Psyllid ID: psy10598


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MKLAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVHQVLYEPKYVGN
ccccEEEEEEEcccccccccccEEEEEccccccccccccccccccEEEEEEccccHHHHHHHHccccEEcccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccccc
ccHHHHHHHccccccccccccccEEEEEccccHHHHHcccccccccEEEEEccccccHHHHHHccccccccccccccccHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccccc
MKLAVAFLFLAFltspgchgynilvfgvfpftshfrkcyyiphpkcrlfithggvhsaFESIYHAVPMVIVPlfadqkqngqkaeeegyglmvdfdvfdyEELRRKVHQVLYEPKYVGN
MKLAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVhqvlyepkyvgn
MKlavaflflaflTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVHQVLYEPKYVGN
**LAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQ*********EGYGLMVDFDVFDYEELRRKVHQVLYEPK****
MKLAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVHQVLYEP*Y***
MKLAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQ********EEGYGLMVDFDVFDYEELRRKVHQVLYEPKYVGN
MKLAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVHQVLYEPKY***
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLAVAFLFLAFLTSPGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVHQVLYEPKYVGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
O02663529 UDP-glucuronosyltransfera N/A N/A 0.647 0.145 0.441 8e-14
P16662529 UDP-glucuronosyltransfera yes N/A 0.647 0.145 0.428 2e-13
Q9XT55528 UDP-glucuronosyltransfera N/A N/A 0.647 0.145 0.441 2e-13
O97951529 UDP-glucuronosyltransfera N/A N/A 0.647 0.145 0.441 4e-13
Q9GLD9529 UDP-glucuronosyltransfera no N/A 0.647 0.145 0.428 4e-13
Q9TSL6529 UDP-glucuronosyltransfera N/A N/A 0.647 0.145 0.428 7e-13
P36514502 UDP-glucuronosyltransfera no N/A 0.647 0.153 0.415 1e-12
P36537528 UDP-glucuronosyltransfera no N/A 0.647 0.145 0.415 1e-12
P06133528 UDP-glucuronosyltransfera no N/A 0.647 0.145 0.428 2e-12
Q8BWQ1534 UDP-glucuronosyltransfera yes N/A 0.823 0.183 0.365 2e-12
>sp|O02663|UD2B9_MACFA UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis GN=UGT2B9 PE=2 SV=1 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 47/77 (61%)

Query: 43  HPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEE 102
           HPK R FITHGG +  +E+IYH VPMV +PLFADQ  N    + +G  + +DFD     +
Sbjct: 365 HPKTRAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTKGAAVRLDFDTMSSTD 424

Query: 103 LRRKVHQVLYEPKYVGN 119
           L  ++  V+ +P Y  N
Sbjct: 425 LANRLKTVINDPLYKEN 441




UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on C18, C19, and C21 steroids, bile acids, and several xenobiotics including eugenol, 1-naphthol, and p-nitrophenol.
Macaca fascicularis (taxid: 9541)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|P16662|UD2B7_HUMAN UDP-glucuronosyltransferase 2B7 OS=Homo sapiens GN=UGT2B7 PE=1 SV=1 Back     alignment and function description
>sp|Q9XT55|UDB19_MACFA UDP-glucuronosyltransferase 2B19 OS=Macaca fascicularis GN=UGT2B19 PE=1 SV=1 Back     alignment and function description
>sp|O97951|UDB18_MACFA UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis GN=UGT2B18 PE=1 SV=1 Back     alignment and function description
>sp|Q9GLD9|UDB33_MACMU UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta GN=UGT2B33 PE=1 SV=1 Back     alignment and function description
>sp|Q9TSL6|UDB23_MACFA UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis GN=UGT2B23 PE=1 SV=1 Back     alignment and function description
>sp|P36514|UD2C1_RABIT UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus GN=UGT2C1 PE=2 SV=1 Back     alignment and function description
>sp|P36537|UDB10_HUMAN UDP-glucuronosyltransferase 2B10 OS=Homo sapiens GN=UGT2B10 PE=1 SV=1 Back     alignment and function description
>sp|P06133|UD2B4_HUMAN UDP-glucuronosyltransferase 2B4 OS=Homo sapiens GN=UGT2B4 PE=1 SV=2 Back     alignment and function description
>sp|Q8BWQ1|UD2A3_MOUSE UDP-glucuronosyltransferase 2A3 OS=Mus musculus GN=Ugt2a3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
321455272 421 hypothetical protein DAPPUDRAFT_64677 [D 0.621 0.175 0.472 3e-15
321464624 310 hypothetical protein DAPPUDRAFT_199280 [ 0.621 0.238 0.5 4e-15
157109736 519 glucosyl/glucuronosyl transferases [Aede 0.621 0.142 0.459 9e-15
194760013 543 GF15366 [Drosophila ananassae] gi|190615 0.638 0.139 0.434 8e-14
91090210 528 PREDICTED: similar to glucosyl/glucurono 0.663 0.149 0.455 1e-13
189240912 526 PREDICTED: similar to glucosyl/glucurono 0.663 0.150 0.455 1e-13
170057588 330 glucosyl/glucuronosyl transferase [Culex 0.647 0.233 0.402 1e-13
270013464 530 hypothetical protein TcasGA2_TC012063 [T 0.663 0.149 0.455 1e-13
189236608 485 PREDICTED: similar to CG30438 CG30438-PB 0.621 0.152 0.459 1e-13
347967888 533 AGAP002449-PA [Anopheles gambiae str. PE 0.621 0.138 0.445 2e-13
>gi|321455272|gb|EFX66409.1| hypothetical protein DAPPUDRAFT_64677 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 52/74 (70%)

Query: 43  HPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEE 102
           HPK RLFI HGG++S  E++YH VP + +PLFADQ  N QKA+++GY + +D+D    E 
Sbjct: 243 HPKIRLFINHGGLNSKQEAVYHGVPFIALPLFADQPINAQKAQDDGYAIRLDWDTLTEEI 302

Query: 103 LRRKVHQVLYEPKY 116
           L   + ++L +P+Y
Sbjct: 303 LYDAIQRILTDPRY 316




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321464624|gb|EFX75631.1| hypothetical protein DAPPUDRAFT_199280 [Daphnia pulex] Back     alignment and taxonomy information
>gi|157109736|ref|XP_001650803.1| glucosyl/glucuronosyl transferases [Aedes aegypti] gi|108878939|gb|EAT43164.1| AAEL005375-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194760013|ref|XP_001962236.1| GF15366 [Drosophila ananassae] gi|190615933|gb|EDV31457.1| GF15366 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|91090210|ref|XP_967762.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] gi|270013463|gb|EFA09911.1| hypothetical protein TcasGA2_TC012062 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240912|ref|XP_967685.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170057588|ref|XP_001864550.1| glucosyl/glucuronosyl transferase [Culex quinquefasciatus] gi|167876948|gb|EDS40331.1| glucosyl/glucuronosyl transferase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|270013464|gb|EFA09912.1| hypothetical protein TcasGA2_TC012063 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189236608|ref|XP_001816444.1| PREDICTED: similar to CG30438 CG30438-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347967888|ref|XP_312497.5| AGAP002449-PA [Anopheles gambiae str. PEST] gi|333468258|gb|EAA08100.5| AGAP002449-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
FB|FBgn0040251519 Ugt86Di "Ugt86Di" [Drosophila 0.638 0.146 0.447 2.6e-14
FB|FBgn0050438524 CG30438 [Drosophila melanogast 0.621 0.141 0.418 4.3e-14
FB|FBgn0032684530 CG10178 [Drosophila melanogast 0.638 0.143 0.394 7.2e-13
UNIPROTKB|P16662529 UGT2B7 "UDP-glucuronosyltransf 0.647 0.145 0.428 8.7e-13
FB|FBgn0040260543 Ugt36Bc "Ugt36Bc" [Drosophila 0.638 0.139 0.421 1.2e-12
FB|FBgn0040255527 Ugt86De "Ugt86De" [Drosophila 0.638 0.144 0.368 1.6e-12
UNIPROTKB|F5H377221 UGT3A2 "UDP-glucuronosyltransf 0.638 0.343 0.394 2.4e-12
UNIPROTKB|A6NCP7392 UGT2B4 "cDNA FLJ51299, highly 0.647 0.196 0.428 2.7e-12
UNIPROTKB|F5GY78238 UGT2A3 "UDP-glucuronosyltransf 0.647 0.323 0.402 3.1e-12
UNIPROTKB|B4DPP1444 UGT2B10 "cDNA FLJ54605, highly 0.647 0.173 0.415 3.6e-12
FB|FBgn0040251 Ugt86Di "Ugt86Di" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 2.6e-14, P = 2.6e-14
 Identities = 34/76 (44%), Positives = 50/76 (65%)

Query:    41 IPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDY 100
             + HPK   F+THGG+ S  ESIYHA P++ +P+F+DQ  N   AE+ GYG+M+DF   + 
Sbjct:   348 LAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAHAEQNGYGIMLDFKTLNA 407

Query:   101 EELRRKVHQVLYEPKY 116
              E R+ + ++  EP Y
Sbjct:   408 VEFRKAIERITSEPSY 423




GO:0015020 "glucuronosyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0050438 CG30438 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032684 CG10178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P16662 UGT2B7 "UDP-glucuronosyltransferase 2B7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0040260 Ugt36Bc "Ugt36Bc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040255 Ugt86De "Ugt86De" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F5H377 UGT3A2 "UDP-glucuronosyltransferase 3A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6NCP7 UGT2B4 "cDNA FLJ51299, highly similar to UDP-glucuronosyltransferase 2B4 (EC 2.4.1.17)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GY78 UGT2A3 "UDP-glucuronosyltransferase 2A3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DPP1 UGT2B10 "cDNA FLJ54605, highly similar to UDP-glucuronosyltransferase 2B10 (EC 2.4.1.17)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 4e-18
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 7e-16
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 2e-15
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 4e-15
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 2e-11
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 1e-06
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 2e-06
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 5e-06
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 8e-05
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 4e-04
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 5e-04
PLN02764453 PLN02764, PLN02764, glycosyltransferase family pro 6e-04
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 7e-04
PLN03015470 PLN03015, PLN03015, UDP-glucosyl transferase 0.001
pfam04101167 pfam04101, Glyco_tran_28_C, Glycosyltransferase fa 0.001
pfam13528317 pfam13528, Glyco_trans_1_3, Glycosyl transferase f 0.002
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 0.003
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
 Score = 77.8 bits (192), Expect = 4e-18
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 34  HFRKCYYIPH----PKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGY 89
           + R   ++PH    P+C   + HGG  +   ++   VP ++VP F DQ     +  E G 
Sbjct: 289 NVRVVDFVPHDWLLPRCAAVVHHGGAGTTAAALRAGVPQLVVPFFGDQPFWAARVAELGA 348

Query: 90  GLMVDFDVFDYEELRRKVHQVLYEP 114
           G  +D      E L   + ++L  P
Sbjct: 349 GPALDPRELTAERLAAALRRLLDPP 373


Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics. Length = 401

>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|217893 pfam04101, Glyco_tran_28_C, Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>gnl|CDD|222200 pfam13528, Glyco_trans_1_3, Glycosyl transferase family 1 Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 99.95
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.94
PLN02670472 transferase, transferring glycosyl groups 99.91
PLN03004451 UDP-glycosyltransferase 99.91
PLN02554481 UDP-glycosyltransferase family protein 99.9
PLN02562448 UDP-glycosyltransferase 99.9
PLN02208442 glycosyltransferase family protein 99.9
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.9
PLN02207468 UDP-glycosyltransferase 99.89
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.89
KOG1192|consensus496 99.88
PLN02167475 UDP-glycosyltransferase family protein 99.88
PLN02210456 UDP-glucosyl transferase 99.88
PLN02992481 coniferyl-alcohol glucosyltransferase 99.88
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.87
PLN02173449 UDP-glucosyl transferase family protein 99.87
PLN03007482 UDP-glucosyltransferase family protein 99.87
PLN00164480 glucosyltransferase; Provisional 99.87
PLN02448459 UDP-glycosyltransferase family protein 99.87
PLN02555480 limonoid glucosyltransferase 99.86
PLN02764453 glycosyltransferase family protein 99.86
PLN00414446 glycosyltransferase family protein 99.86
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.86
PLN03015470 UDP-glucosyl transferase 99.85
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.85
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.83
PLN02534491 UDP-glycosyltransferase 99.8
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.73
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.67
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.66
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.6
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.58
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.41
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.26
COG4671400 Predicted glycosyl transferase [General function p 99.24
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.23
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.14
PLN02605382 monogalactosyldiacylglycerol synthase 99.09
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.09
KOG3349|consensus170 98.93
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.92
TIGR03492396 conserved hypothetical protein. This protein famil 98.84
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.53
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.28
COG5017161 Uncharacterized conserved protein [Function unknow 98.27
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 98.27
cd03814364 GT1_like_2 This family is most closely related to 98.15
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.13
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 98.01
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 97.97
cd03801374 GT1_YqgM_like This family is most closely related 97.95
cd03795357 GT1_like_4 This family is most closely related to 97.92
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 97.91
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 97.91
cd03823359 GT1_ExpE7_like This family is most closely related 97.88
cd03808359 GT1_cap1E_like This family is most closely related 97.87
cd03800398 GT1_Sucrose_synthase This family is most closely r 97.85
cd03820348 GT1_amsD_like This family is most closely related 97.83
cd03812358 GT1_CapH_like This family is most closely related 97.82
cd03798377 GT1_wlbH_like This family is most closely related 97.7
cd03794394 GT1_wbuB_like This family is most closely related 97.7
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 97.69
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 97.69
cd04962371 GT1_like_5 This family is most closely related to 97.67
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 97.67
cd03817374 GT1_UGDG_like This family is most closely related 97.66
cd03821375 GT1_Bme6_like This family is most closely related 97.63
cd03807365 GT1_WbnK_like This family is most closely related 97.62
cd04946407 GT1_AmsK_like This family is most closely related 97.59
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 97.59
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 97.57
cd03804351 GT1_wbaZ_like This family is most closely related 97.54
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 97.53
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 97.53
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 97.52
cd03811353 GT1_WabH_like This family is most closely related 97.5
cd04951360 GT1_WbdM_like This family is most closely related 97.48
cd03825365 GT1_wcfI_like This family is most closely related 97.47
cd03818396 GT1_ExpC_like This family is most closely related 97.45
cd03822366 GT1_ecORF704_like This family is most closely rela 97.43
cd03805392 GT1_ALG2_like This family is most closely related 97.41
cd03819355 GT1_WavL_like This family is most closely related 97.39
cd04949372 GT1_gtfA_like This family is most closely related 97.38
PRK14089347 ipid-A-disaccharide synthase; Provisional 97.34
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 97.32
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 97.25
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 97.25
cd03813475 GT1_like_3 This family is most closely related to 97.24
PLN02275371 transferase, transferring glycosyl groups 97.08
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 97.07
cd03816415 GT1_ALG1_like This family is most closely related 97.05
cd03809365 GT1_mtfB_like This family is most closely related 96.88
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 96.71
PRK10307412 putative glycosyl transferase; Provisional 96.67
cd03802335 GT1_AviGT4_like This family is most closely relate 96.65
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 96.64
cd03796398 GT1_PIG-A_like This family is most closely related 96.32
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 96.31
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 96.28
cd04955363 GT1_like_6 This family is most closely related to 96.23
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 96.05
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 95.85
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 95.84
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 95.58
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 95.57
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 95.57
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 95.53
cd03806419 GT1_ALG11_like This family is most closely related 95.45
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 95.21
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 95.18
PLN02501 794 digalactosyldiacylglycerol synthase 94.83
PHA01633335 putative glycosyl transferase group 1 94.72
PLN02949463 transferase, transferring glycosyl groups 94.55
PLN02846462 digalactosyldiacylglycerol synthase 94.3
PRK14098489 glycogen synthase; Provisional 93.89
PLN00142815 sucrose synthase 93.75
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 92.81
TIGR02470784 sucr_synth sucrose synthase. This model represents 92.71
PHA01630331 putative group 1 glycosyl transferase 92.63
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 92.56
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 92.53
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 92.49
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 92.47
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 92.26
PRK10125405 putative glycosyl transferase; Provisional 92.13
PRK00654466 glgA glycogen synthase; Provisional 91.97
PLN02939977 transferase, transferring glycosyl groups 91.34
PRK10017426 colanic acid biosynthesis protein; Provisional 91.09
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 90.34
PRK14099485 glycogen synthase; Provisional 90.07
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 89.8
PRK04885 265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 89.7
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 89.47
PLN023161036 synthase/transferase 88.81
PRK02649 305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 88.17
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 87.91
PRK14077 287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 87.14
PRK02155 291 ppnK NAD(+)/NADH kinase family protein; Provisiona 86.92
PRK03372 306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 85.7
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 85.68
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [ 85.66
PRK01911 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 85.52
PRK02231 272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 85.39
PRK04539 296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 84.71
PRK03501 264 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.8
PRK01185 271 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.77
PRK03708 277 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.13
PRK03378 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 82.64
PRK14075 256 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 82.34
COG4370412 Uncharacterized protein conserved in bacteria [Fun 82.19
PRK01231 295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.28
PLN02929 301 NADH kinase 81.23
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
Probab=99.95  E-value=9.5e-29  Score=194.02  Aligned_cols=106  Identities=39%  Similarity=0.695  Sum_probs=92.2

Q ss_pred             eeeeecCC--CCCCCCCEEEEeeccCCccccccccccCCCeeEEEEcCChhHHHHHHHhCCCEEEccCcccHHHHHHHHH
Q psy10598          8 LFLAFLTS--PGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAE   85 (119)
Q Consensus         8 ~~~~~~~~--~~~l~~nv~~~~~~p~~~~~~~~~ll~~~~~~~~I~hgG~~t~~eal~~g~P~i~~P~~~dQ~~na~~~~   85 (119)
                      .++|+.+.  +..+|+|+.+.+|+||.+      +|+||++++||||||+||+.||+++|+|+|++|+++||..||++++
T Consensus       308 ~~iW~~~~~~~~~l~~n~~~~~W~PQ~~------lL~hp~v~~fitHgG~~s~~Ea~~~gvP~l~~P~~~DQ~~na~~~~  381 (500)
T PF00201_consen  308 RFIWKYEGEPPENLPKNVLIVKWLPQND------LLAHPRVKLFITHGGLNSTQEALYHGVPMLGIPLFGDQPRNAARVE  381 (500)
T ss_dssp             EEEEEETCSHGCHHHTTEEEESS--HHH------HHTSTTEEEEEES--HHHHHHHHHCT--EEE-GCSTTHHHHHHHHH
T ss_pred             cccccccccccccccceEEEeccccchh------hhhcccceeeeeccccchhhhhhhccCCccCCCCcccCCccceEEE
Confidence            57788775  356889999999999999      9999999999999999999999999999999999999999999999


Q ss_pred             HcCceeEecCCCCCHHHHHHHHHHHhcCcccccC
Q psy10598         86 EEGYGLMVDFDVFDYEELRRKVHQVLYEPKYVGN  119 (119)
Q Consensus        86 ~~G~g~~l~~~~~~~~~l~~~i~~~l~~~~~~~~  119 (119)
                      +.|+|+.++..+++.++|.++|+++++|++|++|
T Consensus       382 ~~G~g~~l~~~~~~~~~l~~ai~~vl~~~~y~~~  415 (500)
T PF00201_consen  382 EKGVGVVLDKNDLTEEELRAAIREVLENPSYKEN  415 (500)
T ss_dssp             HTTSEEEEGGGC-SHHHHHHHHHHHHHSHHHHHH
T ss_pred             EEeeEEEEEecCCcHHHHHHHHHHHHhhhHHHHH
Confidence            9999999999999999999999999999999864



This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PLN02929 NADH kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 4e-14
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 3e-08
2yjn_A441 Structure Of The Glycosyltransferase Eryciii From T 2e-05
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 3e-05
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 9e-05
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 1e-04
2vce_A480 Characterization And Engineering Of The Bifunctiona 1e-04
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 1e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 6/104 (5%) Query: 16 PGCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFA 75 P G N ++ P + + HPK R FITHGG + +E+IYH +P V +PLFA Sbjct: 63 PDTLGLNTRLYKWIP------QNDLLGHPKTRAFITHGGANGIYEAIYHGIPXVGIPLFA 116 Query: 76 DQKQNGQKAEEEGYGLMVDFDVFDYEELRRKVHQVLYEPKYVGN 119 DQ N + G + VDF+ +L + +V+ +P Y N Sbjct: 117 DQPDNIAHXKARGAAVRVDFNTXSSTDLLNALKRVINDPSYKEN 160
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2YJN|A Chain A, Structure Of The Glycosyltransferase Eryciii From The Erythromycin Biosynthetic Pathway, In Complex With Its Activating Partner, Erycii Length = 441 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 1e-31
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 3e-25
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 7e-24
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 3e-22
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 7e-22
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 1e-20
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 7e-20
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 3e-19
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 1e-18
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 1e-17
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 3e-15
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 8e-15
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 9e-15
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 1e-14
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 3e-10
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 2e-09
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 5e-09
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 1e-06
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 2e-06
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  108 bits (273), Expect = 1e-31
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 43  HPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFDVFDYEE 102
           HPK R FITHGG +  +E+IYH +PMV +PLFADQ  N    +  G  + VDF+     +
Sbjct: 84  HPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTD 143

Query: 103 LRRKVHQVLYEPKY 116
           L   + +V+ +P Y
Sbjct: 144 LLNALKRVINDPSY 157


>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} PDB: 3h4i_A* 1pn3_A* 1pnv_A* Length = 404 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.91
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.9
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.9
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.9
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.89
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.89
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.88
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.85
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.85
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.85
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.84
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.84
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.82
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.82
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.82
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.8
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.8
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.78
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.73
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.73
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.73
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.6
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.34
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.26
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.37
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.35
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.19
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.15
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 98.14
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 98.1
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.03
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.97
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 97.9
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 97.89
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 97.88
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 97.87
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 97.78
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 97.74
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 97.7
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.53
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 97.44
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 97.25
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 97.24
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 97.22
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 97.15
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 97.03
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 96.98
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 96.87
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 96.71
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 96.47
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 96.23
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 96.19
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 96.18
2iz6_A176 Molybdenum cofactor carrier protein; metal transpo 94.63
2i2c_A 272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 89.8
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 88.56
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.91  E-value=4.5e-24  Score=144.86  Aligned_cols=96  Identities=36%  Similarity=0.680  Sum_probs=90.0

Q ss_pred             CCCCCCEEEEeeccCCccccccccccCCCeeEEEEcCChhHHHHHHHhCCCEEEccCcccHHHHHHHHHHcCceeEecCC
Q psy10598         17 GCHGYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEEGYGLMVDFD   96 (119)
Q Consensus        17 ~~l~~nv~~~~~~p~~~~~~~~~ll~~~~~~~~I~hgG~~t~~eal~~g~P~i~~P~~~dQ~~na~~~~~~G~g~~l~~~   96 (119)
                      ..+++|+.+.+|+|+.+      ++.|+++|++|||||++|++|++++|+|+|++|...||..|++++++.|+|+.+..+
T Consensus        64 ~~~~~~v~~~~~~~~~~------~l~~~~ad~~I~~~G~~t~~Ea~~~G~P~i~~p~~~~Q~~na~~l~~~g~g~~~~~~  137 (170)
T 2o6l_A           64 DTLGLNTRLYKWIPQND------LLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFN  137 (170)
T ss_dssp             TTCCTTEEEESSCCHHH------HHTSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHTTTSEEECCTT
T ss_pred             ccCCCcEEEecCCCHHH------HhcCCCcCEEEEcCCccHHHHHHHcCCCEEeccchhhHHHHHHHHHHcCCeEEeccc
Confidence            45788999999999977      888899999999999999999999999999999999999999999999999999888


Q ss_pred             CCCHHHHHHHHHHHhcCccccc
Q psy10598         97 VFDYEELRRKVHQVLYEPKYVG  118 (119)
Q Consensus        97 ~~~~~~l~~~i~~~l~~~~~~~  118 (119)
                      +++.++|.++|.+++.|+++++
T Consensus       138 ~~~~~~l~~~i~~ll~~~~~~~  159 (170)
T 2o6l_A          138 TMSSTDLLNALKRVINDPSYKE  159 (170)
T ss_dssp             TCCHHHHHHHHHHHHHCHHHHH
T ss_pred             cCCHHHHHHHHHHHHcCHHHHH
Confidence            8899999999999999988765



>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 119
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 1e-17
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 6e-16
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 7e-16
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 2e-14
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 2e-13
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 1e-12
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 2e-11
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
 Score = 74.8 bits (182), Expect = 1e-17
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 43  HPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEEE-GYGLMVDFDVFDYE 101
           H     F+TH G +S +ES+   VP++  P F DQ+ NG+  E+    G+ ++  VF   
Sbjct: 335 HEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKS 394

Query: 102 ELRRKVHQVLYEPKY 116
            L     Q+L + K 
Sbjct: 395 GLMSCFDQILSQEKG 409


>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.94
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.94
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.93
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.92
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.92
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.91
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.89
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.73
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 97.92
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.79
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.85
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.14
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 96.0
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 95.63
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 93.36
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 87.28
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: Hydroquinone glucosyltransferase
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.94  E-value=3.6e-28  Score=181.78  Aligned_cols=94  Identities=24%  Similarity=0.302  Sum_probs=86.5

Q ss_pred             CCCEEEEeeccCCccccccccccCCCeeEEEEcCChhHHHHHHHhCCCEEEccCcccHHHHHHHHHH-cCceeEecCCC-
Q psy10598         20 GYNILVFGVFPFTSHFRKCYYIPHPKCRLFITHGGVHSAFESIYHAVPMVIVPLFADQKQNGQKAEE-EGYGLMVDFDV-   97 (119)
Q Consensus        20 ~~nv~~~~~~p~~~~~~~~~ll~~~~~~~~I~hgG~~t~~eal~~g~P~i~~P~~~dQ~~na~~~~~-~G~g~~l~~~~-   97 (119)
                      ++|+.+.+|+||.+      +|+||++++||||||+||++||+++|+|+|++|+++||+.||+++++ .|+|+.+...+ 
T Consensus       333 ~~nv~~~~w~Pq~~------lL~hp~~~~fVtHGG~gS~~EAl~~GvP~v~~P~~~DQ~~nA~rv~e~lG~Gv~l~~~~~  406 (471)
T d2vcha1         333 KRGFVIPFWAPQAQ------VLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDD  406 (471)
T ss_dssp             TTEEEEESCCCHHH------HHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTCCEECCCCCTT
T ss_pred             CCCeeecccCCHHH------HhcCccCCEEEecCCccHHHHHHHcCCCEEEcccccccHHHHHHHHHHheeEEEEecCCC
Confidence            56899999999999      99999999999999999999999999999999999999999999955 79999986644 


Q ss_pred             --CCHHHHHHHHHHHhcCcc---cccC
Q psy10598         98 --FDYEELRRKVHQVLYEPK---YVGN  119 (119)
Q Consensus        98 --~~~~~l~~~i~~~l~~~~---~~~~  119 (119)
                        ++.++|.++|+++++|++   ||+|
T Consensus       407 ~~~t~~~l~~ai~~vl~~~~~~~~r~r  433 (471)
T d2vcha1         407 GLVRREEVARVVKGLMEGEEGKGVRNK  433 (471)
T ss_dssp             SCCCHHHHHHHHHHHHTSTHHHHHHHH
T ss_pred             CcCCHHHHHHHHHHHhCCcHHHHHHHH
Confidence              799999999999999875   7753



>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure