Psyllid ID: psy10596

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MSAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCSNLGK
ccccccccEEEcccEEEEEEccccccEEEEEcccEEEEccccHHHHHHHHHHHHccccccccccEEEccEEEEEEccccccEEEEEcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccc
ccHHccccEEEcccccEEEEccccccEEEEEcccccccccHHHHHHHHHHHHHHHccccccccEEEccccEEEEEccccccEEEEEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccc
msakdfkpyvcadpdvicldldgseDFLLLATDGLWEKVTELEAASSVYThlseqsgakdfkpyvcadpdvicldldgseDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGigcsnlgk
msakdfkpyvcaDPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYThlseqsgakdfkpYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCSNLGK
MSAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCSNLGK
*****FKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCS****
MSAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSE*SG*LSTLFFLDEIWSMVGIGCSNL**
MSAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCSNLGK
*S**DFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCSNLG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTLFFLDEIWSMVGIGCSNLGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q80TL0 749 Protein phosphatase 1E OS yes N/A 0.448 0.081 0.426 8e-08
Q8WY54 764 Protein phosphatase 1E OS yes N/A 0.448 0.079 0.426 8e-08
Q80Z30 750 Protein phosphatase 1E OS yes N/A 0.448 0.081 0.426 8e-08
P49593454 Protein phosphatase 1F OS no N/A 0.382 0.114 0.442 1e-05
Q9LNW3442 Protein phosphatase 2C 3 yes N/A 0.441 0.135 0.4 2e-05
Q9FIF5413 Probable protein phosphat no N/A 0.382 0.125 0.423 0.0001
Q5Z6F5327 Probable protein phosphat no N/A 0.713 0.296 0.330 0.0001
Q0D673290 Probable protein phosphat no N/A 0.404 0.189 0.343 0.0001
Q8CGA0452 Protein phosphatase 1F OS no N/A 0.375 0.112 0.431 0.0001
Q5SN75403 Probable protein phosphat no N/A 0.397 0.133 0.388 0.0003
>sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 Back     alignment and function desciption
 Score = 55.8 bits (133), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 52  LSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQS 111
           +S   G  + KPY+C D D     LDG+ED+L+LA DG ++ V   EA   V  HL E +
Sbjct: 396 VSRAIGDAEHKPYICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLKENN 455

Query: 112 G 112
           G
Sbjct: 456 G 456
Protein phosphatase that inactivates multifunctional CaM kinases such as CAMK4 and CAMK2. Dephosphorylates and inactivates PAK. May play a role in the inhibition of actin fiber stress breakdown and in morphological changes driven by TNK2/CDC42.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 Back     alignment and function description
>sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=2 SV=1 Back     alignment and function description
>sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 Back     alignment and function description
>sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 Back     alignment and function description
>sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 Back     alignment and function description
>sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 Back     alignment and function description
>sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=2 SV=1 Back     alignment and function description
>sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
432901513 615 PREDICTED: protein phosphatase 1E-like [ 0.448 0.099 0.475 5e-08
427795117 1654 Hypothetical protein, partial [Rhipiceph 0.389 0.032 0.509 1e-07
410914818 619 PREDICTED: protein phosphatase 1E-like [ 0.448 0.098 0.475 2e-07
348527936 617 PREDICTED: protein phosphatase 1E-like [ 0.448 0.098 0.459 2e-07
270013413 350 hypothetical protein TcasGA2_TC012009 [T 0.544 0.211 0.383 2e-07
66472780 633 protein phosphatase 1E [Danio rerio] gi| 0.448 0.096 0.442 4e-07
190339270 633 Protein phosphatase 1E (PP2C domain cont 0.448 0.096 0.442 4e-07
91090356 637 PREDICTED: similar to protein phosphatas 0.294 0.062 0.509 5e-07
332030509 403 Protein phosphatase 1F [Acromyrmex echin 0.411 0.138 0.446 6e-07
357605155 394 putative protein phosphatase 2c [Danaus 0.411 0.142 0.464 7e-07
>gi|432901513|ref|XP_004076872.1| PREDICTED: protein phosphatase 1E-like [Oryzias latipes] Back     alignment and taxonomy information
 Score = 62.8 bits (151), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 36/61 (59%)

Query: 52  LSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQS 111
           +S   G  + KPY+C D D     LDGSED+L+LA DG W+ V+  EA   V  HL E S
Sbjct: 306 VSRAIGDSEHKPYICGDADHSVFPLDGSEDYLILACDGFWDTVSPEEAVRVVSDHLQENS 365

Query: 112 G 112
           G
Sbjct: 366 G 366

Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|427795117|gb|JAA63010.1| Hypothetical protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|410914818|ref|XP_003970884.1| PREDICTED: protein phosphatase 1E-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|348527936|ref|XP_003451475.1| PREDICTED: protein phosphatase 1E-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|270013413|gb|EFA09861.1| hypothetical protein TcasGA2_TC012009 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|66472780|ref|NP_001018354.1| protein phosphatase 1E [Danio rerio] gi|62857004|dbj|BAD95887.1| Ca/calmodulin-dependent protein kinase phosphatase-N [Danio rerio] Back     alignment and taxonomy information
>gi|190339270|gb|AAI62507.1| Protein phosphatase 1E (PP2C domain containing) [Danio rerio] Back     alignment and taxonomy information
>gi|91090356|ref|XP_967846.1| PREDICTED: similar to protein phosphatase 2c [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332030509|gb|EGI70197.1| Protein phosphatase 1F [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357605155|gb|EHJ64491.1| putative protein phosphatase 2c [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
ZFIN|ZDB-GENE-070326-2 633 ppm1e "protein phosphatase 1E 0.448 0.096 0.442 1.8e-08
UNIPROTKB|F1NZD1 548 PPM1E "Uncharacterized protein 0.448 0.111 0.442 6.5e-08
UNIPROTKB|F1NZC9 601 PPM1E "Uncharacterized protein 0.448 0.101 0.442 7.5e-08
UNIPROTKB|F1N580 601 PPM1E "Uncharacterized protein 0.448 0.101 0.426 1.6e-07
UNIPROTKB|F1S261 601 PPM1E "Uncharacterized protein 0.448 0.101 0.426 1.6e-07
MGI|MGI:2444096 749 Ppm1e "protein phosphatase 1E 0.448 0.081 0.426 2.1e-07
RGD|735028 750 Ppm1e "protein phosphatase, Mg 0.448 0.081 0.426 2.1e-07
UNIPROTKB|J9P9L8 755 PPM1E "Uncharacterized protein 0.448 0.080 0.426 2.1e-07
UNIPROTKB|Q8WY54 764 PPM1E "Protein phosphatase 1E" 0.448 0.079 0.426 2.2e-07
UNIPROTKB|G3HFY1448 I79_009498 "Protein phosphatas 0.441 0.133 0.435 4.5e-07
ZFIN|ZDB-GENE-070326-2 ppm1e "protein phosphatase 1E (PP2C domain containing)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 139 (54.0 bits), Expect = 1.8e-08, P = 1.8e-08
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query:    52 LSEQSGAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQS 111
             +S   G  + KPY+C D D    +LDGSED+L+LA DG ++ V   EA   V  HL E +
Sbjct:   314 VSRAIGDSEHKPYICGDADCSTFNLDGSEDYLILACDGFYDTVNPEEAVRVVSDHLQENN 373

Query:   112 G 112
             G
Sbjct:   374 G 374
GO:0003824 "catalytic activity" evidence=IEA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=IEA
GO:0006470 "protein dephosphorylation" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0016311 "dephosphorylation" evidence=IDA
GO:0016301 "kinase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
UNIPROTKB|F1NZD1 PPM1E "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZC9 PPM1E "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N580 PPM1E "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S261 PPM1E "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2444096 Ppm1e "protein phosphatase 1E (PP2C domain containing)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735028 Ppm1e "protein phosphatase, Mg2+/Mn2+ dependent, 1E" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9L8 PPM1E "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WY54 PPM1E "Protein phosphatase 1E" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3HFY1 I79_009498 "Protein phosphatase 1F" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
cd00143254 cd00143, PP2Cc, Serine/threonine phosphatases, fam 9e-12
cd00143254 cd00143, PP2Cc, Serine/threonine phosphatases, fam 5e-11
smart00332252 smart00332, PP2Cc, Serine/threonine phosphatases, 4e-10
smart00332252 smart00332, PP2Cc, Serine/threonine phosphatases, 3e-09
pfam00481252 pfam00481, PP2C, Protein phosphatase 2C 1e-08
pfam00481252 pfam00481, PP2C, Protein phosphatase 2C 2e-08
COG0631262 COG0631, PTC1, Serine/threonine protein phosphatas 5e-04
COG0631262 COG0631, PTC1, Serine/threonine protein phosphatas 5e-04
>gnl|CDD|238083 cd00143, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information 
 Score = 60.0 bits (146), Expect = 9e-12
 Identities = 23/55 (41%), Positives = 35/55 (63%)

Query: 57  GAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQS 111
           G  D KP V A+PDV  + L   +DFL+LA+DGLW+ ++  EA   V + L+++ 
Sbjct: 172 GDFDLKPGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED 226

Length = 254
>gnl|CDD|238083 cd00143, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
>gnl|CDD|214625 smart00332, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>gnl|CDD|214625 smart00332, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>gnl|CDD|215938 pfam00481, PP2C, Protein phosphatase 2C Back     alignment and domain information
>gnl|CDD|215938 pfam00481, PP2C, Protein phosphatase 2C Back     alignment and domain information
>gnl|CDD|223704 COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223704 COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
KOG0699|consensus542 99.95
KOG0697|consensus379 99.95
KOG0698|consensus330 99.95
PF00481254 PP2C: Protein phosphatase 2C; InterPro: IPR001932 99.89
KOG0700|consensus390 99.87
PLN03145365 Protein phosphatase 2c; Provisional 99.83
PTZ00224 381 protein phosphatase 2C; Provisional 99.73
COG0631262 PTC1 Serine/threonine protein phosphatase [Signal 99.44
KOG1323|consensus493 99.4
smart00332255 PP2Cc Serine/threonine phosphatases, family 2C, ca 99.24
cd00143254 PP2Cc Serine/threonine phosphatases, family 2C, ca 99.17
KOG0618|consensus 1081 99.05
KOG0698|consensus330 98.9
KOG0697|consensus379 98.87
KOG0700|consensus390 98.86
KOG0699|consensus542 98.62
PRK14559645 putative protein serine/threonine phosphatase; Pro 98.62
PF00481254 PP2C: Protein phosphatase 2C; InterPro: IPR001932 98.54
PLN03145365 Protein phosphatase 2c; Provisional 98.17
KOG1323|consensus493 97.65
KOG1379|consensus330 97.33
PTZ00224381 protein phosphatase 2C; Provisional 97.12
smart00331193 PP2C_SIG Sigma factor PP2C-like phosphatases. 97.04
COG0631262 PTC1 Serine/threonine protein phosphatase [Signal 96.84
smart00332255 PP2Cc Serine/threonine phosphatases, family 2C, ca 96.48
cd00143254 PP2Cc Serine/threonine phosphatases, family 2C, ca 96.15
TIGR02865764 spore_II_E stage II sporulation protein E. Stage I 95.68
PF13672212 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 95.54
PF07228193 SpoIIE: Stage II sporulation protein E (SpoIIE); I 92.34
KOG0640|consensus430 82.29
>KOG0699|consensus Back     alignment and domain information 
Probab=99.95  E-value=1.3e-29  Score=201.60  Aligned_cols=117  Identities=26%  Similarity=0.395  Sum_probs=108.1

Q ss_pred             CCCCCCCCCCCCcEEEEecCCCcceEEEecCCceeeeehhhhcccccccccccCCCccCC---------cccccCCceEE
Q psy10596          3 AKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFK---------PYVCADPDVIC   73 (136)
Q Consensus         3 d~dhkp~~~~E~~iri~~~gg~~~f~vla~dG~w~v~~~~~~~~~v~l~vSRa~Gd~~~k---------~~v~~~P~v~~   73 (136)
                      ..||||-..-|-. ||+++||    .| .-||  ||.+        +|.+||+|||+.+|         ++|++-|+|+.
T Consensus       366 S~DHKPEDevE~~-RI~~AGG----~v-tlDG--RVNG--------GLNLSRA~GDHaYK~N~~Lp~eEQMIsALPDiK~  429 (542)
T KOG0699|consen  366 SVDHKPEDEVETN-RIHAAGG----QV-TLDG--RVNG--------GLNLSRAFGDHAYKKNQELPLEEQMISALPDIKI  429 (542)
T ss_pred             ccCCCcccHHHHH-HHHhcCC----eE-eecc--eecC--------ccchhhhhhhhhhhcccCCChHHHHhhhccccee
Confidence            4699999999998 9999999    44 3467  5677        79999999999987         37999999999


Q ss_pred             EecCCCCcEEEEeccCCcccCChHHHHHHHHHhhhcccCccchH-HHHHHHHh----ccCCCCCCCC
Q psy10596         74 LDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTL-FFLDEIWS----MVGIGCSNLG  135 (136)
Q Consensus        74 ~~l~~~~~flilasDGlwd~~s~~~~~~~v~~~~~~~~~~~~~~-~~~~~~~a----~~~~~~Dn~~  135 (136)
                      ..|+++++|+||||||||.+||+|++|+|||..+..+...+.+| +|+|.|||    +.|.||||||
T Consensus       430 l~lTpedEFmVvACDGIWN~MsSqeVVdFvr~~l~~n~~ls~iceeL~D~CLAp~T~GDGTGCDNMT  496 (542)
T KOG0699|consen  430 LALTPEDEFMVVACDGIWNSMSSQEVVDFVRDLLAKNSSLSEICEELCDACLAPSTDGDGTGCDNMT  496 (542)
T ss_pred             EeecCcccEEEEEccchhhhccHHHHHHHHHHHHhcCchHHHHHHHHHHhhcCCCCCCCCcCCCcce
Confidence            99999999999999999999999999999999999999999999 99999999    8899999998

>KOG0697|consensus Back     alignment and domain information
>KOG0698|consensus Back     alignment and domain information
>PF00481 PP2C: Protein phosphatase 2C; InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>KOG0700|consensus Back     alignment and domain information
>PLN03145 Protein phosphatase 2c; Provisional Back     alignment and domain information
>PTZ00224 protein phosphatase 2C; Provisional Back     alignment and domain information
>COG0631 PTC1 Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1323|consensus Back     alignment and domain information
>smart00332 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>cd00143 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0698|consensus Back     alignment and domain information
>KOG0697|consensus Back     alignment and domain information
>KOG0700|consensus Back     alignment and domain information
>KOG0699|consensus Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PF00481 PP2C: Protein phosphatase 2C; InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>PLN03145 Protein phosphatase 2c; Provisional Back     alignment and domain information
>KOG1323|consensus Back     alignment and domain information
>KOG1379|consensus Back     alignment and domain information
>PTZ00224 protein phosphatase 2C; Provisional Back     alignment and domain information
>smart00331 PP2C_SIG Sigma factor PP2C-like phosphatases Back     alignment and domain information
>COG0631 PTC1 Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>smart00332 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>cd00143 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
>TIGR02865 spore_II_E stage II sporulation protein E Back     alignment and domain information
>PF13672 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 2V06_A 2JFR_A 2J86_A 2J82_A 2Y09_A 2XZV_A 2CM1_A 1TXO_B Back     alignment and domain information
>PF07228 SpoIIE: Stage II sporulation protein E (SpoIIE); InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 3e-13
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 3e-13
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 6e-13
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 1e-12
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 1e-11
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 4e-11
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 2e-11
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 1e-10
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 5e-10
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 8e-10
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 6e-10
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 1e-09
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 1e-09
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 4e-09
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 3e-09
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 7e-09
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 1e-08
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 1e-08
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 8e-08
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 9e-08
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 4e-07
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 4e-07
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 1e-05
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 7e-05
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 5e-05
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 5e-05
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Length = 316 Back     alignment and structure
 Score = 64.1 bits (156), Expect = 3e-13
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 57  GAKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGL 113
           G +  KP +  DP+V  +     +D L+LA+DG+W+ +T+ EA       +      
Sbjct: 198 GDRYLKPSIIPDPEVTAVKRVKEDDCLILASDGVWDVMTDEEACEMARKRILLWHKK 254
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Length = 316 Back     alignment and structure
>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3ujg_B 3nmt_B* 3rt0_A 3kb3_B* Length = 337 Back     alignment and structure
>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3ujg_B 3nmt_B* 3rt0_A 3kb3_B* Length = 337 Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Length = 389 Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Length = 389 Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Length = 274 Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Length = 274 Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Length = 307 Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Length = 307 Back     alignment and structure
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Length = 304 Back     alignment and structure
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Length = 304 Back     alignment and structure
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Length = 324 Back     alignment and structure
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Length = 324 Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Length = 382 Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Length = 382 Back     alignment and structure
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Length = 377 Back     alignment and structure
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Length = 377 Back     alignment and structure
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Length = 467 Back     alignment and structure
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Length = 467 Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Length = 401 Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Length = 401 Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Length = 364 Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Length = 364 Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Length = 358 Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Length = 358 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 99.82
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 99.82
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 99.82
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 99.8
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 99.79
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 99.79
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 99.78
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 99.77
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 99.77
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 99.76
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 99.76
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 99.76
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 99.67
2pk0_A250 Serine/threonine protein phosphatase STP1; SI moti 99.23
2j82_A240 TPPHA, protein serine-threonine phosphatase; PP2C 99.19
2jfr_A234 Ser-Thr phosphatase MSPP; hydrolase, PPM phosphata 99.12
1txo_A237 Putative bacterial enzyme; serine/threonine protei 99.11
3rnr_A211 Stage II sporulation E family protein; structural 98.91
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 98.33
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 98.03
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 98.02
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 97.95
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 97.94
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 97.86
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 97.83
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 97.82
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 97.79
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 97.74
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 97.69
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.34
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 97.25
3t91_A242 Stage II sporulation protein E; SPOIIE, phosphatas 96.62
2pk0_A250 Serine/threonine protein phosphatase STP1; SI moti 95.87
3f79_A255 Probable two-component response regulator; adaptor 95.75
3zt9_A193 Serine phosphatase; hydrolase, signal transduction 95.73
3pu9_A242 Protein serine/threonine phosphatase; PSI-biology, 95.67
1txo_A237 Putative bacterial enzyme; serine/threonine protei 95.53
2j82_A240 TPPHA, protein serine-threonine phosphatase; PP2C 95.17
2jfr_A234 Ser-Thr phosphatase MSPP; hydrolase, PPM phosphata 94.77
3rnr_A211 Stage II sporulation E family protein; structural 93.1
3ke6_A 399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 84.86
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Back     alignment and structure
Probab=99.82  E-value=3.1e-21  Score=155.38  Aligned_cols=117  Identities=14%  Similarity=0.110  Sum_probs=95.3

Q ss_pred             CCCCCCCCCCCCcEEEEecCCCcceEEEecCCceeeeehhhhcccccccccccCCCccCC---------cccccCCceEE
Q psy10596          3 AKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFK---------PYVCADPDVIC   73 (136)
Q Consensus         3 d~dhkp~~~~E~~iri~~~gg~~~f~vla~dG~w~v~~~~~~~~~v~l~vSRa~Gd~~~k---------~~v~~~P~v~~   73 (136)
                      .+||+|..+.|.. ||.+.+|    .+....|.||+.+        .|++||+|||..+|         |+++++|++..
T Consensus       190 T~DH~~~~~~E~~-RI~~~gg----~v~~~~g~~rv~G--------~l~vtRalGd~~~k~~~~~~~~~~~v~~~Pdv~~  256 (377)
T 3d8k_A          190 STPHTASSHKERH-RVQAAGG----VFTTVNGELLLGG--------VVPMTRAFGSFDFKKGGQGKLQQDLVSAVPDVTT  256 (377)
T ss_dssp             SCCCSSSSHHHHH-HHHTTTC----CEEECSSSEEETT--------TBSCSBCSSCGGGSCC---CCSSCSSBCCCEEEE
T ss_pred             CcCCCCCCHHHHH-HHHHcCC----EEEecCCcEEEcC--------ceecceeecChhhhcccccccccCccccCCcEEE
Confidence            5799999999998 9999999    5555678888876        68999999999887         58999999999


Q ss_pred             EecCCCCcEEEEeccCCcccCChHHHHHHHHHhhhc-ccCccchH-HHHHHHHhccCCCCCCCC
Q psy10596         74 LDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSE-QSGLLSTL-FFLDEIWSMVGIGCSNLG  135 (136)
Q Consensus        74 ~~l~~~~~flilasDGlwd~~s~~~~~~~v~~~~~~-~~~~~~~~-~~~~~~~a~~~~~~Dn~~  135 (136)
                      ++++++| |||||||||||+++++|+++.+.+.+.. .......+ .|++.++..  ++.||||
T Consensus       257 ~~l~~~D-~llL~SDGl~d~ls~~e~v~~v~~~~~~~~~~~~~~a~~Lv~~A~~~--g~~DNiT  317 (377)
T 3d8k_A          257 FFAYPGD-DIVAGTAGAFAHFRSHAAIAAAIALYPVSPETVLDAAKAMVVNAKRR--KVTKNIS  317 (377)
T ss_dssp             EEECTTC-EEEEECGGGGCSCSSHHHHHHHHTTSCCCGGGHHHHHHHHHHTTTTS--SCCSCCC
T ss_pred             EEcCCCC-EEEEEECCcccCCCcHHHHHHHHHHhhccCCCHHHHHHHHHHHHHhc--CCCCCEE
Confidence            9998774 8999999999999999999877664432 22333444 777776654  7799998
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Back     alignment and structure
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Back     alignment and structure
>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3zvu_B* 3ujg_B 3nmt_B* 4ds8_B* 3rt0_A 3kb3_B* Back     alignment and structure
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Back     alignment and structure
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2pk0_A Serine/threonine protein phosphatase STP1; SI motif, signaling protein; 2.65A {Streptococcus agalactiae} Back     alignment and structure
>2j82_A TPPHA, protein serine-threonine phosphatase; PP2C family phosphatase, hydrolase; 1.28A {Synechococcus elongatus} PDB: 2j86_A 2y09_A 2xzv_A Back     alignment and structure
>2jfr_A Ser-Thr phosphatase MSPP; hydrolase, PPM phosphatase, manganese, phosphate; 0.83A {Mycobacterium smegmatis} PDB: 2jfs_A 2jft_A 2v06_A Back     alignment and structure
>1txo_A Putative bacterial enzyme; serine/threonine protein phosphatases, PSTP/PPP, structural genomics, PSI, protein structure initiative; 1.95A {Mycobacterium tuberculosis} SCOP: d.219.1.1 PDB: 2cm1_A Back     alignment and structure
>3rnr_A Stage II sporulation E family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.00A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Back     alignment and structure
>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3zvu_B* 3ujg_B 3nmt_B* 4ds8_B* 3rt0_A 3kb3_B* Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Back     alignment and structure
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Back     alignment and structure
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Back     alignment and structure
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Back     alignment and structure
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Back     alignment and structure
>3t91_A Stage II sporulation protein E; SPOIIE, phosphatase, manganese binding, PP2C PH domain; HET: GL0 MAN; 2.64A {Bacillus subtilis} PDB: 3t9q_A* Back     alignment and structure
>2pk0_A Serine/threonine protein phosphatase STP1; SI motif, signaling protein; 2.65A {Streptococcus agalactiae} Back     alignment and structure
>3f79_A Probable two-component response regulator; adaptor, signaling protein; 2.80A {Pseudomonas aeruginosa} PDB: 3es2_A Back     alignment and structure
>3zt9_A Serine phosphatase; hydrolase, signal transduction, protein protein interaction,; HET: PEG; 1.75A {Moorella thermoacetica} Back     alignment and structure
>3pu9_A Protein serine/threonine phosphatase; PSI-biology, MCSG, structural genomics; HET: MSE; 1.55A {Sphaerobacter thermophilus} Back     alignment and structure
>1txo_A Putative bacterial enzyme; serine/threonine protein phosphatases, PSTP/PPP, structural genomics, PSI, protein structure initiative; 1.95A {Mycobacterium tuberculosis} SCOP: d.219.1.1 PDB: 2cm1_A Back     alignment and structure
>2j82_A TPPHA, protein serine-threonine phosphatase; PP2C family phosphatase, hydrolase; 1.28A {Synechococcus elongatus} PDB: 2j86_A 2y09_A 2xzv_A Back     alignment and structure
>2jfr_A Ser-Thr phosphatase MSPP; hydrolase, PPM phosphatase, manganese, phosphate; 0.83A {Mycobacterium smegmatis} PDB: 2jfs_A 2jft_A 2v06_A Back     alignment and structure
>3rnr_A Stage II sporulation E family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.00A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1a6qa2295 d.219.1.1 (A:2-296) Protein serine/threonine phosp 3e-05
d1a6qa2295 d.219.1.1 (A:2-296) Protein serine/threonine phosp 3e-05
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PP2C-like
superfamily: PP2C-like
family: PP2C-like
domain: Protein serine/threonine phosphatase 2C, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 7   KPYVCADPDVICLDLD-GSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKD 60
           +  V  +P+V  ++     + F++LA DG+W+ +   E    V + L      + 
Sbjct: 211 EQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEK 265
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1a6qa2295 Protein serine/threonine phosphatase 2C, catalytic 99.84
d1txoa_235 putative serine/threonine phosphatase pstp/ppp {My 99.06
d1a6qa2295 Protein serine/threonine phosphatase 2C, catalytic 98.06
d1txoa_235 putative serine/threonine phosphatase pstp/ppp {My 95.73
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PP2C-like
superfamily: PP2C-like
family: PP2C-like
domain: Protein serine/threonine phosphatase 2C, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=1.2e-22  Score=156.34  Aligned_cols=114  Identities=20%  Similarity=0.290  Sum_probs=97.5

Q ss_pred             CCCCCCCCCCCCcEEEEecCCCcceEEEecCCceeeeehhhhcccccccccccCCCccCC---------cccccCCceEE
Q psy10596          3 AKDFKPYVCADPDVICLDLDGSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGAKDFK---------PYVCADPDVIC   73 (136)
Q Consensus         3 d~dhkp~~~~E~~iri~~~gg~~~f~vla~dG~w~v~~~~~~~~~v~l~vSRa~Gd~~~k---------~~v~~~P~v~~   73 (136)
                      ..||+|..+.|.. ||.+.||    .|..    +++.+        .+++||+|||..+|         ++++++|++..
T Consensus       160 T~dH~~~~~~E~~-Ri~~~gg----~v~~----~r~~g--------~l~~tRa~Gd~~~k~~~~~~~~~~~v~~~Pdi~~  222 (295)
T d1a6qa2         160 TQDHKPSNPLEKE-RIQNAGG----SVMI----QRVNG--------SLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHD  222 (295)
T ss_dssp             CCCCCTTSHHHHH-HHHHTTC----CEET----TEETT--------TBSCSBCEECGGGSCCTTCCGGGSSSBCCCEEEE
T ss_pred             ccccCcccHHHHh-hHhhcCC----cccc----cccCC--------ceeeeeccCcHHhhhccccCcccccccccccceE
Confidence            4799999999999 9999999    4432    34444        57999999999887         46999999999


Q ss_pred             EecC-CCCcEEEEeccCCcccCChHHHHHHHHHhhhcccCccchH-HHHHHHHhccCCCCCCCC
Q psy10596         74 LDLD-GSEDFLLLATDGLWEKVTELEAASSVYTHLSEQSGLLSTL-FFLDEIWSMVGIGCSNLG  135 (136)
Q Consensus        74 ~~l~-~~~~flilasDGlwd~~s~~~~~~~v~~~~~~~~~~~~~~-~~~~~~~a~~~~~~Dn~~  135 (136)
                      +++. ++++|||||||||||+++++|++++|++.+.....+...+ +|++.|+..  ++.||||
T Consensus       223 ~~~~~~~~~flvL~SDGl~d~l~~~ei~~~v~~~~~~~~~~~~~a~~Lv~~A~~~--gs~DNiT  284 (295)
T d1a6qa2         223 IERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYK--GSRDNMS  284 (295)
T ss_dssp             EECCTTTEEEEEEECHHHHTTSCHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHT--TCCSCEE
T ss_pred             EEeecccceeEeeecCcccccCCHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHhc--CCCCCeE
Confidence            9986 5678999999999999999999999999988777777777 899998875  5689997
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure