Psyllid ID: psy10533

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MSLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTISRHVSSRESVLSSDSSVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILIR
ccccccccccccccccccccEEEEccccccccccccccccccccccccEEEccEEccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEEccEEEEccccccccccccccccccccccccEEcccccccHHHHHHHHHcccccccccccccccccccEEEccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEcccccccHHHHHHHcccccccccccEEccccEEEccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHccccccccccEEEcccEEcccccEEccccccccccEEEEccEEEccccHHcccccccccccccEEcccEEEEcccccccccccccccEEEEccEEccHHHHHHHccccccccccccccccEEEEEEccccccccccccccEEEEEc
ccccccccccccccEccccEEEEEcccccccccEEEEHcccccccccEEEEccccccHHHHHHHcccHHHHccccccccEEEEEEcccccccccEEEHHccccccccccccccccccHHHHHHccccccccccEEcccccccccccccccccccccccEEEEcccccccccEEEHHccccccccccEEcccccccHHHHHHHccccccccccccccccccccEEEEcccccccccEEEEccccccccccEEEccccccccccccccccHHHHHHHHccHHccccccccccEEEEcccccccccEEEHHccccccccccEccccccccHHHHHHHHcHHHccccccccccEEEEcccccccccccccccHHHHHcccccHHHHccccccccEEEcccccccccccEEEEcccccccccEEEHHccccccccccEccccccccHHHHHHHHccHHccccccccccEEEEccccccccccccccccEcccccccccHHHHHHHHcHHcccccccEEcccEEEEcccccccccEEEccccEccccccccHHHHHHHHccHcccccccccccEEEccccHHHHHHHHccccHHHHHHcc
mslgnmycsrcnegfepeekivnsngelwhqqcfvcaqcfrpfpggifyefegrkycehdfhvlfapccgngcpslSTFAISLAGeisgwyppclkitmslgnmycfplqrrfrargedrqtltggawhqqcfvcaqcfrpfpggifyefeGEFVIGRVIKAMnanwhpkcfrcehcSKELADLGFIRSQGRALCHECNAQAKAvgfgkhmchkchgliddkplkfrgevyhpyhfnctscgtelnsdarevksrpgytandmnelyclrchdkmgipicgacrrpIEERVVTALGKhwhvehfvcarcekpflghrhyekkGLAYCETHYHQLFGNLCFVCnqviggdeshyitSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFAcstlgkhwhvehfvcarcekpflghrhyekkGLAYCETHYHQLFGNLcfvcnqnhtisLHVSsreavlssdssvfglrhyEKKGLAYCETHYHQLFGNLcfvcnqdhtisrhvssresvlssdssvfglrhyeknGLAYCETHYHQLFGNLCFVCnqviggdpgtvktnlvdarsrvrfpswatfilir
MSLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTscgtelnsdarEVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTISrhvssresvlssdssVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVktnlvdarsrvrfpswatfilir
MSLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTIsrhvssresvlssdssvFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILIR
******YCSRCNEGFE*EEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELN**********GYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTISRH************SVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILI*
*SLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTISRHVSSRESVLSSDSSVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILIR
MSLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTIS**************SVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILIR
*SLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTISRHVSSRESVLSSDSSVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHTISLHVSSREAVLSSDSSVFGLRHYEKKGLAYCETHYHQLFGNLCFVCNQDHTISRHVSSRESVLSSDSSVFGLRHYEKNGLAYCETHYHQLFGNLCFVCNQVIGGDPGTVKTNLVDARSRVRFPSWATFILIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query594 2.2.26 [Sep-21-2011]
Q2KJ33341 LIM and senescent cell an yes N/A 0.469 0.818 0.498 9e-90
Q7Z4I7341 LIM and senescent cell an yes N/A 0.469 0.818 0.498 1e-89
Q91XD2341 LIM and senescent cell an yes N/A 0.437 0.762 0.527 3e-88
P48059325 LIM and senescent cell an no N/A 0.409 0.747 0.525 1e-86
Q99JW4325 LIM and senescent cell an no N/A 0.409 0.747 0.525 2e-86
P50464348 LIM domain-containing pro yes N/A 0.432 0.738 0.5 1e-83
Q19157330 LIM domain-containing pro no N/A 0.365 0.657 0.354 2e-39
Q54NW4553 LIM domain-containing pro yes N/A 0.356 0.383 0.331 3e-29
Q8MML5569 Paxillin-B OS=Dictyosteli no N/A 0.363 0.379 0.316 2e-28
Q8VI36591 Paxillin OS=Mus musculus no N/A 0.329 0.331 0.323 7e-27
>sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 Back     alignment and function desciption
 Score =  331 bits (849), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 179/359 (49%), Positives = 217/359 (60%), Gaps = 80/359 (22%)

Query: 97  ITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEG---- 152
           ++ +L N  C   Q RF A  E      G  +H+ CFVCAQCFRPFP G+FYEFEG    
Sbjct: 6   MSNALANAVCQRCQARF-APAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYC 64

Query: 153 ----------------EFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCH 196
                           EF+IGRVIKAMN NWHP CFRCE C  ELADLGF+++ GR LC 
Sbjct: 65  EHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRHLCR 124

Query: 197 ECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRP 256
            C+ + KA G GK++C +CH +ID++PL F+ + YHP HF+CT CG EL ++ARE+K   
Sbjct: 125 PCHNREKAKGLGKYICQRCHLVIDEQPLMFKNDAYHPDHFSCTHCGKELTAEARELKG-- 182

Query: 257 GYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGH 316
                   ELYCL CHDKMG+PICGACRRPIE RVV ALGK WHVEHFVCA+CEKPFLGH
Sbjct: 183 --------ELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGH 234

Query: 317 RHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLF 376
           RHYEKKGLAYCETHY+QLFG++C+ C+ VI                              
Sbjct: 235 RHYEKKGLAYCETHYNQLFGDVCYTCSHVI------------------------------ 264

Query: 377 GNLCFVCNQVIGGDLFTALNKAWCVHHFACSTLGKHWHVEHF--------VCARCEKPF 427
                       GD+ +ALNKAWCVH F+CST      +++         VC RC + F
Sbjct: 265 -----------EGDVVSALNKAWCVHCFSCSTCNSRLTLKNKFVEFDMKPVCKRCYEKF 312
Competes with LIMS1 for binding to ILK. Plays a role in modulating cell spreading and migration.
Bos taurus (taxid: 9913)
>sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 Back     alignment and function description
>sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 Back     alignment and function description
>sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 Back     alignment and function description
>sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 Back     alignment and function description
>sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 Back     alignment and function description
>sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 Back     alignment and function description
>sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 Back     alignment and function description
>sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 Back     alignment and function description
>sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
312382680546 hypothetical protein AND_04464 [Anophele 0.483 0.525 0.555 1e-118
321471829342 hypothetical protein DAPPUDRAFT_187931 [ 0.484 0.842 0.565 1e-118
328707525342 PREDICTED: LIM domain-containing protein 0.483 0.839 0.570 1e-118
157128836346 pinch [Aedes aegypti] gi|108882172|gb|EA 0.484 0.832 0.561 1e-117
157128838336 pinch [Aedes aegypti] gi|157128840|ref|X 0.484 0.857 0.561 1e-117
328780833342 PREDICTED: LIM and senescent cell antige 0.449 0.780 0.662 1e-116
340727871342 PREDICTED: LIM and senescent cell antige 0.449 0.780 0.662 1e-116
307182140343 LIM and senescent cell antigen-like-cont 0.449 0.778 0.659 1e-116
332030721337 LIM and senescent cell antigen-like-cont 0.449 0.792 0.659 1e-116
307210658336 LIM and senescent cell antigen-like-cont 0.449 0.794 0.656 1e-116
>gi|312382680|gb|EFR28056.1| hypothetical protein AND_04464 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  432 bits (1110), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 226/407 (55%), Positives = 249/407 (61%), Gaps = 120/407 (29%)

Query: 1   MSLGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHD 60
           MSLG M+C+RC+EGFEP E+IVNSNG+LWH QCFVCAQCFR F  GIFYEFEGRKYCE D
Sbjct: 211 MSLGTMHCTRCDEGFEPHERIVNSNGQLWHTQCFVCAQCFRQFQDGIFYEFEGRKYCEKD 270

Query: 61  FHVLFAPCCGNGCPSLSTFAISLAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDR 120
           FH+LFAPCC       + F I                             R  +A   + 
Sbjct: 271 FHILFAPCCSK----CNDFVIG----------------------------RVIKAMAAN- 297

Query: 121 QTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKAMNANWHPKCFRCEHCSKE 180
                  WH  CF C +C  P                                       
Sbjct: 298 -------WHPHCFTCERCSAP--------------------------------------- 311

Query: 181 LADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTS 240
           LAD GFIR+Q RALCHECN   K+ G  KHMC+KCHG+ID  PL+FRGEVYH YHFNCTS
Sbjct: 312 LADSGFIRNQNRALCHECNRIEKSDGLEKHMCNKCHGVIDGAPLRFRGEVYHGYHFNCTS 371

Query: 241 CGTELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWH 300
           CG+EL+S AREVK+R GY ANDMNELYCLRCHD+MGIPICGACRRPIEERVVTALGKHWH
Sbjct: 372 CGSELDSSAREVKNRSGYAANDMNELYCLRCHDRMGIPICGACRRPIEERVVTALGKHWH 431

Query: 301 VEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELT 360
           VEHFVCA+CEKPFLGHRHYEK+GLAYCETHYHQLFGNLCFVCNQVIG             
Sbjct: 432 VEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVIG------------- 478

Query: 361 YKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHFACS 407
                                       GD+FTALNKAWCVHHF+CS
Sbjct: 479 ----------------------------GDVFTALNKAWCVHHFSCS 497

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|321471829|gb|EFX82801.1| hypothetical protein DAPPUDRAFT_187931 [Daphnia pulex] Back     alignment and taxonomy information
>gi|328707525|ref|XP_001951328.2| PREDICTED: LIM domain-containing protein unc-97-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157128836|ref|XP_001655217.1| pinch [Aedes aegypti] gi|108882172|gb|EAT46397.1| AAEL002415-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|157128838|ref|XP_001655218.1| pinch [Aedes aegypti] gi|157128840|ref|XP_001655219.1| pinch [Aedes aegypti] gi|108882173|gb|EAT46398.1| AAEL002415-PB [Aedes aegypti] gi|108882174|gb|EAT46399.1| AAEL002415-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328780833|ref|XP_623943.3| PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2-like [Apis mellifera] gi|380028361|ref|XP_003697872.1| PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|340727871|ref|XP_003402258.1| PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2-like [Bombus terrestris] gi|350405769|ref|XP_003487544.1| PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307182140|gb|EFN69483.1| LIM and senescent cell antigen-like-containing domain protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332030721|gb|EGI70397.1| LIM and senescent cell antigen-like-containing domain protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307210658|gb|EFN87081.1| LIM and senescent cell antigen-like-containing domain protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
FB|FBgn0020249348 stck "steamer duck" [Drosophil 0.333 0.568 0.843 3.9e-99
UNIPROTKB|F1RQH7341 LIMS2 "Uncharacterized protein 0.402 0.700 0.603 5.3e-88
UNIPROTKB|Q7Z4I7341 LIMS2 "LIM and senescent cell 0.402 0.700 0.6 1.1e-87
UNIPROTKB|F1PUC6362 LIMS2 "Uncharacterized protein 0.415 0.682 0.589 1.1e-87
UNIPROTKB|Q2KJ33341 LIMS2 "LIM and senescent cell 0.402 0.700 0.596 1.8e-87
UNIPROTKB|E2RNC7387 LIMS2 "Uncharacterized protein 0.402 0.617 0.596 3.7e-87
MGI|MGI:2385067341 Lims2 "LIM and senescent cell 0.400 0.697 0.609 6e-87
UNIPROTKB|E1BV80341 LIMS2 "Uncharacterized protein 0.402 0.700 0.6 9.9e-87
UNIPROTKB|F1M9H8337 Lims2 "Protein Lims2" [Rattus 0.400 0.706 0.609 9.9e-87
RGD|1305273306 Lims2 "LIM and senescent cell 0.400 0.777 0.609 9.9e-87
FB|FBgn0020249 stck "steamer duck" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 984 (351.4 bits), Expect = 3.9e-99, P = 3.9e-99
 Identities = 167/198 (84%), Positives = 186/198 (93%)

Query:   152 GEFVIGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHM 211
             GEFVIGRVIKAM+A+WHP+CFRC+ C+KELAD GFI++Q RALCHECNA+ KA   G+++
Sbjct:    86 GEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYV 145

Query:   212 CHKCHGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRC 271
             C KCHGLID++PL+FRGEVYH YHF+CT+CGTEL+S AREVKSRPG  ANDMNELYCLRC
Sbjct:   146 CQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRC 205

Query:   272 HDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHY 331
             HDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCA+CEKPFLGHRHYEK+GLAYCETHY
Sbjct:   206 HDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHY 265

Query:   332 HQLFGNLCFVCNQVIGGD 349
             HQLFGNLCFVCNQVIGGD
Sbjct:   266 HQLFGNLCFVCNQVIGGD 283
GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031252 "cell leading edge" evidence=IDA
GO:0046329 "negative regulation of JNK cascade" evidence=IGI
GO:0007391 "dorsal closure" evidence=IMP
GO:0008258 "head involution" evidence=IMP
GO:0009880 "embryonic pattern specification" evidence=IMP
UNIPROTKB|F1RQH7 LIMS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z4I7 LIMS2 "LIM and senescent cell antigen-like-containing domain protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUC6 LIMS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ33 LIMS2 "LIM and senescent cell antigen-like-containing domain protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNC7 LIMS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2385067 Lims2 "LIM and senescent cell antigen like domains 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BV80 LIMS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9H8 Lims2 "Protein Lims2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1305273 Lims2 "LIM and senescent cell antigen like domains 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91XD2LIMS2_MOUSENo assigned EC number0.52710.43770.7624yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 3e-33
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 8e-29
cd0933252 cd09332, LIM2_PINCH, The second LIM domain of prot 3e-23
cd0933351 cd09333, LIM3_PINCH, The third LIM domain of prote 6e-20
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 1e-19
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 2e-13
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 3e-13
pfam0041258 pfam00412, LIM, LIM domain 3e-13
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 2e-12
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 6e-12
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-11
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 1e-11
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 2e-11
pfam0041258 pfam00412, LIM, LIM domain 2e-11
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 4e-11
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 2e-10
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 2e-09
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 4e-09
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 5e-09
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 2e-08
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 3e-08
cd0933554 cd09335, LIM5_PINCH, The fifth LIM domain of prote 3e-08
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 5e-08
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 5e-08
cd0940752 cd09407, LIM2_Paxillin, The second LIM domain of p 6e-08
pfam0041258 pfam00412, LIM, LIM domain 9e-08
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 1e-07
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 3e-07
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 4e-07
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 7e-07
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 7e-07
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 8e-07
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 9e-07
cd0940852 cd09408, LIM2_Leupaxin, The second LIM domain of L 9e-07
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 1e-06
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 1e-06
cd0939253 cd09392, LIM2_Lrg1p_like, The second LIM domain of 1e-06
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-06
cd0945752 cd09457, LIM2_ENH, The second LIM domain of the En 2e-06
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 3e-06
cd0939758 cd09397, LIM1_UF1, LIM domain in proteins of unkno 4e-06
cd0941252 cd09412, LIM4_Leupaxin, The fourth LIM domain of L 4e-06
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 5e-06
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 8e-06
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 8e-06
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 1e-05
cd0945554 cd09455, LIM1_Enigma_like_1, The first LIM domain 1e-05
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 1e-05
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 1e-05
cd0945752 cd09457, LIM2_ENH, The second LIM domain of the En 2e-05
cd0941152 cd09411, LIM4_Paxillin, The fourth LIM domain of P 2e-05
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 3e-05
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 4e-05
cd0945252 cd09452, LIM1_Enigma, The first LIM domain of Enig 4e-05
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 5e-05
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 5e-05
cd0933952 cd09339, LIM4_Paxillin_like, The fourth LIM domain 5e-05
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 6e-05
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 6e-05
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 6e-05
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 7e-05
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 7e-05
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 8e-05
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 1e-04
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 1e-04
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 1e-04
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 1e-04
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 2e-04
cd0940852 cd09408, LIM2_Leupaxin, The second LIM domain of L 2e-04
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 2e-04
cd0934756 cd09347, LIM4_FHL, The fourth LIM domain of Four a 2e-04
cd0945352 cd09453, LIM1_ENH, The first LIM domain of the Eni 2e-04
cd0932856 cd09328, LIM2_abLIM, The second LIM domain on acti 2e-04
cd0946154 cd09461, LIM3_Enigma_like_1, The third LIM domain 2e-04
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 2e-04
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 3e-04
pfam0041258 pfam00412, LIM, LIM domain 3e-04
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 3e-04
cd0932856 cd09328, LIM2_abLIM, The second LIM domain on acti 3e-04
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 5e-04
cd0941856 cd09418, LIM2_Prickle, The second LIM domain of Pr 5e-04
cd0939253 cd09392, LIM2_Lrg1p_like, The second LIM domain of 6e-04
cd0943256 cd09432, LIM6_LIMPETin, The sixth LIM domain of pr 6e-04
cd0943157 cd09431, LIM3_Fhl2, The third LIM domain of Four a 8e-04
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 9e-04
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 0.001
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 0.001
cd0945352 cd09453, LIM1_ENH, The first LIM domain of the Eni 0.001
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 0.001
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 0.001
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 0.001
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 0.001
cd0943456 cd09434, LIM4_FHL3, The fourth LIM domain of Four 0.001
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 0.001
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 0.002
pfam0041258 pfam00412, LIM, LIM domain 0.002
pfam0041258 pfam00412, LIM, LIM domain 0.002
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 0.002
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 0.002
cd0933554 cd09335, LIM5_PINCH, The fifth LIM domain of prote 0.002
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 0.002
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 0.002
cd0940752 cd09407, LIM2_Paxillin, The second LIM domain of p 0.002
cd0945352 cd09453, LIM1_ENH, The first LIM domain of the Eni 0.002
cd0945452 cd09454, LIM1_ZASP_Cypher, The first LIM domain of 0.002
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 0.002
cd0945554 cd09455, LIM1_Enigma_like_1, The first LIM domain 0.003
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 0.003
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 0.003
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 0.003
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 0.004
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 0.004
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information 
 Score =  120 bits (304), Expect = 3e-33
 Identities = 50/59 (84%), Positives = 55/59 (93%)

Query: 8  CSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFA 66
          C RC EGFEP+EKIVNSNGEL+H+QCFVCAQCF+PFP G+FYEFEGRKYCEHDF VLFA
Sbjct: 1  CERCREGFEPDEKIVNSNGELYHEQCFVCAQCFQPFPDGLFYEFEGRKYCEHDFQVLFA 59

The first LIM domain of paxillin: Paxillin is an adaptor protein, which recruits key components of the signal-transduction machinery to specific sub-cellular locations to respond to environmental changes rapidly. The C-terminal region of paxillin contains four LIM domains which target paxillin to focal adhesions, presumably through a direct association with the cytoplasmic tail of beta-integrin. The N-terminal of paxillin is leucine-rich LD-motifs. Paxillin is found at the interface between the plasma membrane and the actin cytoskeleton. The binding partners of paxillin are diverse and include protein tyrosine kinases, such as Src and FAK, structural proteins, such as vinculin and actopaxin, and regulators of actin organization. Paxillin recruits these proteins to their function sites to control the dynamic changes in cell adhesion, cytoskeletal reorganization and gene expression. LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 59
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188719 cd09333, LIM3_PINCH, The third LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188795 cd09411, LIM4_Paxillin, The fourth LIM domain of Paxillin Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the Paxillin-like protein family Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 594
KOG2272|consensus332 100.0
KOG2272|consensus332 100.0
KOG1701|consensus468 99.96
KOG1701|consensus468 99.95
KOG1044|consensus 670 99.94
KOG1703|consensus479 99.93
KOG1044|consensus 670 99.92
KOG1703|consensus479 99.9
KOG4577|consensus383 99.66
KOG4577|consensus383 99.48
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.4
KOG1700|consensus200 99.24
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.19
KOG1700|consensus200 98.95
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.34
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.05
KOG1702|consensus264 97.86
KOG1702|consensus264 95.59
KOG0490|consensus235 94.88
KOG0490|consensus235 94.88
>KOG2272|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-59  Score=446.80  Aligned_cols=302  Identities=75%  Similarity=1.501  Sum_probs=286.7

Q ss_pred             CCCCcccCCCcccccCceeeecCCcccccCCcCCCCCCCCCCCCCeEEeCCccCChhHHHhhccCCcCCCCCCCcccccc
Q psy10533          3 LGNMYCSRCNEGFEPEEKIVNSNGELWHQQCFVCAQCFRPFPGGIFYEFEGRKYCEHDFHVLFAPCCGNGCPSLSTFAIS   82 (594)
Q Consensus         3 ~~~~~C~~C~~~i~~~e~~~~~~~~~~H~~CF~C~~C~~~L~~~~~~~~~~~~yC~~~y~~~~~p~c~~~c~~~~~~~~~   82 (594)
                      ++++.|.+|...+.++|++|+.+|..||.+||.|++|-+||.++.||+.+|+.|||.||..||+|-|++           
T Consensus        10 ~~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~k-----------   78 (332)
T KOG2272|consen   10 LANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGK-----------   78 (332)
T ss_pred             HHHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcc-----------
Confidence            667899999999999999999999999999999999999999999999999999999999999976554           


Q ss_pred             cccccCCCCCCcccccccCCCcccccccccccccCCcccccCCCccccCCCCCCcCCCCCCCCceeeeccceEEeeEEEc
Q psy10533         83 LAGEISGWYPPCLKITMSLGNMYCFPLQRRFRARGEDRQTLTGGAWHQQCFVCAQCFRPFPGGIFYEFEGEFVIGRVIKA  162 (594)
Q Consensus        83 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~i~g~~v~a  162 (594)
                                                                             |             +++|+|++|.+
T Consensus        79 -------------------------------------------------------C-------------~EFiiGrVika   90 (332)
T KOG2272|consen   79 -------------------------------------------------------C-------------GEFIIGRVIKA   90 (332)
T ss_pred             -------------------------------------------------------c-------------ccchhhHHHHh
Confidence                                                                   7             77889999999


Q ss_pred             CCcccCCCccccCCCCccccccccEecCCceeeccccccccccccCccccccccccccCcceeecCccccccCcccCCCC
Q psy10533        163 MNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKCHGLIDDKPLKFRGEVYHPYHFNCTSCG  242 (594)
Q Consensus       163 ~~~~~H~~CF~C~~C~~~L~~~~f~~~dg~~~C~~C~~~~~~~~~~~~~C~~C~~~I~~~~i~~~~~~~H~~CF~C~~C~  242 (594)
                      |+.+||+.||+|..|.+.|.+..|+...|+.+|..|.++..+.+.+...|.+|+..|+++.|++.+..|||.+|+|..|+
T Consensus        91 mnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~yHFkCt~C~  170 (332)
T KOG2272|consen   91 MNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPYHFKCTTCG  170 (332)
T ss_pred             hccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCccceeccccc
Confidence            99999999999999999999999999999999999999988888889999999999999999999999999999999999


Q ss_pred             CCCCCCcccccCCCCcccccccccccccccCCCCCCCCCCCCCCcceeEEEEcCccccccCcCCccccCCCCCCcccccC
Q psy10533        243 TELNSDAREVKSRPGYTANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKK  322 (594)
Q Consensus       243 ~~L~~~~~~~~~~~gy~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~f~~~~  322 (594)
                      +.|.++...++          +.+||.+|+++++.|+|..|.+||++++|.++|+.||.++|+|+.|.+|+.+.+.|++.
T Consensus       171 keL~sdaRevk----------~eLyClrChD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGHrHYEkk  240 (332)
T KOG2272|consen  171 KELTSDAREVK----------GELYCLRCHDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKK  240 (332)
T ss_pred             ccccchhhhhc----------cceeccccccccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccchhhhhhc
Confidence            99999988887          89999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeecchhhhhhhhcCCCccccccccCCCCccccccceeccCCCCcCcccccccccccccccCccccCceEEecCceeecc
Q psy10533        323 GLAYCETHYHQLFGNLCFVCNQVIGGDESHYITSRELTYKKGLGYCESHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVH  402 (594)
Q Consensus       323 g~~yC~~cy~~~f~~~C~~C~~~i~~~~~~~i~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~g~~i~a~~k~~H~~  402 (594)
                      |.+||+.+|.++|+..|                                         ..|+.+|.|++++|+++.|.++
T Consensus       241 GlaYCe~h~~qLfG~~C-----------------------------------------F~C~~~i~G~vv~al~KawCv~  279 (332)
T KOG2272|consen  241 GLAYCETHYHQLFGNLC-----------------------------------------FICNRVIGGDVVSALNKAWCVE  279 (332)
T ss_pred             CchhHHHHHHHHhhhhh-----------------------------------------eecCCccCccHHHHhhhhhccc
Confidence            99999999999998666                                         7778888888999999999999


Q ss_pred             cccccccCCccccCcccccccCCCcCCCceeecCCEeecHhHHhh
Q psy10533        403 HFACSTLGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQ  447 (594)
Q Consensus       403 CF~C~~C~~~l~~~~f~C~~C~~~~~~~~~~~~dg~~yC~~~y~~  447 (594)
                      ||+|+.|++.|+.             -+.|++-|-+|.|+.+|.+
T Consensus       280 cf~Cs~Cdkkl~~-------------K~Kf~E~DmkP~CKkCy~r  311 (332)
T KOG2272|consen  280 CFSCSTCDKKLTQ-------------KNKFYEFDMKPVCKKCYDR  311 (332)
T ss_pred             ccccccccccccc-------------ccceeeeccchHHHHHHhh
Confidence            9999999999983             5679999999999999984

>KOG2272|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
1nyp_A66 4th Lim Domain Of Pinch Protein Length = 66 7e-28
1nyp_A66 4th Lim Domain Of Pinch Protein Length = 66 2e-17
1nyp_A66 4th Lim Domain Of Pinch Protein Length = 66 4e-04
2kbx_B70 Solution Structure Of Ilk-Pinch Complex Length = 70 3e-24
2kbx_B70 Solution Structure Of Ilk-Pinch Complex Length = 70 9e-06
1g47_A77 1st Lim Domain Of Pinch Protein Length = 77 4e-24
1g47_A77 1st Lim Domain Of Pinch Protein Length = 77 9e-06
3ixe_B72 Structural Basis Of Competition Between Pinch1 And 2e-22
3ixe_B72 Structural Basis Of Competition Between Pinch1 And 6e-07
3f6q_B72 Crystal Structure Of Integrin-Linked Kinase Ankyrin 6e-22
3f6q_B72 Crystal Structure Of Integrin-Linked Kinase Ankyrin 9e-06
2cor_A79 Solution Structure Of The Third Lim Domain Of Parti 6e-18
2d8x_A70 Solution Structure Of The Second Lim Domain Of Part 5e-14
1x3h_A80 Solution Structure Of The Lim Domain Of Human Leupa 4e-07
2dar_A90 Solution Structure Of First Lim Domain Of Enigma-Li 4e-05
2dar_A90 Solution Structure Of First Lim Domain Of Enigma-Li 8e-04
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 2e-04
1qli_A113 Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi 2e-04
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 2e-04
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 3e-04
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 3e-04
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 9e-04
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 3e-04
1ctl_A85 Structure Of The Carboxy-Terminal Lim Domain From T 5e-04
1b8t_A192 Solution Structure Of The Chicken Crp1 Length = 192 7e-04
2dj7_A80 Solution Structure Of 3rd Lim Domain Of Actin-Bindi 8e-04
>pdb|1NYP|A Chain A, 4th Lim Domain Of Pinch Protein Length = 66 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (305), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%)
Query: 275 MGIPICGACRRPIEERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQL 334
           MG+PICGACRRPIE RVV A+GK WHVEHFVCA+CEKPFLGHRHYE+KGLAYCETHY+QL
Sbjct: 3   MGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQL 62
Query: 335 FGNL 338
           FG++
Sbjct: 63  FGDV 66
>pdb|1NYP|A Chain A, 4th Lim Domain Of Pinch Protein Length = 66 Back     alignment and structure
>pdb|1NYP|A Chain A, 4th Lim Domain Of Pinch Protein Length = 66 Back     alignment and structure
>pdb|2KBX|B Chain B, Solution Structure Of Ilk-Pinch Complex Length = 70 Back     alignment and structure
>pdb|2KBX|B Chain B, Solution Structure Of Ilk-Pinch Complex Length = 70 Back     alignment and structure
>pdb|1G47|A Chain A, 1st Lim Domain Of Pinch Protein Length = 77 Back     alignment and structure
>pdb|1G47|A Chain A, 1st Lim Domain Of Pinch Protein Length = 77 Back     alignment and structure
>pdb|3IXE|B Chain B, Structural Basis Of Competition Between Pinch1 And Pinch2 For Binding To The Ankyrin Repeat Domain Of Integrin-Linked Kinase Length = 72 Back     alignment and structure
>pdb|3IXE|B Chain B, Structural Basis Of Competition Between Pinch1 And Pinch2 For Binding To The Ankyrin Repeat Domain Of Integrin-Linked Kinase Length = 72 Back     alignment and structure
>pdb|3F6Q|B Chain B, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 72 Back     alignment and structure
>pdb|3F6Q|B Chain B, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 72 Back     alignment and structure
>pdb|2COR|A Chain A, Solution Structure Of The Third Lim Domain Of Particularly Interesting New Cys-His Protein Length = 79 Back     alignment and structure
>pdb|2D8X|A Chain A, Solution Structure Of The Second Lim Domain Of Particularly Interesting New Cys-His Protein (Pinch) Length = 70 Back     alignment and structure
>pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 Back     alignment and structure
>pdb|2DAR|A Chain A, Solution Structure Of First Lim Domain Of Enigma-Like Pdz And Lim Domains Protein Length = 90 Back     alignment and structure
>pdb|2DAR|A Chain A, Solution Structure Of First Lim Domain Of Enigma-Like Pdz And Lim Domains Protein Length = 90 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 Back     alignment and structure
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 Back     alignment and structure
>pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 Back     alignment and structure
>pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 9e-32
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-30
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 1e-18
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 5e-17
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-10
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 5e-30
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-22
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 1e-17
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-13
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-11
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-10
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-10
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-05
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-27
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-21
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-19
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-18
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-13
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-12
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 5e-27
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-18
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-17
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 4e-12
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 4e-10
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-08
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-07
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-06
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 5e-27
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 3e-22
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 1e-13
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-09
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 9e-07
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 1e-05
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-04
2cuq_A80 Four and A half LIM domains 3; structural genomics 3e-26
2cuq_A80 Four and A half LIM domains 3; structural genomics 7e-20
2cuq_A80 Four and A half LIM domains 3; structural genomics 6e-12
2cuq_A80 Four and A half LIM domains 3; structural genomics 5e-08
2cuq_A80 Four and A half LIM domains 3; structural genomics 4e-05
2cuq_A80 Four and A half LIM domains 3; structural genomics 6e-04
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-25
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 2e-18
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 9e-13
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 8e-10
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-05
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-04
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 5e-04
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 2e-25
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 7e-17
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 5e-16
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 3e-07
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 9e-05
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 6e-04
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-23
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 3e-19
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 3e-12
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-10
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-06
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 3e-04
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 7e-04
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 2e-22
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 9e-20
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 1e-14
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 3e-08
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 4e-06
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-22
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-17
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 7e-13
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 3e-12
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-10
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 9e-10
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 9e-07
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 4e-04
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 6e-22
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 9e-15
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 1e-12
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 1e-10
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 1e-04
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-04
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 1e-21
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 7e-14
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-12
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-09
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 5e-05
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 6e-04
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 8e-21
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 4e-20
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-14
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-12
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 1e-10
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 3e-08
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 1e-20
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 2e-15
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 2e-12
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 6e-09
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 7e-06
2cor_A79 Pinch protein; LIM domain, particularly interestin 1e-20
2cor_A79 Pinch protein; LIM domain, particularly interestin 1e-15
2cor_A79 Pinch protein; LIM domain, particularly interestin 3e-08
2cor_A79 Pinch protein; LIM domain, particularly interestin 3e-07
2cor_A79 Pinch protein; LIM domain, particularly interestin 3e-06
3f6q_B72 LIM and senescent cell antigen-like-containing dom 2e-20
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-17
3f6q_B72 LIM and senescent cell antigen-like-containing dom 8e-15
3f6q_B72 LIM and senescent cell antigen-like-containing dom 4e-08
3f6q_B72 LIM and senescent cell antigen-like-containing dom 4e-06
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-19
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 1e-13
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-11
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 7e-10
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 4e-05
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 7e-19
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 4e-14
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 3e-09
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 9e-09
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 6e-04
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 7e-19
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 5e-17
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 3e-15
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-14
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 4e-14
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-09
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 1e-18
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 2e-12
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 2e-09
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 9e-06
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 1e-18
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 9e-14
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 7e-10
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 3e-09
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 4e-06
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 5e-18
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 7e-13
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 6e-12
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 9e-12
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 6e-06
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 5e-04
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 6e-18
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-17
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 5e-13
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 3e-08
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 5e-05
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-17
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-14
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-12
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 8e-07
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 6e-17
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 7e-16
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-11
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 8e-09
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-04
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-04
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 7e-17
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-15
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 1e-11
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-09
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-04
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 6e-04
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 2e-15
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 6e-10
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 5e-08
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-15
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 3e-09
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 9e-08
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-04
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 3e-15
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 5e-13
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 2e-06
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 6e-06
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 6e-06
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-14
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-12
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-11
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-09
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 4e-14
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 2e-10
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-08
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 4e-13
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 3e-10
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-08
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 4e-07
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 7e-05
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 5e-04
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 6e-13
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 3e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 4e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 7e-05
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 3e-04
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 9e-13
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 4e-10
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 3e-09
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 9e-05
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-12
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 3e-10
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-09
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-08
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 5e-11
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-09
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-07
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-04
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 1e-10
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 1e-08
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 3e-07
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 2e-04
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-09
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-09
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 9e-07
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-04
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 4e-07
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 7e-05
2co8_A82 NEDD9 interacting protein with calponin homology a 3e-06
2co8_A82 NEDD9 interacting protein with calponin homology a 2e-04
2co8_A82 NEDD9 interacting protein with calponin homology a 6e-04
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 9e-05
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 1e-04
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
 Score =  120 bits (303), Expect = 9e-32
 Identities = 34/193 (17%), Positives = 46/193 (23%), Gaps = 26/193 (13%)

Query: 156 IGRVIKAMNANWHPKCFRCEHCSKELADLGFIRSQGRALCHECNAQAKAVGFGKHMCHKC 215
               ++   +++H  CF C  C K L             C  C  +              
Sbjct: 19  FAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAG 78

Query: 216 HGLIDDKPLKFRGEVYHPYHFNCTSCGTELNSDAREVKSRPGYTANDMNELYCLRCHDKM 275
               D              H                                        
Sbjct: 79  TLSTDKGESLGIKYEEGQSHRPTNPN-------------------------ASRMAQKVG 113

Query: 276 GIPICGACRRPI-EERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQL 334
           G   C  C + +     V   GK WH   F CA+C K        +K G  YC+  Y + 
Sbjct: 114 GSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLADKDGEIYCKGCYAKN 173

Query: 335 FGNLCFVCNQVIG 347
           FG   F   Q  G
Sbjct: 174 FGPKGFGFGQGAG 186
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.94
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.92
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.91
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.91
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.9
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.89
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.88
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.88
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.87
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.87
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.85
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.85
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.83
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.82
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.75
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.75
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.7
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.68
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.68
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.67
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.67
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.66
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.66
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.64
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.64
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.64
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.63
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.63
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.62
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.58
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.58
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.58
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.57
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.57
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.56
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.56
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.55
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.53
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.53
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.53
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.52
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.52
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.52
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.51
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.51
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.49
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.49
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.49
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.48
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.48
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.48
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.47
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.47
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.47
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.46
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.46
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.46
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.45
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.45
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.45
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.44
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.43
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.43
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.43
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.4
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.39
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.38
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.37
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.37
2co8_A82 NEDD9 interacting protein with calponin homology a 99.36
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.35
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.35
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.34
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.34
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.34
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.33
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.32
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.28
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.28
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.27
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.26
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.25
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.22
2co8_A82 NEDD9 interacting protein with calponin homology a 99.12
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.99
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 96.84
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
Probab=99.94  E-value=7.5e-27  Score=226.22  Aligned_cols=168  Identities=20%  Similarity=0.333  Sum_probs=131.8

Q ss_pred             CCCCCCCCCCcc-eeEEEEcCccccccCcCCccccCCCCCCcccccCCeecchhhhhhhhcCCCccccccccCCC----C
Q psy10533        277 IPICGACRRPIE-ERVVTALGKHWHVEHFVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIGGDE----S  351 (594)
Q Consensus       277 ~~~C~~C~~~I~-~~~v~a~g~~wH~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~f~~~C~~C~~~i~~~~----~  351 (594)
                      .++|..|+++|. ++.|.++|+.||++||+|..|+++|.+..|++++|++||..||.++|+++|..|++..+...    .
T Consensus         7 ~~~C~~C~~~I~~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~~~~~~~~   86 (192)
T 1b8t_A            7 GKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKGE   86 (192)
T ss_dssp             CEECTTTCCEECSSCCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCCCCCCCCC
T ss_pred             CCcCccCCCeecceeEEEeCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCccccccccccccEecCCCc
Confidence            578999999997 57788999999999999999999999888999999999999999999999999987532110    0


Q ss_pred             ccccccceeccCCCCcCcccc----cccc--cccccccCcccc-CceEEecCceeecccccccccCCccccCcccccccC
Q psy10533        352 HYITSRELTYKKGLGYCESHY----HQLF--GNLCFVCNQVIG-GDLFTALNKAWCVHHFACSTLGKHWHVEHFVCARCE  424 (594)
Q Consensus       352 ~~i~~~~~~~~~g~~~C~~~~----~~~~--~~~C~~C~~~I~-g~~i~a~~k~~H~~CF~C~~C~~~l~~~~f~C~~C~  424 (594)
                      ++ .-.+-..+...|  ....    ...+  .++|.+|+++|. ++.|.|+|+.||++||+|..|+++|.          
T Consensus        87 ~~-~~~~~~~~~~~p--~~~~~~~~~~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~----------  153 (192)
T 1b8t_A           87 SL-GIKYEEGQSHRP--TNPNASRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLE----------  153 (192)
T ss_dssp             CC-CCCCCCCCCCCC--CCCCCCCCCCCCCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCC----------
T ss_pred             cc-ccccccccccCC--CCcCccccccccCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCC----------
Confidence            10 000000111111  0111    1111  357999999996 67899999999999999998887775          


Q ss_pred             CCcCCCceeecCCEeecHhHHhhHhCCCCCcCCCCcc
Q psy10533        425 KPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQNHT  461 (594)
Q Consensus       425 ~~~~~~~~~~~dg~~yC~~~y~~~f~~~C~~C~~~i~  461 (594)
                          +..|+++||++||+.||.++|+++|.+|+++|+
T Consensus       154 ----~~~~~~~~g~~yC~~cy~~~f~~kc~~C~~~~g  186 (192)
T 1b8t_A          154 ----STTLADKDGEIYCKGCYAKNFGPKGFGFGQGAG  186 (192)
T ss_dssp             ----SSSEEEETTEEEEHHHHHHHTCCCCCCCCCCCC
T ss_pred             ----CCcccccCCEEeCHHHHHHhcCCcCCCCCCccc
Confidence                456999999999999999999999999999854
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 594
d1u5sb235 g.39.1.3 (B:103-137) Pinch (particularly interesti 1e-15
d1u5sb235 g.39.1.3 (B:103-137) Pinch (particularly interesti 1e-15
d1u5sb235 g.39.1.3 (B:103-137) Pinch (particularly interesti 2e-07
d1u5sb235 g.39.1.3 (B:103-137) Pinch (particularly interesti 2e-07
d1u5sb235 g.39.1.3 (B:103-137) Pinch (particularly interesti 4e-04
d2cora235 g.39.1.3 (A:8-42) Pinch (particularly interesting 2e-14
d1u5sb131 g.39.1.3 (B:72-102) Pinch (particularly interestin 3e-13
d1g47a135 g.39.1.3 (A:1-35) Pinch (particularly interesting 1e-12
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 5e-11
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 7e-07
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 7e-07
d2dara245 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En 2e-10
d2dara245 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En 6e-04
d2d8xa226 g.39.1.3 (A:8-32) Pinch (particularly interesting 1e-07
d2cora131 g.39.1.3 (A:43-73) Pinch (particularly interesting 2e-07
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 5e-07
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 4e-05
d2d8xa132 g.39.1.3 (A:33-64) Pinch (particularly interesting 9e-07
d1x3ha232 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) 3e-06
d1x3ha232 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) 3e-05
d1x3ha232 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) 3e-05
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Pinch (particularly interesting new Cys-His) protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.3 bits (167), Expect = 1e-15
 Identities = 30/35 (85%), Positives = 35/35 (100%)

Query: 304 FVCARCEKPFLGHRHYEKKGLAYCETHYHQLFGNL 338
           FVCA+CEKPFLGHRHYE+KGLAYCETHY+QLFG++
Sbjct: 1   FVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDV 35
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2d8xa2 g.39.1.3 (A:8-32) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.89
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.89
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.73
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.72
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.48
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.47
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.43
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.41
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.4
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.38
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.32
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.3
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.28
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.2
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.2
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.2
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.18
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.12
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.09
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.09
d2co8a236 Nedd9 interacting protein with calponin homology, 98.08
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.08
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.08
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.07
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.03
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.01
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.96
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.91
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.85
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.84
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.83
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.82
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.76
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.73
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.69
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.69
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.62
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.57
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.48
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.48
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.38
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.31
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.29
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.28
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.27
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.25
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.24
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.24
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.21
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.2
d1g47a135 Pinch (particularly interesting new Cys-His) prote 97.2
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.18
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.14
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.12
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.08
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.06
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.04
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.03
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.03
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.0
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 96.97
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 96.97
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.96
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.95
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 96.94
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.91
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.89
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 96.86
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.84
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.84
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.81
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.78
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.76
d2cora235 Pinch (particularly interesting new Cys-His) prote 96.68
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.56
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.56
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 96.44
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 96.42
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.42
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.34
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 96.28
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.25
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.18
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.13
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.09
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.08
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.06
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.05
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.0
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.95
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.91
d2co8a236 Nedd9 interacting protein with calponin homology, 95.6
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 95.41
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 95.32
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.21
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.17
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 94.66
d2cora235 Pinch (particularly interesting new Cys-His) prote 94.6
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.59
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 94.52
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 93.99
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 93.92
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 93.72
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 93.18
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 92.57
d2cora131 Pinch (particularly interesting new Cys-His) prote 92.46
d2cora131 Pinch (particularly interesting new Cys-His) prote 92.26
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 92.0
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 91.95
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 91.29
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 91.13
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 90.65
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 88.83
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 88.41
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 87.93
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 83.67
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 83.48
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 83.48
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 81.37
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.05  E-value=3.1e-11  Score=81.01  Aligned_cols=35  Identities=20%  Similarity=0.544  Sum_probs=33.6

Q ss_pred             ccccccccccccccCccccCceEEecCceeecccc
Q psy10533        370 SHYHQLFGNLCFVCNQVIGGDLFTALNKAWCVHHF  404 (594)
Q Consensus       370 ~~~~~~~~~~C~~C~~~I~g~~i~a~~k~~H~~CF  404 (594)
                      +||+++|+++|.+|++||+|++|+|+|+.||++||
T Consensus         1 ~DY~~~fapkC~~C~~~I~g~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           1 KDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCCCSCBCTTTCCBCCSSCEEETTEEECTTTC
T ss_pred             CcHHHHhChhhhhcCCcccchheeecCCccCcccC
Confidence            47899999999999999999999999999999998
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure