Psyllid ID: psy10573


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRFQQKKYYTEL
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHcccccccccccEEEEEcccccccccccccccccEEEEEcccccccHHHHHccccccEEEEEEEcccccEEEEEEEEcccccEEEEEEEccEEEccccccccccccccccc
cccccHHHccHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccHHHHccccEEEEEcccccccccccccccEEEEEEEcccccccHHHHHHHccccEEEEEEccccccEEEEEEEEcccccEEEEEEccEEEEEEccccccccccEEEcc
mlrvdrknfftrvvnepyriksrqigygadisspHIHAQMLELLKdkikpgarildigsgsgYLTACLAYmagpegrvYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLltnphgstrviqscwtkEEYNSWLLdqlvpggrmvmpvgepfkgqnltIIDKLADGYTIVTTVVRgvrtnplyrdrfqqkkyytel
mlrvdrknfftrvvnepyriksrqigygaDISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTtvvrgvrtnplyrdrfqqkkyytel
MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYtivttvvrgvrtNPLYRDRFQQKKYYTEL
*******NFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRFQ********
MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRF*********
MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRFQQKKYYTEL
*LRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRFQQKKYYT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRFQQKKYYTEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q43209230 Protein-L-isoaspartate O- N/A N/A 0.844 0.756 0.436 7e-31
Q92047228 Protein-L-isoaspartate(D- no N/A 0.834 0.754 0.415 2e-30
P15246227 Protein-L-isoaspartate(D- yes N/A 0.946 0.859 0.391 3e-30
P80895227 Protein-L-isoaspartate(D- yes N/A 0.946 0.859 0.391 5e-30
Q5F3N1228 Protein-L-isoaspartate(D- no N/A 0.898 0.811 0.390 2e-29
Q42539230 Protein-L-isoaspartate O- no N/A 0.825 0.739 0.429 3e-29
P22062227 Protein-L-isoaspartate(D- yes N/A 0.946 0.859 0.381 5e-29
Q4R5H0227 Protein-L-isoaspartate(D- N/A N/A 0.946 0.859 0.386 7e-29
P22061227 Protein-L-isoaspartate(D- no N/A 0.946 0.859 0.386 7e-29
Q5RA89227 Protein-L-isoaspartate(D- no N/A 0.946 0.859 0.386 7e-29
>sp|Q43209|PIMT_WHEAT Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1 Back     alignment and function desciption
 Score =  133 bits (335), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 102/181 (56%), Gaps = 7/181 (3%)

Query: 1   MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSG 60
           M  +DR  F       PY      IGY A IS+PH+HA  LELLKD ++PG   LD+GSG
Sbjct: 35  METIDRALFVPEGFT-PYTDSPMPIGYNATISAPHMHATCLELLKDYLQPGMHALDVGSG 93

Query: 61  SGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDK-GNSELLDQGRVQFVAYFWLRHL 119
           SGYLTAC A M GPEGR  G+EH+ EL  +S +N+++   + L+  G + F         
Sbjct: 94  SGYLTACFAMMVGPEGRAVGIEHIPELVVASTENVERSAAAALMKDGSLSFHVSDGRLGW 153

Query: 120 LLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTI 179
               P+ +  V  +     E    LL+QL PGGRMV+PVG     Q+L +IDK ADG T 
Sbjct: 154 PDAAPYDAIHVGAAA---PEIPRPLLEQLKPGGRMVIPVGT--YSQDLQVIDKSADGSTS 208

Query: 180 V 180
           V
Sbjct: 209 V 209




Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues.
Triticum aestivum (taxid: 4565)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 7
>sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 Back     alignment and function description
>sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 Back     alignment and function description
>sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 Back     alignment and function description
>sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q42539|PIMT_ARATH Protein-L-isoaspartate O-methyltransferase OS=Arabidopsis thaliana GN=PCM PE=2 SV=3 Back     alignment and function description
>sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 Back     alignment and function description
>sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 Back     alignment and function description
>sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
320168944 321 L-isoaspartyl protein carboxyl methyltra 0.868 0.557 0.430 1e-34
242014348287 protein-L-isoaspartate O-methyltransfera 0.927 0.665 0.434 1e-34
225710608250 Protein-L-isoaspartateD-aspartate O-meth 0.878 0.724 0.441 3e-33
225718542248 Protein-L-isoaspartateD-aspartate O-meth 0.878 0.729 0.436 2e-32
156550279229 PREDICTED: protein-L-isoaspartate(D-aspa 0.830 0.746 0.446 5e-32
114052539249 L-isoaspartyl protein carboxyl methyltra 0.844 0.698 0.433 9e-32
390345040296 PREDICTED: protein-L-isoaspartate(D-aspa 0.898 0.625 0.411 4e-31
348531162246 PREDICTED: protein-L-isoaspartate(D-aspa 0.927 0.776 0.429 5e-31
383856863268 PREDICTED: protein-L-isoaspartate(D-aspa 0.868 0.667 0.427 5e-31
225456838230 PREDICTED: protein-L-isoaspartate O-meth 0.946 0.847 0.433 6e-31
>gi|320168944|gb|EFW45843.1| L-isoaspartyl protein carboxyl methyltransferase [Capsaspora owczarzaki ATCC 30864] Back     alignment and taxonomy information
 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 127/209 (60%), Gaps = 30/209 (14%)

Query: 1   MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSG 60
           M  VDR +F    + +PY+   + IG+GA IS+PH+HA +LELLK  ++PG R+LD+GSG
Sbjct: 129 MRAVDRGDF---TLTQPYQDSPQPIGHGATISAPHMHAHVLELLKGHLRPGMRVLDVGSG 185

Query: 61  SGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFV--------- 111
           SGYL AC+A+M GP G+V G+EH+ EL   S+ N+ + ++E L+ GR++ V         
Sbjct: 186 SGYLCACMAHMVGPAGKVVGIEHIPELVNMSLINLKRHHNEALEAGRIEIVVGDGRLGIS 245

Query: 112 -AYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTII 170
            + F   H+    P     + QS          L+DQL PGGR+V+PVG+ F GQ+L  +
Sbjct: 246 GSQFDAIHVGAAAP----TIPQS----------LVDQLKPGGRLVIPVGQSF-GQSLEQV 290

Query: 171 DKLADGYTIVTTVVRGVRTNPLYRDRFQQ 199
           DKL DG +IVT  + GV   PL  DR  Q
Sbjct: 291 DKLPDG-SIVTQHLMGVIYVPLT-DREHQ 317




Source: Capsaspora owczarzaki ATCC 30864

Species: Capsaspora owczarzaki

Genus: Capsaspora

Family:

Order:

Class: Ichthyosporea

Phylum:

Superkingdom: Eukaryota

>gi|242014348|ref|XP_002427853.1| protein-L-isoaspartate O-methyltransferase, putative [Pediculus humanus corporis] gi|212512322|gb|EEB15115.1| protein-L-isoaspartate O-methyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|225710608|gb|ACO11150.1| Protein-L-isoaspartateD-aspartate O-methyltransferase [Caligus rogercresseyi] Back     alignment and taxonomy information
>gi|225718542|gb|ACO15117.1| Protein-L-isoaspartateD-aspartate O-methyltransferase [Caligus clemensi] Back     alignment and taxonomy information
>gi|156550279|ref|XP_001602931.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|114052539|ref|NP_001040252.1| L-isoaspartyl protein carboxyl methyltransferase [Bombyx mori] gi|87248521|gb|ABD36313.1| L-isoaspartyl protein carboxyl methyltransferase [Bombyx mori] Back     alignment and taxonomy information
>gi|390345040|ref|XP_786523.3| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|348531162|ref|XP_003453079.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|383856863|ref|XP_003703926.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|225456838|ref|XP_002278792.1| PREDICTED: protein-L-isoaspartate O-methyltransferase [Vitis vinifera] gi|297733662|emb|CBI14909.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
ZFIN|ZDB-GENE-040426-1738249 pcmtl "l-isoaspartyl protein c 0.825 0.682 0.426 7.9e-30
UNIPROTKB|E1BXJ0228 LOC423008 "Protein-L-isoaspart 0.825 0.745 0.420 1.3e-29
UNIPROTKB|G3MZZ6228 PCMT1 "Protein-L-isoaspartate 0.825 0.745 0.426 2.1e-29
UNIPROTKB|P15246227 PCMT1 "Protein-L-isoaspartate( 0.825 0.748 0.426 2.1e-29
ZFIN|ZDB-GENE-990415-134266 pcmt "l-isoaspartyl protein ca 0.825 0.639 0.414 3.4e-29
UNIPROTKB|J9JIK8208 PCMT1 "Protein-L-isoaspartate 0.825 0.817 0.426 4.4e-29
UNIPROTKB|P80895227 PCMT1 "Protein-L-isoaspartate( 0.825 0.748 0.426 4.4e-29
TAIR|locus:2157767309 PIMT2 "protein-l-isoaspartate 0.825 0.550 0.440 1.2e-28
UNIPROTKB|F1NJV4197 PCMT1 "Protein-L-isoaspartate 0.825 0.862 0.403 1.5e-28
UNIPROTKB|Q5F3N1228 PCMT1 "Protein-L-isoaspartate( 0.825 0.745 0.403 1.5e-28
ZFIN|ZDB-GENE-040426-1738 pcmtl "l-isoaspartyl protein carboxyl methyltransferase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 330 (121.2 bits), Expect = 7.9e-30, P = 7.9e-30
 Identities = 75/176 (42%), Positives = 104/176 (59%)

Query:     1 MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSG 60
             ML  DR   ++R  + PY    + IGY A IS+PH+HA  LE+L DK+  GA  LD+GSG
Sbjct:    53 MLATDR-GIYSR--DHPYADSPQSIGYKATISAPHMHAHALEVLSDKLTEGASALDVGSG 109

Query:    61 SGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLL 120
             SGYLTAC A M GP G+V G++H+ +L +SS+KN+   + ELL  GR++ V         
Sbjct:   110 SGYLTACFARMVGPSGKVVGIDHIDQLVQSSVKNVQADDPELLATGRIKLVVGDGRFGFP 169

Query:   121 LTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADG 176
                P+ +  V  +  T  +    LL+QL PGGR+V+PVG     Q L   D+ +DG
Sbjct:   170 DEAPYDAIHVGAAAPTLPKA---LLEQLKPGGRLVLPVGPEGGSQVLEQYDRQSDG 222




GO:0006464 "cellular protein modification process" evidence=IEA
GO:0004719 "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
UNIPROTKB|E1BXJ0 LOC423008 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZZ6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P15246 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-134 pcmt "l-isoaspartyl protein carboxyl methyltransferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9JIK8 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P80895 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2157767 PIMT2 "protein-l-isoaspartate methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJV4 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3N1 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A9R115PIMT_YERPG2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
B1JJF4PIMT_YERPY2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
B0KSC8PIMT_PSEPG2, ., 1, ., 1, ., 7, 70.33140.78150.7594yesN/A
A7HL14PIMT_FERNB2, ., 1, ., 1, ., 7, 70.32640.86890.8994yesN/A
A7MTT6PIMT_VIBHB2, ., 1, ., 1, ., 7, 70.33840.82030.8125yesN/A
A4TQ01PIMT_YERPP2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
Q57636PIMT_METJA2, ., 1, ., 1, ., 7, 70.31110.81060.7767yesN/A
O27962PIMT2_ARCFU2, ., 1, ., 1, ., 7, 70.32090.72810.6849yesN/A
A2BKH8PIMT_HYPBU2, ., 1, ., 1, ., 7, 70.32600.80580.6887yesN/A
A3MY16PIMT_PYRCJ2, ., 1, ., 1, ., 7, 70.34960.72330.7198yesN/A
Q8DC56PIMT_VIBVU2, ., 1, ., 1, ., 7, 70.33840.82030.8125yesN/A
Q27873PIMT_CAEEL2, ., 1, ., 1, ., 7, 70.39300.81060.7422yesN/A
Q0W2W0PIMT_UNCMA2, ., 1, ., 1, ., 7, 70.3150.83000.9095yesN/A
Q66EB9PIMT_YERPS2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
Q8TYL4PIMT_METKA2, ., 1, ., 1, ., 7, 70.34460.80580.7345yesN/A
Q8ZBQ0PIMT_YERPE2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
A8AAV7PIMT_IGNH42, ., 1, ., 1, ., 7, 70.32600.80090.7819yesN/A
Q1I655PIMT_PSEE42, ., 1, ., 1, ., 7, 70.33140.76690.7452yesN/A
P15246PIMT_BOVIN2, ., 1, ., 1, ., 7, 70.39100.94660.8590yesN/A
Q8TT93PIMT1_METAC2, ., 1, ., 1, ., 7, 70.33140.77660.6374yesN/A
Q9URZ1PIMT_SCHPO2, ., 1, ., 1, ., 7, 70.35540.75240.6739yesN/A
Q88MF0PIMT_PSEPK2, ., 1, ., 1, ., 7, 70.33140.78150.7594yesN/A
Q123X2PIMT2_POLSJ2, ., 1, ., 1, ., 7, 70.30450.88340.8625yesN/A
B8J9E3PIMT_ANAD22, ., 1, ., 1, ., 7, 70.32960.75720.7464yesN/A
P80895PIMT_PIG2, ., 1, ., 1, ., 7, 70.39100.94660.8590yesN/A
P23506PIMT_MOUSE2, ., 1, ., 1, ., 7, 70.38110.94660.8590yesN/A
B2K581PIMT_YERPB2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
A2SF76PIMT_METPP2, ., 1, ., 1, ., 7, 70.330.85430.6542yesN/A
Q1C474PIMT_YERPA2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
P22062PIMT_RAT2, ., 1, ., 1, ., 7, 70.38110.94660.8590yesN/A
A5W820PIMT_PSEP12, ., 1, ., 1, ., 7, 70.33140.78150.7594yesN/A
Q1CLR2PIMT_YERPN2, ., 1, ., 1, ., 7, 70.31280.83000.8221yesN/A
Q12UV0PIMT_METBU2, ., 1, ., 1, ., 7, 70.33330.66010.6699yesN/A
Q7MHQ8PIMT_VIBVY2, ., 1, ., 1, ., 7, 70.33840.82030.8125yesN/A
A0B9U1PIMT_METTP2, ., 1, ., 1, ., 7, 70.32380.79120.7761yesN/A
Q27869PIMT_DROME2, ., 1, ., 1, ., 7, 70.36540.89800.8185yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.766
4th Layer2.1.1.770.824

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 4e-42
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 4e-30
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 7e-26
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 5e-20
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 1e-18
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 7e-16
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 1e-11
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 4e-10
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 4e-07
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 6e-07
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 7e-07
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 2e-06
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisio 3e-06
pfam08704309 pfam08704, GCD14, tRNA methyltransferase complex G 8e-06
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 1e-05
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 2e-05
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 7e-05
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 1e-04
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 2e-04
COG4798238 COG4798, COG4798, Predicted methyltransferase [Gen 2e-04
TIGR04188363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 3e-04
pfam01269229 pfam01269, Fibrillarin, Fibrillarin 3e-04
pfam01209233 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransf 3e-04
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 5e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 6e-04
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 0.001
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 0.002
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 0.002
COG2263198 COG2263, COG2263, Predicted RNA methylase [Transla 0.003
TIGR02752231 TIGR02752, MenG_heptapren, demethylmenaquinone met 0.003
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 0.003
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-m 0.004
pfam13489154 pfam13489, Methyltransf_23, Methyltransferase doma 0.004
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 0.004
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
 Score =  140 bits (356), Expect = 4e-42
 Identities = 79/203 (38%), Positives = 98/203 (48%), Gaps = 33/203 (16%)

Query: 1   MLRVDRKNFFTRVVNE-PYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGS 59
           ML VDR+ F         Y      IGYG  IS+PH+HA MLELL+  +KPG R+L+IGS
Sbjct: 25  MLAVDREEFVPESFKSYAYEDIPLSIGYGQTISAPHMHAMMLELLE--LKPGMRVLEIGS 82

Query: 60  GSGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHL 119
           GSGYLTAC A M G  G V  +EH+ EL E + +N++K     L    V  V        
Sbjct: 83  GSGYLTACFARMVGEVGLVVSIEHIPELVEIARRNLEK-----LGLENVIVV-------- 129

Query: 120 LLTNPHGSTR----------VIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTI 169
                 G  R           I       E    L+DQL  GGR+V+PVG     Q L  
Sbjct: 130 -----VGDGRQGWPEFAPYDAIHVGAAAPEIPEALIDQLKEGGRLVIPVGPNGN-QVLQQ 183

Query: 170 IDKLADGYTIVTTVVRGVRTNPL 192
            DK  DG  ++  +  GVR  PL
Sbjct: 184 FDKRNDGSVVIKDLE-GVRFVPL 205


Length = 210

>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219979 pfam08704, GCD14, tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|227135 COG4798, COG4798, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|201699 pfam01269, Fibrillarin, Fibrillarin Back     alignment and domain information
>gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family Back     alignment and domain information
>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|233708 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|131799 TIGR02752, MenG_heptapren, demethylmenaquinone methyltransferase Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233687 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.97
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.97
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.95
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.95
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.95
KOG1661|consensus237 99.93
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.92
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.88
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.79
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.77
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.72
PLN02233261 ubiquinone biosynthesis methyltransferase 99.7
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.69
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.69
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.68
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.67
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.64
PLN02244340 tocopherol O-methyltransferase 99.63
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.63
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.62
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.62
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.61
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.61
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.61
PRK07402196 precorrin-6B methylase; Provisional 99.59
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.59
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.59
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.58
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.58
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.58
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.58
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.58
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.57
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.57
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.57
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.56
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.56
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.56
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.56
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.55
PRK11207197 tellurite resistance protein TehB; Provisional 99.55
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.54
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.54
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.54
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.53
PRK08317241 hypothetical protein; Provisional 99.53
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.53
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.52
PLN02336475 phosphoethanolamine N-methyltransferase 99.52
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.52
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.52
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.51
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.51
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.51
KOG1540|consensus296 99.51
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.51
PRK04266226 fibrillarin; Provisional 99.5
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.5
COG4123248 Predicted O-methyltransferase [General function pr 99.5
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.5
PRK14903431 16S rRNA methyltransferase B; Provisional 99.49
PLN02490340 MPBQ/MSBQ methyltransferase 99.49
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.49
PTZ00146293 fibrillarin; Provisional 99.48
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.48
PRK04457262 spermidine synthase; Provisional 99.47
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.47
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.47
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.47
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.46
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.46
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.45
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.45
PRK06922677 hypothetical protein; Provisional 99.45
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.45
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.44
PLN02476278 O-methyltransferase 99.44
PRK14902444 16S rRNA methyltransferase B; Provisional 99.44
PRK14901434 16S rRNA methyltransferase B; Provisional 99.44
COG4122219 Predicted O-methyltransferase [General function pr 99.44
PRK12335287 tellurite resistance protein TehB; Provisional 99.44
PRK14967223 putative methyltransferase; Provisional 99.44
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.43
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.43
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.43
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.43
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.43
KOG1271|consensus227 99.43
PRK05785226 hypothetical protein; Provisional 99.43
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.42
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.42
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.42
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.42
PRK00811283 spermidine synthase; Provisional 99.42
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.41
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.41
KOG1270|consensus282 99.41
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.4
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.4
TIGR00452314 methyltransferase, putative. Known examples to dat 99.4
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.39
PRK10901427 16S rRNA methyltransferase B; Provisional 99.39
KOG1541|consensus270 99.38
PRK14968188 putative methyltransferase; Provisional 99.38
PRK14904445 16S rRNA methyltransferase B; Provisional 99.38
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.38
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.38
COG2890280 HemK Methylase of polypeptide chain release factor 99.36
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.36
PLN02336 475 phosphoethanolamine N-methyltransferase 99.35
TIGR03438301 probable methyltransferase. This model represents 99.35
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.35
PRK01581374 speE spermidine synthase; Validated 99.34
TIGR00438188 rrmJ cell division protein FtsJ. 99.33
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.33
KOG4300|consensus252 99.33
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.33
PLN02589247 caffeoyl-CoA O-methyltransferase 99.32
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.32
PLN03075296 nicotianamine synthase; Provisional 99.31
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.31
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 99.3
PRK06202232 hypothetical protein; Provisional 99.29
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.29
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.28
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.28
PLN02366308 spermidine synthase 99.28
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.28
KOG2904|consensus328 99.28
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.27
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.25
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 99.25
PHA03412241 putative methyltransferase; Provisional 99.25
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 99.24
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.24
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.23
PRK03612521 spermidine synthase; Provisional 99.23
PLN02672 1082 methionine S-methyltransferase 99.21
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.21
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.21
KOG2915|consensus314 99.2
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 99.18
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.18
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 99.18
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 99.15
KOG1975|consensus 389 99.14
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.14
KOG2899|consensus288 99.14
PHA03411279 putative methyltransferase; Provisional 99.12
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.12
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.11
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 99.1
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.1
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.1
PLN02823336 spermine synthase 99.09
KOG3010|consensus261 99.09
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.08
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 99.08
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.07
COG0421282 SpeE Spermidine synthase [Amino acid transport and 99.06
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 99.06
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.05
KOG3191|consensus209 99.04
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.04
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 99.03
COG1041347 Predicted DNA modification methylase [DNA replicat 99.03
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.02
KOG2361|consensus264 99.01
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 99.01
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.0
PRK00536262 speE spermidine synthase; Provisional 99.0
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.99
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.98
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.98
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.97
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.96
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.96
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 98.96
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.95
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.95
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.94
KOG1663|consensus237 98.93
COG2521287 Predicted archaeal methyltransferase [General func 98.92
KOG1499|consensus 346 98.88
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.88
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.87
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.86
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.82
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 98.81
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.8
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.77
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.77
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.77
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 98.76
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.75
PLN02232160 ubiquinone biosynthesis methyltransferase 98.75
KOG3420|consensus185 98.75
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.73
PRK04148134 hypothetical protein; Provisional 98.72
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.71
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.69
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.68
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.67
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.66
COG2520341 Predicted methyltransferase [General function pred 98.65
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.65
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.64
KOG2940|consensus 325 98.55
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 98.55
KOG0820|consensus 315 98.54
KOG1500|consensus 517 98.53
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.51
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.5
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 98.47
COG4262508 Predicted spermidine synthase with an N-terminal m 98.45
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.44
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.44
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.43
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 98.43
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.43
KOG1596|consensus317 98.42
KOG3115|consensus249 98.41
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.41
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 98.4
KOG2187|consensus534 98.38
KOG1122|consensus460 98.35
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.31
PRK10742250 putative methyltransferase; Provisional 98.29
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 98.27
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 98.25
KOG3045|consensus325 98.24
KOG4589|consensus232 98.22
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.22
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 98.13
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 98.1
COG4076252 Predicted RNA methylase [General function predicti 98.09
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.06
COG0286 489 HsdM Type I restriction-modification system methyl 98.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 98.0
KOG1709|consensus271 97.94
KOG2730|consensus263 97.94
KOG2352|consensus 482 97.9
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.9
KOG3178|consensus342 97.87
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.84
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 97.84
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.83
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.8
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.77
KOG1331|consensus 293 97.77
KOG2198|consensus375 97.71
PF13679141 Methyltransf_32: Methyltransferase domain 97.65
KOG3987|consensus288 97.63
KOG2671|consensus421 97.6
KOG1269|consensus 364 97.59
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.58
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.58
COG3897218 Predicted methyltransferase [General function pred 97.54
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 97.51
KOG4058|consensus199 97.5
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.48
COG4798238 Predicted methyltransferase [General function pred 97.44
COG2384226 Predicted SAM-dependent methyltransferase [General 97.38
KOG0024|consensus354 97.31
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.31
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.31
KOG1562|consensus337 97.27
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 97.23
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.22
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.21
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.17
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.11
KOG3201|consensus201 97.11
PRK11524284 putative methyltransferase; Provisional 96.81
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 96.76
COG3129292 Predicted SAM-dependent methyltransferase [General 96.71
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 96.71
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 96.67
PF05711248 TylF: Macrocin-O-methyltransferase (TylF); InterPr 96.65
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.55
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 96.55
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 96.42
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.35
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 96.33
PRK13699227 putative methylase; Provisional 96.32
KOG2793|consensus248 96.24
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.18
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 96.08
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.06
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 96.02
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 95.92
KOG1099|consensus294 95.86
COG4301321 Uncharacterized conserved protein [Function unknow 95.85
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 95.84
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 95.83
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 95.82
KOG0822|consensus 649 95.82
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 95.79
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 95.74
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 95.71
PHA01634156 hypothetical protein 95.66
KOG1501|consensus 636 95.62
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 95.61
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 95.58
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 95.56
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 95.55
TIGR00497 501 hsdM type I restriction system adenine methylase ( 95.44
COG1565 370 Uncharacterized conserved protein [Function unknow 95.44
KOG1098|consensus 780 95.19
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 95.16
KOG2798|consensus369 95.11
KOG2352|consensus482 95.09
PLN02740381 Alcohol dehydrogenase-like 94.76
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 94.69
KOG1253|consensus 525 94.54
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 94.41
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 94.38
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 94.18
PRK11524 284 putative methyltransferase; Provisional 94.16
PLN02827378 Alcohol dehydrogenase-like 94.15
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 94.13
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 94.05
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 94.03
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 93.9
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 93.8
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 93.74
PLN02586360 probable cinnamyl alcohol dehydrogenase 93.72
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 93.66
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 93.56
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 93.52
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 93.51
KOG3924|consensus419 93.48
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 93.46
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.31
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.28
KOG1227|consensus351 93.24
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 93.2
KOG2651|consensus 476 93.17
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 93.12
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 93.11
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 93.08
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 92.98
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 92.9
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 92.82
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 92.82
KOG2078|consensus495 92.81
KOG2360|consensus413 92.63
PLN02494477 adenosylhomocysteinase 92.63
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 92.47
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 92.45
PRK13699 227 putative methylase; Provisional 92.39
PLN02514357 cinnamyl-alcohol dehydrogenase 92.39
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 92.32
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 92.24
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 92.03
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 92.01
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 92.0
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.88
PRK10083339 putative oxidoreductase; Provisional 91.8
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 91.67
COG4017254 Uncharacterized protein conserved in archaea [Func 91.56
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 91.53
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 91.48
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 91.4
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 91.26
PF11312315 DUF3115: Protein of unknown function (DUF3115); In 91.19
PLN02178375 cinnamyl-alcohol dehydrogenase 90.78
PRK08306296 dipicolinate synthase subunit A; Reviewed 90.77
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 90.68
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 90.68
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 90.59
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 90.56
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 90.47
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 90.44
COG1568354 Predicted methyltransferases [General function pre 90.3
KOG2912|consensus 419 90.15
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 90.04
PTZ00075476 Adenosylhomocysteinase; Provisional 90.03
PF03269177 DUF268: Caenorhabditis protein of unknown function 89.96
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 89.66
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 89.48
KOG0023|consensus360 89.42
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 89.32
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 89.21
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 88.98
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 88.81
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 88.77
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 88.63
COG1255129 Uncharacterized protein conserved in archaea [Func 88.55
PF05206259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 88.44
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 88.13
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 88.1
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 87.79
PTZ00357 1072 methyltransferase; Provisional 87.39
PLN02702364 L-idonate 5-dehydrogenase 86.98
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 86.91
PF12692160 Methyltransf_17: S-adenosyl-L-methionine methyltra 86.87
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 86.62
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 86.46
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 86.34
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 86.18
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 86.18
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 86.05
PRK08324 681 short chain dehydrogenase; Validated 85.88
COG0863302 DNA modification methylase [DNA replication, recom 85.58
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 85.42
KOG2782|consensus 303 85.41
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 85.26
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 85.2
KOG0022|consensus375 85.14
PRK05562223 precorrin-2 dehydrogenase; Provisional 85.04
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 84.99
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 84.99
KOG2920|consensus282 84.86
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 84.86
PRK10458 467 DNA cytosine methylase; Provisional 84.77
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 84.73
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 84.72
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 84.25
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.24
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 84.16
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 83.59
COG2961279 ComJ Protein involved in catabolism of external DN 83.26
PF02153 258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 83.23
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 82.73
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 82.53
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 82.38
KOG1198|consensus347 81.3
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 80.97
KOG1197|consensus336 80.9
PLN02668 386 indole-3-acetate carboxyl methyltransferase 80.29
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=5.1e-30  Score=190.90  Aligned_cols=176  Identities=39%  Similarity=0.551  Sum_probs=161.5

Q ss_pred             Cccccccccccccc-cCccccccccccCccccCcHHHHHHHHHHhhccCCCCCeEEEEcccCchHHHHHHHHhCCCceEE
Q psy10573          1 MLRVDRKNFFTRVV-NEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVY   79 (206)
Q Consensus         1 ~~~~~~~~~~~~~~-~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLDlG~G~G~~~~~l~~~~~~~~~v~   79 (206)
                      |++|||+.|+|+.+ ..+|.|.+.+++.++.++.|.+.+.|++.|.  +.++.+|||||||+|+.+..+++..+   +|+
T Consensus        24 ~~~vPRe~FVp~~~~~~AY~d~~lpi~~gqtis~P~~vA~m~~~L~--~~~g~~VLEIGtGsGY~aAvla~l~~---~V~   98 (209)
T COG2518          24 FLAVPRELFVPAAYKHLAYEDRALPIGCGQTISAPHMVARMLQLLE--LKPGDRVLEIGTGSGYQAAVLARLVG---RVV   98 (209)
T ss_pred             HHhCCHHhccCchhhcccccCCcccCCCCceecCcHHHHHHHHHhC--CCCCCeEEEECCCchHHHHHHHHHhC---eEE
Confidence            57899999999999 9999999999999999999999999999998  99999999999999999999999875   999


Q ss_pred             EEeCCHHHHHHHHHhhhccCccccCCCceEEEEcc----cccccccCCCCCCeeEEEecCChHHHHHHHHhcccCCcEEE
Q psy10573         80 GVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYF----WLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMV  155 (206)
Q Consensus        80 ~iD~s~~~~~~a~~~~~~~~~~~~~~~~i~~~~~d----~~~~~~~~~~~~~~D~i~~~~~~~~~~~~~~~~L~~gG~l~  155 (206)
                      ++|+.+...+.|++++..     .+..|+.++++|    +++..||       |.|++....+.+++.+.+.|++||+++
T Consensus        99 siEr~~~L~~~A~~~L~~-----lg~~nV~v~~gDG~~G~~~~aPy-------D~I~Vtaaa~~vP~~Ll~QL~~gGrlv  166 (209)
T COG2518          99 SIERIEELAEQARRNLET-----LGYENVTVRHGDGSKGWPEEAPY-------DRIIVTAAAPEVPEALLDQLKPGGRLV  166 (209)
T ss_pred             EEEEcHHHHHHHHHHHHH-----cCCCceEEEECCcccCCCCCCCc-------CEEEEeeccCCCCHHHHHhcccCCEEE
Confidence            999999999999999998     556689999999    4444555       999999999999999999999999999


Q ss_pred             EEecCCCCCeeEEEEEecCCCceEEEEEEeeEEeeecccc
Q psy10573        156 MPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRD  195 (206)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  195 (206)
                      +..... ..+.+.++.+...+.|.. +.++.+.|.|+.+.
T Consensus       167 ~PvG~~-~~q~l~~~~k~~~~~~~~-~~l~~v~~vPl~~~  204 (209)
T COG2518         167 IPVGSG-PAQRLLRITKDGDGNFER-RDLFNVRFVPLVGG  204 (209)
T ss_pred             EEEccC-CcEEEEEEEEcCCCcEEE-eeeccceeeecCCc
Confidence            999844 358899999988888999 99999999999883



>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1562|consensus Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG3201|consensus Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PF05711 TylF: Macrocin-O-methyltransferase (TylF); InterPro: IPR008884 This family consists of bacterial macrocin O-methyltransferase (TylF) proteins Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>KOG1099|consensus Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG0822|consensus Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>KOG2798|consensus Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1253|consensus Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>KOG3924|consensus Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>KOG1227|consensus Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG2078|consensus Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>COG4017 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PF11312 DUF3115: Protein of unknown function (DUF3115); InterPro: IPR021463 This eukaryotic family of proteins has no known function Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2912|consensus Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>KOG2782|consensus Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 1e-29
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 7e-25
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 5e-17
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 3e-12
1jg4_A235 Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- 2e-09
3lbf_A210 Crystal Structure Of Protein L-Isoaspartyl Methyltr 2e-08
1dl5_A317 Protein-L-Isoaspartate O-Methyltransferase Length = 9e-05
1o54_A277 Crystal Structure Of Sam-Dependent O-Methyltransfer 1e-04
1i9g_A280 Crystal Structure Of An Adomet Dependent Methyltran 2e-04
3mb5_A255 Crystal Structure Of P. Abyssi Trna M1a58 Methyltra 7e-04
3lhd_C253 Crystal Structure Of P. Abyssi Trna M1a58 Methyltra 7e-04
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure

Iteration: 1

Score = 125 bits (315), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 72/176 (40%), Positives = 98/176 (55%), Gaps = 6/176 (3%) Query: 1 MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSG 60 ML DR ++ PY + IG+ A IS+PH+HA LELL D++ GA+ LD+GSG Sbjct: 31 MLATDRSHYAK---CNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSG 87 Query: 61 SGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLL 120 SG LTAC A M G G+V G++H+ EL + S+ N+ K + LL GRVQ V Sbjct: 88 SGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYA 147 Query: 121 LTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADG 176 P+ + V + + L+DQL PGGR+++PVG Q L DKL DG Sbjct: 148 EEAPYDAIHVGAAAPVVPQA---LIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDG 200
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|1JG4|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- Methyltransferase With S-Adenosylmethionine Length = 235 Back     alignment and structure
>pdb|3LBF|A Chain A, Crystal Structure Of Protein L-Isoaspartyl Methyltransferase From Escherichia Coli Length = 210 Back     alignment and structure
>pdb|1DL5|A Chain A, Protein-L-Isoaspartate O-Methyltransferase Length = 317 Back     alignment and structure
>pdb|1O54|A Chain A, Crystal Structure Of Sam-Dependent O-Methyltransferase (Tm0748) From Thermotoga Maritima At 1.65 A Resolution Length = 277 Back     alignment and structure
>pdb|1I9G|A Chain A, Crystal Structure Of An Adomet Dependent Methyltransferase Length = 280 Back     alignment and structure
>pdb|3MB5|A Chain A, Crystal Structure Of P. Abyssi Trna M1a58 Methyltransferase In Complex With S-Adenosyl-L-Methionine Length = 255 Back     alignment and structure
>pdb|3LHD|C Chain C, Crystal Structure Of P. Abyssi Trna M1a58 Methyltransferase In Complex With S-Adenosyl-L-Homocysteine Length = 253 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 4e-58
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 1e-55
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 3e-52
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 3e-45
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 4e-45
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 4e-39
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 1e-38
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 1e-36
2b25_A336 Hypothetical protein; structural genomics, methyl 3e-14
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 5e-14
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 9e-14
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 4e-13
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 2e-11
1yb2_A275 Hypothetical protein TA0852; structural genomics, 2e-10
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 4e-10
3dh0_A219 SAM dependent methyltransferase; cystal structure, 9e-10
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 2e-09
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 2e-09
3ocj_A305 Putative exported protein; structural genomics, PS 5e-09
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 2e-08
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 2e-08
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 3e-08
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 4e-08
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 4e-08
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 5e-08
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 5e-08
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 8e-08
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 1e-07
3dtn_A234 Putative methyltransferase MM_2633; structural gen 1e-07
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 2e-07
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 2e-07
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 4e-07
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 4e-07
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 7e-07
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 2e-06
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 4e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 6e-06
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 7e-06
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 8e-06
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 9e-06
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 1e-05
3cc8_A230 Putative methyltransferase; structural genomics, j 1e-05
3m33_A226 Uncharacterized protein; structural genomics, PSI- 1e-05
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 2e-05
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 2e-05
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 2e-05
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 2e-05
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 3e-05
1xxl_A239 YCGJ protein; structural genomics, protein structu 4e-05
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 4e-05
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 4e-05
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 5e-05
3duw_A223 OMT, O-methyltransferase, putative; alternating of 6e-05
2avd_A229 Catechol-O-methyltransferase; structural genomics, 6e-05
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 7e-05
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 8e-05
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 8e-05
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 8e-05
3ege_A261 Putative methyltransferase from antibiotic biosyn 1e-04
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 1e-04
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 1e-04
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 1e-04
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 1e-04
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 1e-04
3lpm_A259 Putative methyltransferase; structural genomics, p 1e-04
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 1e-04
2p7i_A250 Hypothetical protein; putative methyltransferase, 2e-04
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 2e-04
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 2e-04
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 2e-04
3hnr_A220 Probable methyltransferase BT9727_4108; structural 2e-04
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 2e-04
3f4k_A257 Putative methyltransferase; structural genomics, P 3e-04
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 3e-04
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 4e-04
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 4e-04
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 4e-04
1vl5_A260 Unknown conserved protein BH2331; putative methylt 4e-04
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 5e-04
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 5e-04
1ne2_A200 Hypothetical protein TA1320; structural genomics, 5e-04
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 5e-04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 6e-04
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 6e-04
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 7e-04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 8e-04
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
 Score =  181 bits (462), Expect = 4e-58
 Identities = 78/211 (36%), Positives = 109/211 (51%), Gaps = 25/211 (11%)

Query: 1   MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSG 60
           ML  DR ++       PY    + IG+ A IS+PH+HA  LELL D++  GA+ LD+GSG
Sbjct: 31  MLATDRSHY---AKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSG 87

Query: 61  SGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVA---YF-WL 116
           SG LTAC A M G  G+V G++H+ EL + S+ N+ K +  LL  GRVQ V       + 
Sbjct: 88  SGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYA 147

Query: 117 RH-----LLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIID 171
                  + +     +  V Q+          L+DQL PGGR+++PVG     Q L   D
Sbjct: 148 EEAPYDAIHVGA--AAPVVPQA----------LIDQLKPGGRLILPVGPAGGNQMLEQYD 195

Query: 172 KLADGYTIVTTVVRGVRTNPLYRDRFQQKKY 202
           KL DG +I    + GV   PL     Q  ++
Sbjct: 196 KLQDG-SIKMKPLMGVIYVPLTDKEKQWSRW 225


>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B* 3pla_E* Length = 232 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Length = 242 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Length = 239 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Length = 223 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Length = 232 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Length = 248 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4er3_A* 3sr4_A* Length = 438 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Length = 227 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Length = 233 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Length = 233 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Length = 340 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.93
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.92
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.92
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.92
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.91
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.91
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.87
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.87
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.74
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.72
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.71
2b25_A336 Hypothetical protein; structural genomics, methyl 99.7
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.7
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.7
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.7
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.69
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.69
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.68
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.68
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.67
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.66
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.65
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.65
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.65
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.65
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.65
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.65
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.65
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.64
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.64
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.64
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.64
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.64
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.63
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.63
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.63
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.63
3f4k_A257 Putative methyltransferase; structural genomics, P 99.63
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.63
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.62
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.62
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.62
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.62
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.62
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.62
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.61
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.61
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.61
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.61
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.61
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.61
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.61
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.61
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.61
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.61
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.6
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.6
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.6
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.6
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.6
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.6
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.6
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.6
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.6
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.6
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.6
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.6
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.6
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.6
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.6
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.6
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.59
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.59
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.59
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.59
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.59
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.59
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.59
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.59
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.58
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.58
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.58
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.58
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.58
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.58
3ocj_A305 Putative exported protein; structural genomics, PS 99.58
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.58
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.57
3lpm_A259 Putative methyltransferase; structural genomics, p 99.57
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.57
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.57
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.57
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.56
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.56
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.56
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.56
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.56
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.56
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.56
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.56
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.56
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.56
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.56
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.56
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.56
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.55
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.55
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.55
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.55
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.55
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.55
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.55
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.54
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.54
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.54
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.54
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.54
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.54
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.54
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.54
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.54
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.54
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.54
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.53
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.53
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.53
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.53
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.53
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.53
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.53
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.53
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.53
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.53
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.53
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.53
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.52
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.52
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.52
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.52
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.52
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.52
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.52
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.52
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.52
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.52
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.52
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.51
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.51
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.51
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.5
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.5
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.5
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.5
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.49
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.49
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.49
3lcc_A235 Putative methyl chloride transferase; halide methy 99.49
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.49
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.49
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.49
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.49
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.49
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.48
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.48
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.48
2o07_A304 Spermidine synthase; structural genomics, structur 99.48
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.48
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.48
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.47
2pt6_A321 Spermidine synthase; transferase, structural genom 99.47
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.47
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.46
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.46
2i7c_A283 Spermidine synthase; transferase, structural genom 99.46
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.46
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.46
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.45
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.45
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.45
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.44
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.44
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.43
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.43
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.43
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.43
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.43
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.42
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.42
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.42
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.42
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.42
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.41
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.41
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.41
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.41
2h00_A254 Methyltransferase 10 domain containing protein; st 99.4
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.4
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.39
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.39
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.39
3cc8_A230 Putative methyltransferase; structural genomics, j 99.38
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.38
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.38
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.38
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.37
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.37
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.37
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.37
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.37
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.37
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.36
3k6r_A278 Putative transferase PH0793; structural genomics, 99.36
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.36
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.36
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.35
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 99.35
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.35
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.34
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.33
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.33
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.33
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.32
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.31
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.31
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.31
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 99.3
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.3
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.29
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.29
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.29
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 99.28
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.27
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.26
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.26
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.26
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.26
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 99.26
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.25
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.25
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.23
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.23
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.23
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 99.23
3fut_A271 Dimethyladenosine transferase; methyltransferase, 99.22
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.21
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 99.21
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.2
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.2
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.19
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.19
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.19
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.19
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.18
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.18
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.18
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.17
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 99.17
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.17
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.16
3khk_A 544 Type I restriction-modification system methylation 99.16
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.15
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.14
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 99.14
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.13
3lkd_A 542 Type I restriction-modification system methyltrans 99.11
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 99.1
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.09
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.09
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 99.02
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 99.01
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.99
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.98
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.96
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.96
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.96
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.9
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.9
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 98.88
3ufb_A 530 Type I restriction-modification system methyltran 98.86
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 98.83
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.82
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.79
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.68
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.65
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.65
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.65
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.57
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 98.42
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 98.4
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.35
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.3
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 98.24
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 98.2
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.2
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 98.1
2px2_A269 Genome polyprotein [contains: capsid protein C (co 97.97
2zig_A297 TTHA0409, putative modification methylase; methylt 97.95
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 97.88
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 97.71
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 97.61
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.59
2oo3_A283 Protein involved in catabolism of external DNA; st 97.53
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 97.33
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 97.28
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.25
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 97.05
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 97.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.98
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.95
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 96.93
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 96.92
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 96.81
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 96.79
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.77
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.77
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 96.72
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.69
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.68
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 96.68
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 96.67
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 96.67
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.66
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.65
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.62
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 96.57
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.56
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.56
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 96.55
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.54
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.52
3fbg_A346 Putative arginate lyase; structural genomics, unkn 96.41
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 96.39
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.38
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.38
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 96.38
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.36
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.36
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.36
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.31
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 96.25
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.15
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.14
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 96.08
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 96.05
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.04
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.01
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 95.98
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 95.96
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 95.96
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 95.92
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.91
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 95.85
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 95.79
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 95.73
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.73
4eye_A342 Probable oxidoreductase; structural genomics, niai 95.68
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.68
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.64
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 95.57
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 95.56
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 95.37
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 95.33
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 95.24
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 95.24
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 95.22
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 95.19
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 95.03
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 95.01
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 94.91
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 94.78
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 94.72
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.67
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 94.6
2zig_A 297 TTHA0409, putative modification methylase; methylt 94.47
3krt_A456 Crotonyl COA reductase; structural genomics, prote 94.44
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 94.11
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 94.08
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 94.07
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 93.98
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 93.85
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 93.82
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.8
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 93.6
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 93.48
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 93.16
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 93.1
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.09
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.0
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 92.87
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 92.46
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 92.29
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.09
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 91.8
4eso_A255 Putative oxidoreductase; NADP, structural genomics 91.53
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 91.21
3me5_A 482 Cytosine-specific methyltransferase; structural ge 91.07
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 90.79
3c85_A183 Putative glutathione-regulated potassium-efflux S 90.78
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 90.68
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 90.54
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 89.23
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 88.86
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 88.79
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 88.73
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 88.69
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 88.66
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 88.17
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 88.15
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 88.04
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 87.61
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 87.05
2rir_A300 Dipicolinate synthase, A chain; structural genomic 86.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 86.19
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 86.1
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 86.01
1id1_A153 Putative potassium channel protein; RCK domain, E. 85.64
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 85.58
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 85.44
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 85.38
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 84.68
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 84.53
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 84.41
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 83.89
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 83.89
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 83.62
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 83.51
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 83.11
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 82.46
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 82.46
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 82.34
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 82.11
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 81.9
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 81.7
3edm_A259 Short chain dehydrogenase; structural genomics, ox 81.57
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 81.43
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 81.26
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 80.61
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
Probab=99.93  E-value=7e-25  Score=168.29  Aligned_cols=184  Identities=39%  Similarity=0.582  Sum_probs=153.2

Q ss_pred             CccccccccccccccCccccccccccCccccCcHHHHHHHHHHhhccCCCCCeEEEEcccCchHHHHHHHHhCC-----C
Q psy10573          1 MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGP-----E   75 (206)
Q Consensus         1 ~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLDlG~G~G~~~~~l~~~~~~-----~   75 (206)
                      |+++||+.|++..   +|.|.+.++++++.++.|.....+++.+...+.++.+|||+|||+|.++..+++..+.     .
T Consensus        38 ~~~~~r~~f~~~~---~y~d~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~VLdiG~G~G~~~~~la~~~~~~~~~~~  114 (227)
T 1r18_A           38 MKETDRKHYSPRN---PYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDAD  114 (227)
T ss_dssp             HHTSCGGGTCSSC---TTBSSCEEEETTEEECCHHHHHHHHHHTTTTCCTTCEEEEESCTTSHHHHHHHHHHHHSCCCTT
T ss_pred             HHhCCHHHcCCcc---cccCCCcccCCCCccCChHHHHHHHHHHHhhCCCCCEEEEECCCccHHHHHHHHhcccccCCcc
Confidence            4578999998876   8999999999999999999999999999656788999999999999999999886532     3


Q ss_pred             ceEEEEeCCHHHHHHHHHhhhccCccccCCCceEEEEcccccccccCCCC-CCeeEEEecCChHHHHHHHHhcccCCcEE
Q psy10573         76 GRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPH-GSTRVIQSCWTKEEYNSWLLDQLVPGGRM  154 (206)
Q Consensus        76 ~~v~~iD~s~~~~~~a~~~~~~~~~~~~~~~~i~~~~~d~~~~~~~~~~~-~~~D~i~~~~~~~~~~~~~~~~L~~gG~l  154 (206)
                      ++++++|+++.+++.+++++...+.......+++++.+|...  .+  ++ +.||+|+++..++++++.+.++|+|||++
T Consensus       115 ~~v~~vD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~~~--~~--~~~~~fD~I~~~~~~~~~~~~~~~~LkpgG~l  190 (227)
T 1r18_A          115 TRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRK--GY--PPNAPYNAIHVGAAAPDTPTELINQLASGGRL  190 (227)
T ss_dssp             CEEEEEESCHHHHHHHHHHHHHHHHHHHHHTSEEEEESCGGG--CC--GGGCSEEEEEECSCBSSCCHHHHHTEEEEEEE
T ss_pred             CEEEEEEcCHHHHHHHHHHHHhcCccccCCCceEEEECCccc--CC--CcCCCccEEEECCchHHHHHHHHHHhcCCCEE
Confidence            599999999999999999886521000002579999999433  23  33 67899999999999999999999999999


Q ss_pred             EEEecCCCCCeeEEEEEecCCCceEEEEEEeeEEeeec
Q psy10573        155 VMPVGEPFKGQNLTIIDKLADGYTIVTTVVRGVRTNPL  192 (206)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  192 (206)
                      ++++......+.+..+.+..++.|.. +.++.+.|.|+
T Consensus       191 vi~~~~~~~~~~l~~~~~~~~~~~~~-~~l~~~~~~p~  227 (227)
T 1r18_A          191 IVPVGPDGGSQYMQQYDKDANGKVEM-TRLMGVMYVPL  227 (227)
T ss_dssp             EEEESCSSSCEEEEEEEECTTSCEEE-EEEEEECCCCC
T ss_pred             EEEEecCCCceEEEEEEEcCCCcEEE-EEeccEEEeeC
Confidence            99998766678888898887888998 89999999885



>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 7e-32
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 1e-30
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 6e-18
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 8e-17
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 4e-16
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 2e-14
d1dl5a1213 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methylt 1e-13
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 1e-11
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 2e-09
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 2e-09
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 1e-08
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-08
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 2e-08
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 4e-07
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 8e-07
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 8e-07
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 2e-06
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 5e-06
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 1e-05
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 4e-05
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 6e-05
d2fyta1 311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 2e-04
d1im8a_225 c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) 3e-04
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 4e-04
d2nxca1254 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT 4e-04
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 5e-04
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 5e-04
d2ih2a1223 c.66.1.27 (A:21-243) DNA methylase TaqI, N-termina 7e-04
d2bzga1229 c.66.1.36 (A:17-245) Thiopurine S-methyltransferas 9e-04
d2a14a1257 c.66.1.15 (A:5-261) Indolethylamine N-methyltransf 0.002
d1zx0a1229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 0.002
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 0.002
d1oria_ 316 c.66.1.6 (A:) Protein arginine N-methyltransferase 0.002
d1dusa_194 c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeo 0.004
d2igta1309 c.66.1.51 (A:1-309) Putative methyltransferase Atu 0.004
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  113 bits (283), Expect = 7e-32
 Identities = 76/192 (39%), Positives = 101/192 (52%), Gaps = 7/192 (3%)

Query: 1   MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSG 60
           ML  DR ++       PY    + IG+ A IS+PH+HA  LELL D++  GA+ LD+GSG
Sbjct: 30  MLATDRSHY---AKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSG 86

Query: 61  SGYLTACLAYMAGPEGRVYGVEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLL 120
           SG LTAC A M G  G+V G++H+ EL + S+ N+ K +  LL  GRVQ V        +
Sbjct: 87  SGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGD---GRM 143

Query: 121 LTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGEPFKGQNLTIIDKLADGYTIV 180
                     I            L+DQL PGGR+++PVG     Q L   DKL DG +I 
Sbjct: 144 GYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDG-SIK 202

Query: 181 TTVVRGVRTNPL 192
              + GV   PL
Sbjct: 203 MKPLMGVIYVPL 214


>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Length = 225 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Length = 254 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 223 Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 194 Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Length = 309 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.98
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.96
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.96
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.95
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.94
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.82
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.8
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.79
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.77
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.76
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.75
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.75
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.74
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.73
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.73
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.71
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.7
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.69
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.69
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.68
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.68
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.66
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.66
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.66
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.65
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.65
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.65
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.64
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.64
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.64
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.64
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.64
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.63
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.63
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.63
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.62
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.62
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.59
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.58
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.55
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.54
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.51
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.51
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.5
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.5
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.49
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.48
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.46
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.45
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.45
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.45
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.44
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.43
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.4
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.4
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.4
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.39
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.37
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.36
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 99.36
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.36
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.35
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.34
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.32
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.32
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.29
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.27
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.21
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 99.2
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.19
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.13
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 99.12
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 99.1
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 99.08
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 99.08
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.06
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 99.05
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 99.03
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 99.02
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 99.01
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.99
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.98
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.92
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.92
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 98.89
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.89
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.84
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.84
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.81
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 98.75
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.73
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.73
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.63
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.56
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.53
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.49
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.46
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.38
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 98.11
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 98.1
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.07
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.0
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.98
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.9
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.85
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.82
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 97.76
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.76
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.72
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.61
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.52
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.45
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.45
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.43
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 97.43
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.38
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.34
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.25
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 97.14
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 97.09
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.01
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 96.83
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.79
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.78
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.77
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.74
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.71
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.42
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.34
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 96.27
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.97
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.89
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.63
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 95.49
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.36
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 95.18
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 94.54
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 94.52
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.5
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 94.34
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 93.82
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.79
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 93.69
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.59
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.21
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 92.32
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.31
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 92.21
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.64
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.29
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 90.25
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 89.91
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 89.35
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.81
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 88.71
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 88.54
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 86.63
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.27
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 86.19
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 86.15
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 86.03
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 85.59
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.15
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 85.09
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 85.02
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.36
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 83.59
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 83.25
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 83.14
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 83.04
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 81.37
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 81.12
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 81.03
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.95
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 80.67
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 80.66
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 80.52
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 80.32
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 80.32
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 80.28
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 80.28
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 80.23
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.11
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98  E-value=4.6e-32  Score=205.96  Aligned_cols=194  Identities=39%  Similarity=0.574  Sum_probs=169.1

Q ss_pred             CccccccccccccccCccccccccccCccccCcHHHHHHHHHHhhccCCCCCeEEEEcccCchHHHHHHHHhCCCceEEE
Q psy10573          1 MLRVDRKNFFTRVVNEPYRIKSRQIGYGADISSPHIHAQMLELLKDKIKPGARILDIGSGSGYLTACLAYMAGPEGRVYG   80 (206)
Q Consensus         1 ~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLDlG~G~G~~~~~l~~~~~~~~~v~~   80 (206)
                      |++|||+.|+|.   .+|.|.+++++.++.++.|.+.+.+++.|...++++.+|||+|||+|+.+..+++..++.++|++
T Consensus        30 ~~~vpRe~Fvp~---~aY~D~~l~i~~~~~is~P~~~a~~le~L~~~l~~g~~VLdiG~GsGy~ta~la~l~~~~g~V~~  106 (224)
T d1i1na_          30 MLATDRSHYAKC---NPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIG  106 (224)
T ss_dssp             HHTSCGGGTCSS---CTTSSSCEEEETTEEECCHHHHHHHHHHTTTTSCTTCEEEEETCTTSHHHHHHHHHHCTTCEEEE
T ss_pred             HHhCCHHHcCCc---ccCCCCCccccchhhhhhhHHHHHHHHHHhhccCCCCeEEEecCCCCHHHHHHHHHhCCCceEEE
Confidence            578999999984   48999999999999999999999999999766899999999999999999999998888889999


Q ss_pred             EeCCHHHHHHHHHhhhccCccccCCCceEEEEcccccccccCCCCCCeeEEEecCChHHHHHHHHhcccCCcEEEEEecC
Q psy10573         81 VEHVMELAESSIKNIDKGNSELLDQGRVQFVAYFWLRHLLLTNPHGSTRVIQSCWTKEEYNSWLLDQLVPGGRMVMPVGE  160 (206)
Q Consensus        81 iD~s~~~~~~a~~~~~~~~~~~~~~~~i~~~~~d~~~~~~~~~~~~~~D~i~~~~~~~~~~~~~~~~L~~gG~l~~~~~~  160 (206)
                      +|+++++++.|++++...+.......++.++.+|.. ....  +.+.||+|++....+++++.+.+.|||||+++++...
T Consensus       107 ie~~~~l~~~a~~~l~~~~~~~~~~~~~~~~~gD~~-~~~~--~~~~fD~I~~~~~~~~ip~~l~~~LkpGG~LV~pv~~  183 (224)
T d1i1na_         107 IDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGR-MGYA--EEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGP  183 (224)
T ss_dssp             EESCHHHHHHHHHHHHHHCTHHHHTSSEEEEESCGG-GCCG--GGCCEEEEEECSBBSSCCHHHHHTEEEEEEEEEEESC
T ss_pred             EcCCHHHHHHHHHhccccCcccccccceEEEEeecc-cccc--hhhhhhhhhhhcchhhcCHHHHhhcCCCcEEEEEEcc
Confidence            999999999999999864443334567899999832 2233  4567899999999999999999999999999999887


Q ss_pred             CCCCeeEEEEEecCCCceEEEEEEeeEEeeecccccccccc
Q psy10573        161 PFKGQNLTIIDKLADGYTIVTTVVRGVRTNPLYRDRFQQKK  201 (206)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  201 (206)
                      .+..+.+..+.+...+.|.. ..++++.|.|+.+.+.+|.+
T Consensus       184 ~~~~q~l~~~~k~~~~~~~~-~~l~~v~fvPl~~~~~~~~~  223 (224)
T d1i1na_         184 AGGNQMLEQYDKLQDGSIKM-KPLMGVIYVPLTDKEKQWSR  223 (224)
T ss_dssp             TTSCEEEEEEEECTTSCEEE-EEEEEECCCBCCCHHHHCCC
T ss_pred             CCCcEEEEEEEEeCCCeEEE-EEEeeEEEECCCCchhhccC
Confidence            77778888999988888999 99999999999998877754



>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure