
>d1w85b1 c.36.1.7 (B:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 192 Back     information, alignment and structure
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 191 Back     information, alignment and structure
>d2bfdb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure
>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} Length = 186 Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 100.0
d1w85b1192 Pyruvate dehydrogenase E1-beta, PdhB, N-terminal d 100.0
d2ozlb1192 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 100.0
d1ik6a1191 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 100.0
d1umdb1186 Branched-chain alpha-keto acid dehydrogenase, Pyr 100.0
d2bfdb1203 Branched-chain alpha-keto acid dehydrogenase, Pyr 100.0
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 100.0
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 100.0
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 100.0
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 100.0
d2ieaa1230 Pyruvate dehydrogenase E1 component, Pyr module {E 98.42
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 97.82
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 97.49
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 97.16
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 97.07
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 96.8
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 96.74
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 96.52
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 96.17
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 96.11
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 96.02
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 95.91
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 95.77
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 95.66
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 95.58
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 95.52
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 95.31
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 95.21
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 94.95
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 93.42
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 93.37
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 92.7
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 91.94
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 84.34
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase Pyr module
domain: 2-oxoisovalerate dehydrogenase (E1B), Pyr module
species: Pseudomonas putida [TaxId: 303]

Probab=100.00  E-value=3.3e-59  Score=380.10  Aligned_cols=198  Identities=39%  Similarity=0.579  Sum_probs=188.7

Q ss_pred             CcHHHHHHHHHHHHHhcCCcEEEEecCCCccCCchhhchhhhhhcCCCceeeccchhHHHHHHHHHHHhcCCccEEEech
Q psy10429          1 MTVRDALNSALDEEMARDEKVFLLGEEVALYDGAYKVSRGLWKKYGDKRVLDTPITEIGFAGIAVGAAMAGLRPVCEFMT   80 (207)
Q Consensus         1 ~~~~~a~~~~L~~~~~~~~~vv~~~~D~~~~~g~~~~~~~l~~~~g~~r~~~~gIaE~~~vg~A~GlA~~G~~pi~~~~~   80 (207)
                      |||++|++++|.++|++|++++++|+|++..||+|+++++|.++|||+|++|+||+|++|+|+|+|+|++|++||+++++
T Consensus         5 m~~~~ai~~al~e~m~~d~~v~~~Gedv~~~Gg~f~~t~gl~~kfgp~Rv~dtpIaE~~~vG~A~GlA~~G~rPvve~~~   84 (204)
T d1qs0b1           5 MTMIQALRSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQTKYGKSRVFDAPISESGIVGTAVGMGAYGLRPVVEIQF   84 (204)
T ss_dssp             CCHHHHHHHHHHHHHHHCTTEEEEETTCSSSCCTTSTTTTHHHHHCTTTEEECCSCHHHHHHHHHHHHHHTCEEEEECSC
T ss_pred             ehHHHHHHHHHHHHHhhCCCEEEEecCCCccCCccccchHHHHHHhhhheecccccceeehhHHHHHhcCCCcEEEEEEe
Confidence            68999999999999999999999999999899999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHhhhhhhccCCccCCEEEEeCCCCCCCCCCCCchhHhHHHcCCCCcEEEeeCCHHHHHHHHHHHHc
Q psy10429         81 FNFSMQAIDHIINSAAKTFYMSAGTVNVPIVFRGPNGAASGVAAQHSQCFGAWFTQCPGLKVVSPYNSEDAKGLLKAAIR  160 (207)
Q Consensus        81 ~~~~~ra~dqi~~~~a~~~~~~~~~~~~pvvi~~~~G~~~g~~~hhs~~~~a~~~~iPgl~v~~P~~~~e~~~ll~~a~~  160 (207)
                      .+|+++|+|||+|+++|++||++++.++|++++++.|...++++||||+++++|+++|||+|++|+|+.|+++|+++|++
T Consensus        85 ~df~~~a~dqi~n~~ak~~~~~~~~~~~p~vir~~~g~~~~~g~~Hs~~~~s~~~~iPgl~Vv~Ps~~~da~~ll~~a~~  164 (204)
T d1qs0b1          85 ADYFYPASDQIVSEMARLRYRSAGEFIAPLTLRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIE  164 (204)
T ss_dssp             GGGCGGGHHHHHTTTTTHHHHTTTSSCCCCEEEEEECCSSSCCSSSSCCCHHHHTTSTTCEEECCCSHHHHHHHHHHHHH
T ss_pred             cchhhHHHHHHHHHHHHhhcccccCcccceEEEcCcccccCcccccccCHHHHHhcCCCcEEEeeCCHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999888888899999999999999999999999999999999999999


Q ss_pred             CCCcEEEEECcccccccCCCCcccCCCCccccCCc--eEEEEeC
Q psy10429        161 DPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGK--AKVEKQV  202 (207)
Q Consensus       161 ~~~P~~i~~~k~l~~~~~~~~~~~~~~~~~~~~Gk--a~v~r~G  202 (207)
                      +++||+|+|||+||+.++++    +++.+.+|+||  +.++|+|
T Consensus       165 ~~~Pvi~~e~k~ly~~~~~~----~~~~~~~p~~~~~~~~v~~G  204 (204)
T d1qs0b1         165 CDDPVIFLEPKRLYNGPFDG----HHDRPVTPWSKHPHSAVPDG  204 (204)
T ss_dssp             SSSCEEEEEEGGGSSSCCCS----CSSSCCCCSTTSTTCEEESS
T ss_pred             CCCcEEEEeeHHHhCCCccC----CCccCCCCcccCccccCCCC
Confidence            99999999999999987654    34567788887  8899987
>d1w85b1 c.36.1.7 (B:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bfdb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ieaa1 c.36.1.6 (A:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure