Psyllid ID: psy10628
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 238 | ||||||
| 328720391 | 4083 | PREDICTED: spectrin beta chain-like isof | 0.802 | 0.046 | 0.651 | 4e-71 | |
| 328720389 | 4047 | PREDICTED: spectrin beta chain-like isof | 0.802 | 0.047 | 0.651 | 5e-71 | |
| 307173781 | 4197 | Spectrin beta chain, brain 4 [Camponotus | 0.802 | 0.045 | 0.656 | 2e-68 | |
| 383856370 | 4280 | PREDICTED: spectrin beta chain, brain 4- | 0.785 | 0.043 | 0.661 | 2e-67 | |
| 328777761 | 4216 | PREDICTED: spectrin beta chain [Apis mel | 0.785 | 0.044 | 0.651 | 3e-67 | |
| 350407651 | 4247 | PREDICTED: spectrin beta chain, brain 4- | 0.785 | 0.044 | 0.651 | 4e-67 | |
| 307194983 | 3331 | Spectrin beta chain, brain 4 [Harpegnath | 0.785 | 0.056 | 0.630 | 6e-67 | |
| 340717276 | 4224 | PREDICTED: spectrin beta chain, brain 4- | 0.785 | 0.044 | 0.646 | 1e-66 | |
| 380030708 | 4164 | PREDICTED: LOW QUALITY PROTEIN: spectrin | 0.785 | 0.044 | 0.646 | 1e-66 | |
| 340717274 | 4143 | PREDICTED: spectrin beta chain, brain 4- | 0.785 | 0.045 | 0.646 | 1e-66 |
| >gi|328720391|ref|XP_001946129.2| PREDICTED: spectrin beta chain-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 273 bits (698), Expect = 4e-71, Method: Compositional matrix adjust.
Identities = 127/195 (65%), Positives = 162/195 (83%)
Query: 39 NKEAFLNNDDIGESLSGVEALLRKHKAFEKALEAQLSRIDDLEKFAKDLLAEHHYDSSGI 98
+KEAFL+NDD+GESLS VE L+RKH+AFEK L AQL ++++LEK+A DL+ HYDS+GI
Sbjct: 2676 SKEAFLSNDDLGESLSSVEELIRKHEAFEKTLTAQLVKVEELEKYALDLVTGQHYDSNGI 2735
Query: 99 QQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESYRDP 158
Q RL ++ R+DRLKE + +R++RL +SR +QQFLRNMYEV GWI+QKQQ+ DESYRDP
Sbjct: 2736 QGRLVSICNRRDRLKEATASRKRRLNDSRLLQQFLRNMYEVEGWIIQKQQVAGDESYRDP 2795
Query: 159 TNLQSKIQKHAAFESELAANKSRVGAVTAEGESLISGGHFAAAEIKTRLDELELEWRQLQ 218
TNLQ K+QKHA F+SEL AN++RV A+ EGE+LIS GHFA+ EI+ RLDELE +WR LQ
Sbjct: 2796 TNLQRKMQKHATFDSELIANRTRVNAICTEGENLISSGHFASMEIRVRLDELETKWRLLQ 2855
Query: 219 ESSALKRERLSDAYQ 233
E S+LK++RL DAYQ
Sbjct: 2856 EMSSLKKQRLQDAYQ 2870
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328720389|ref|XP_003247015.1| PREDICTED: spectrin beta chain-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307173781|gb|EFN64568.1| Spectrin beta chain, brain 4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383856370|ref|XP_003703682.1| PREDICTED: spectrin beta chain, brain 4-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328777761|ref|XP_396777.4| PREDICTED: spectrin beta chain [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350407651|ref|XP_003488149.1| PREDICTED: spectrin beta chain, brain 4-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307194983|gb|EFN77073.1| Spectrin beta chain, brain 4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340717276|ref|XP_003397111.1| PREDICTED: spectrin beta chain, brain 4-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380030708|ref|XP_003698985.1| PREDICTED: LOW QUALITY PROTEIN: spectrin beta chain, brain 4-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340717274|ref|XP_003397110.1| PREDICTED: spectrin beta chain, brain 4-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 238 | ||||||
| UNIPROTKB|F1NV58 | 3622 | SPTBN5 "Uncharacterized protei | 0.819 | 0.053 | 0.492 | 1.7e-50 | |
| FB|FBgn0004167 | 4337 | kst "karst" [Drosophila melano | 0.806 | 0.044 | 0.489 | 3.3e-48 | |
| ZFIN|ZDB-GENE-051113-60 | 2480 | spna2 "spectrin alpha 2" [Dani | 0.827 | 0.079 | 0.441 | 5.9e-46 | |
| FB|FBgn0250789 | 2415 | alpha-Spec "alpha Spectrin" [D | 0.827 | 0.081 | 0.451 | 4e-43 | |
| UNIPROTKB|F1NHT4 | 2445 | SPTAN1 "Spectrin alpha chain, | 0.827 | 0.080 | 0.426 | 6.5e-43 | |
| UNIPROTKB|F1NHT3 | 2465 | SPTAN1 "Spectrin alpha chain, | 0.827 | 0.079 | 0.426 | 6.7e-43 | |
| UNIPROTKB|F1NIU0 | 2470 | SPTAN1 "Spectrin alpha chain, | 0.827 | 0.079 | 0.426 | 6.7e-43 | |
| UNIPROTKB|P07751 | 2477 | SPTAN1 "Spectrin alpha chain, | 0.827 | 0.079 | 0.426 | 6.8e-43 | |
| UNIPROTKB|F1NHF0 | 2479 | SPTAN1 "Spectrin alpha chain, | 0.827 | 0.079 | 0.426 | 6.8e-43 | |
| UNIPROTKB|J9P2H0 | 2452 | SPTAN1 "Uncharacterized protei | 0.827 | 0.080 | 0.426 | 8.4e-43 |
| UNIPROTKB|F1NV58 SPTBN5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 507 (183.5 bits), Expect = 1.7e-50, Sum P(2) = 1.7e-50
Identities = 96/195 (49%), Positives = 139/195 (71%)
Query: 39 NKEAFLNNDDIGESLSGVEALLRKHKAFEKALEAQLSRIDDLEKFAKDLLAEHHYDSSGI 98
+KEAFL N+D+G+S+S VE+L RKH FEK+LEAQ+ +ID++ FA+ L+ HYDS I
Sbjct: 2574 SKEAFLANEDLGDSVSSVESLQRKHMQFEKSLEAQMEKIDEMASFAQQLIQNKHYDSDNI 2633
Query: 99 QQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESYRDP 158
R QAV+ RK++L E + ARR L ESR +Q+ L+N YEV WI +K I D+S+RDP
Sbjct: 2634 TNRCQAVLRRKEKLLENAAARRHLLEESRLLQKLLKNSYEVATWINEKNSIAQDDSWRDP 2693
Query: 159 TNLQSKIQKHAAFESELAANKSRVGAVTAEGESLISGGHFAAAEIKTRLDELELEWRQLQ 218
+NLQ+K+QKH +F++E+ ANK+R+ ++ +EGE +I H+A I++RL E+E W +L
Sbjct: 2694 SNLQTKLQKHQSFQAEIMANKNRLDSIKSEGEKMIRERHYAPEAIQSRLQEMEELWEELL 2753
Query: 219 ESSALKRERLSDAYQ 233
S KR +L DAY+
Sbjct: 2754 ASCQDKRAKLQDAYK 2768
|
|
| FB|FBgn0004167 kst "karst" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051113-60 spna2 "spectrin alpha 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0250789 alpha-Spec "alpha Spectrin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHT4 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHT3 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIU0 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07751 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHF0 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2H0 SPTAN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 238 | |||
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 7e-33 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 1e-17 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 3e-17 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 4e-16 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-15 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 6e-15 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 4e-04 |
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 118 bits (297), Expect = 7e-33
Identities = 66/197 (33%), Positives = 114/197 (57%), Gaps = 2/197 (1%)
Query: 38 ENKEAFLNNDDIGESLSGVEALLRKHKAFEKALEAQLSRIDDLEKFAKDLLAEHHYDSSG 97
KE L++ D G+ L VEALL+KH+A E L A R++ L + + L+ E H D+
Sbjct: 17 SEKEELLSSTDYGDDLESVEALLKKHEALEAELAAHEERVEALNELGEQLIEEGHPDAEE 76
Query: 98 IQQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESY-R 156
IQ+RL+ + R + L+E + RR+RL E+ +QQF R+ ++ W+ +K+ A E +
Sbjct: 77 IQERLEELNQRWEELRELAEERRQRLEEALDLQQFFRDADDLEQWLEEKEAALASEDLGK 136
Query: 157 DPTNLQSKIQKHAAFESELAANKSRVGAVTAEGESLISGGHFAA-AEIKTRLDELELEWR 215
D +++ ++KH E EL A++ R+ ++ E L+ GH A EI+ +L+EL W
Sbjct: 137 DLESVEELLKKHKELEEELEAHEPRLKSLNELAEELLEEGHPDADEEIEEKLEELNERWE 196
Query: 216 QLQESSALKRERLSDAY 232
+L E + ++++L +A
Sbjct: 197 ELLELAEERQKKLEEAL 213
|
Length = 213 |
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| KOG0517|consensus | 2473 | 99.97 | ||
| KOG0517|consensus | 2473 | 99.97 | ||
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 99.96 | |
| KOG0040|consensus | 2399 | 99.94 | ||
| KOG0040|consensus | 2399 | 99.89 | ||
| smart00150 | 101 | SPEC Spectrin repeats. | 99.68 | |
| smart00150 | 101 | SPEC Spectrin repeats. | 99.67 | |
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 99.65 | |
| KOG4286|consensus | 966 | 99.63 | ||
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 99.62 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 99.46 | |
| KOG4286|consensus | 966 | 99.13 | ||
| KOG4240|consensus | 1025 | 98.02 | ||
| KOG0035|consensus | 890 | 96.11 | ||
| KOG4240|consensus | 1025 | 95.75 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.62 | |
| KOG0994|consensus | 1758 | 86.38 | ||
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 84.73 | |
| TIGR03545 | 555 | conserved hypothetical protein TIGR03545. This mod | 80.86 | |
| KOG0516|consensus | 1047 | 80.1 |
| >KOG0517|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.3e-28 Score=232.24 Aligned_cols=233 Identities=32% Similarity=0.518 Sum_probs=219.9
Q ss_pred CchhhHHHHHHHHHchHH-HHhHhhh---HHHHHHHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHHHHHHHHHHHhHhhH
Q psy10628 2 NGDDGLSSLKEAFLNNDD-IGESLSG---VEALLRKHKAFENKEAFLNNDDIGESLSGVEALLRKHKAFEKALEAQLSRI 77 (238)
Q Consensus 2 ~~~~~~~~l~~~w~~r~~-l~~~l~~---~~~l~~l~~WL~~~e~~l~~~~~~~~l~~ve~~l~~h~~l~~~i~~~~~~v 77 (238)
+++.||..|..-|..|++ |.+.+.+ ..+..+.+.-+.+.|.+|+..++|.+++.++++|++|.+|...+.+...++
T Consensus 1141 ~L~~gw~eL~~mWe~Rq~~L~Q~l~lQ~F~Rda~q~ea~l~~qE~~L~~d~lp~sle~ae~~LKrh~DF~~tm~a~~~ki 1220 (2473)
T KOG0517|consen 1141 ALGTGWEELHRMWENRQKWLSQGLDLQLFLRDARQAEATLSNQEAFLSHDNLPDSLEEAEALLKRHRDFLTTMDANDEKI 1220 (2473)
T ss_pred HHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHhcccccccHHHHHHHHHHHHHHHHHHhcchHHH
Confidence 467899999999999987 5554433 235559999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhHhcCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhCCCCCC
Q psy10628 78 DDLEKFAKDLLAEHHYDSSGIQQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESYRD 157 (238)
Q Consensus 78 ~~l~~~~~~L~~~~~~~~~~i~~~l~~L~~rw~~L~~~~~~r~~~L~~~~~l~~f~~~~~~~~~WL~~~~~~l~~~~~~d 157 (238)
+.+...|+.|+..+|++++.|+++...|..+|..+...+.+|.++|.+++.++.|.++|+++..||.+|..+..+.++.+
T Consensus 1221 ~a~~~~gd~Lv~~~h~~s~~I~ek~~~I~~r~~~nr~rA~q~~~~L~~slelQ~flqd~~EL~~Wi~EK~l~a~Desy~~ 1300 (2473)
T KOG0517|consen 1221 EALVDTGDKLVSEGHIDSDKIREKAQSILARRKANRERAQQRLRKLKDSLELQEFLQDCDELKLWIEEKMLMAQDESYRD 1300 (2473)
T ss_pred HHHHHHHHHHHhcCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccchhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999988888888999
Q ss_pred hhhHHHHHHHHHHHHHHHHhhhhhHHhHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy10628 158 PTNLQSKIQKHAAFESELAANKSRVGAVTAEGESLISGGHFAAAEIKTRLDELELEWRQLQESSALKRERLSDAYQT 234 (238)
Q Consensus 158 ~~~i~~~l~kh~~~~~ei~~~~~~v~~l~~~g~~L~~~~~~~~~~i~~~~~~l~~~W~~L~~~~~~r~~~L~~a~~~ 234 (238)
+.+|...+.+|++|++||.++++.++.|...|+.|+..+|+..+.|+.++.+|+.+|..|...+.++...|.+|-+.
T Consensus 1301 ~~nl~~k~~kHqAFeaELaank~~l~~i~~eG~~L~~ekpe~~~~V~~kl~~L~~~W~~Le~~t~~Kg~~L~qA~~q 1377 (2473)
T KOG0517|consen 1301 ARNLHSKWLKHQAFEAELAANKEWLEKIEKEGQELVSEKPELKALVEKKLRELHKQWDELEKTTQEKGRKLFQANRQ 1377 (2473)
T ss_pred hhHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHhcCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999998764
|
|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >smart00150 SPEC Spectrin repeats | Back alignment and domain information |
|---|
| >smart00150 SPEC Spectrin repeats | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >KOG4286|consensus | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG4286|consensus | Back alignment and domain information |
|---|
| >KOG4240|consensus | Back alignment and domain information |
|---|
| >KOG0035|consensus | Back alignment and domain information |
|---|
| >KOG4240|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03545 conserved hypothetical protein TIGR03545 | Back alignment and domain information |
|---|
| >KOG0516|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 238 | ||||
| 3f31_A | 149 | Crystal Structure Of The N-Terminal Region Of Alpha | 3e-25 | ||
| 1u4q_A | 322 | Crystal Structure Of Repeats 15, 16 And 17 Of Chick | 4e-23 | ||
| 1u5p_A | 216 | Crystal Structure Of Repeats 15 And 16 Of Chicken B | 1e-22 | ||
| 1cun_A | 213 | Crystal Structure Of Repeats 16 And 17 Of Chicken B | 6e-19 | ||
| 1cun_A | 213 | Crystal Structure Of Repeats 16 And 17 Of Chicken B | 8e-09 | ||
| 3fb2_A | 218 | Crystal Structure Of The Human Brain Alpha Spectrin | 5e-16 | ||
| 3fb2_A | 218 | Crystal Structure Of The Human Brain Alpha Spectrin | 8e-06 | ||
| 1owa_A | 156 | Solution Structural Studies On Human Erythrocyte Al | 1e-15 | ||
| 3lbx_A | 161 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 1e-15 | ||
| 1aj3_A | 110 | Solution Structure Of The Spectrin Repeat, Nmr, 20 | 2e-09 | ||
| 2spc_A | 107 | Crystal Structure Of The Repetitive Segments Of Spe | 4e-09 | ||
| 2spc_A | 107 | Crystal Structure Of The Repetitive Segments Of Spe | 2e-04 | ||
| 3edv_A | 323 | Crystal Structure Of Repeats 14-16 Of Beta2-Spectri | 5e-08 | ||
| 1sjj_A | 863 | Cryo-Em Structure Of Chicken Gizzard Smooth Muscle | 8e-07 | ||
| 1hci_A | 476 | Crystal Structure Of The Rod Domain Of Alpha-Actini | 3e-06 | ||
| 1quu_A | 250 | Crystal Structure Of Two Central Spectrin-Like Repe | 3e-06 | ||
| 3kbu_A | 326 | Crystal Structure Of The Ankyrin Binding Domain Of | 8e-05 | ||
| 3kbt_A | 326 | Crystal Structure Of The Ankyrin Binding Domain Of | 1e-04 |
| >pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 | Back alignment and structure |
|
| >pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 | Back alignment and structure |
| >pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 | Back alignment and structure |
| >pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 | Back alignment and structure |
| >pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 | Back alignment and structure |
| >pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 | Back alignment and structure |
| >pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 | Back alignment and structure |
| >pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 | Back alignment and structure |
| >pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 | Back alignment and structure |
| >pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 | Back alignment and structure |
| >pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 | Back alignment and structure |
| >pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 | Back alignment and structure |
| >pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 | Back alignment and structure |
| >pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 | Back alignment and structure |
| >pdb|1HCI|A Chain A, Crystal Structure Of The Rod Domain Of Alpha-Actinin Length = 476 | Back alignment and structure |
| >pdb|1QUU|A Chain A, Crystal Structure Of Two Central Spectrin-Like Repeats From Alpha-Actinin Length = 250 | Back alignment and structure |
| >pdb|3KBU|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank), Emts Derivative Length = 326 | Back alignment and structure |
| >pdb|3KBT|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank) Length = 326 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 238 | |||
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 2e-34 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 4e-12 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 3e-06 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 1e-32 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 7e-30 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 3e-12 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 1e-11 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 4e-32 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 8e-14 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 8e-07 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 4e-32 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 1e-09 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 5e-06 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 4e-31 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 2e-09 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 8e-30 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 4e-10 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 8e-30 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 2e-15 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 4e-13 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 2e-29 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 3e-10 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 3e-29 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 4e-29 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 6e-15 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 7e-04 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 4e-29 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 6e-27 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 2e-10 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 3e-10 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 3e-27 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 4e-12 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 1e-07 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 2e-26 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 8e-08 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 1e-24 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 5e-16 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 1e-08 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 2e-22 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 1e-16 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 2e-06 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 1e-21 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 3e-11 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 6e-07 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 1e-20 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 6e-18 | |
| 2spc_A | 107 | Spectrin; cytoskeleton; 1.80A {Drosophila melanoga | 2e-20 | |
| 2spc_A | 107 | Spectrin; cytoskeleton; 1.80A {Drosophila melanoga | 9e-17 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 4e-18 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 6e-13 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 7e-10 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 3e-17 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 8e-14 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 8e-10 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 9e-09 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 1e-04 |
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
Score = 121 bits (306), Expect = 2e-34
Identities = 61/197 (30%), Positives = 108/197 (54%), Gaps = 1/197 (0%)
Query: 38 ENKEAFLNNDDIGESLSGVEALLRKHKAFEKALEAQLSRIDDLEKFAKDLLAEHHYDSSG 97
EA L ++D G+ L+ V LL+KH+ E + A R+ DL A L+ +D+S
Sbjct: 20 SEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQ 79
Query: 98 IQQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESY-R 156
++ + + + R R+K + ARR +L ES ++ QF R+M + WI +K+ + + E Y R
Sbjct: 80 VKDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGR 139
Query: 157 DPTNLQSKIQKHAAFESELAANKSRVGAVTAEGESLISGGHFAAAEIKTRLDELELEWRQ 216
D T +Q+ +KH E+ELAA++ + V G+ L EI+ RL + W++
Sbjct: 140 DLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKE 199
Query: 217 LQESSALKRERLSDAYQ 233
L++ +A + +RL ++ +
Sbjct: 200 LKQLAAARGQRLEESLE 216
|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 100.0 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 100.0 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 100.0 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 100.0 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 100.0 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 100.0 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 100.0 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 100.0 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 100.0 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 100.0 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 100.0 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 100.0 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 100.0 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 100.0 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 99.97 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 99.97 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 99.95 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.95 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.95 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 99.94 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 99.93 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 99.93 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 99.92 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.87 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 99.8 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 99.79 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 99.79 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.76 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 99.75 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 99.75 | |
| 2spc_A | 107 | Spectrin; cytoskeleton; 1.80A {Drosophila melanoga | 99.75 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 99.74 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 99.74 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 99.74 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 99.74 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 99.74 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 99.72 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.72 | |
| 2spc_A | 107 | Spectrin; cytoskeleton; 1.80A {Drosophila melanoga | 99.71 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.7 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 99.68 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 99.68 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 99.67 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 99.65 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 99.62 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 99.31 | |
| 1wlx_A | 129 | Alpha-actinin 4; three-helix bundle, protein bindi | 99.2 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 99.13 | |
| 1wlx_A | 129 | Alpha-actinin 4; three-helix bundle, protein bindi | 98.83 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 98.69 |
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.8e-37 Score=247.05 Aligned_cols=209 Identities=29% Similarity=0.505 Sum_probs=196.5
Q ss_pred hhHHHHHHHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHHHHHHHHHHHhHhhHHHHHHHHHhhHhcCCCCchHHHHHHHH
Q psy10628 25 SGVEALLRKHKAFENKEAFLNNDDIGESLSGVEALLRKHKAFEKALEAQLSRIDDLEKFAKDLLAEHHYDSSGIQQRLQA 104 (238)
Q Consensus 25 ~~~~~l~~l~~WL~~~e~~l~~~~~~~~l~~ve~~l~~h~~l~~~i~~~~~~v~~l~~~~~~L~~~~~~~~~~i~~~l~~ 104 (238)
.|...+.++.+||.+++..|.+.++|.|+..|+.++++|+.|+.+|.++.++|..|+..|..|+..++++++.|..++..
T Consensus 7 ~F~~~~~~l~~Wl~~~e~~l~~~~~g~dl~~v~~ll~kh~~le~~i~~~~~~v~~l~~~~~~L~~~~~~~~~~i~~~~~~ 86 (216)
T 1u5p_A 7 NFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRET 86 (216)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSSCTHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHhcCcccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCChHHHHHHHHH
Confidence 34445559999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhCCCC-CChhhHHHHHHHHHHHHHHHHhhhhhHH
Q psy10628 105 VIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESY-RDPTNLQSKIQKHAAFESELAANKSRVG 183 (238)
Q Consensus 105 L~~rw~~L~~~~~~r~~~L~~~~~l~~f~~~~~~~~~WL~~~~~~l~~~~~-~d~~~i~~~l~kh~~~~~ei~~~~~~v~ 183 (238)
|+.+|+.|+..+..|+.+|+.++.+++|..+++++..||.+++..++++++ +|+..|+.++++|++|+.+|.++.+.|.
T Consensus 87 l~~~w~~L~~~~~~R~~~Le~~~~l~qf~~~~~~~~~Wl~e~e~~~~~~~~g~dl~~v~~ll~kh~~~~~el~~~~~~i~ 166 (216)
T 1u5p_A 87 INGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQ 166 (216)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhcCcccCCCHHHHHHHHHHHHHHHHHHHHhHHHHH
Confidence 999999999999999999999999999999999999999999998877665 7899999999999999999999999999
Q ss_pred hHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy10628 184 AVTAEGESLISGGHFAAAEIKTRLDELELEWRQLQESSALKRERLSDAYQ 233 (238)
Q Consensus 184 ~l~~~g~~L~~~~~~~~~~i~~~~~~l~~~W~~L~~~~~~r~~~L~~a~~ 233 (238)
.|...|+.|+..+|++++.|+.+++.|+.+|..|+..+..|+..|+++++
T Consensus 167 ~l~~~g~~L~~~~~~~~~~i~~~~~~l~~~W~~L~~~~~~R~~~L~~al~ 216 (216)
T 1u5p_A 167 GVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLE 216 (216)
T ss_dssp HHHHHHHHHHHTCSSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHTC----
T ss_pred HHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence 99999999999999999999999999999999999999999999998863
|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 238 | ||||
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 2e-19 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 6e-07 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 1e-16 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 1e-14 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 4e-16 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 1e-14 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 8e-16 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 9e-14 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 8e-16 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 4e-14 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 4e-15 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 5e-13 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 7e-15 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 4e-09 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 2e-13 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 1e-11 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 2e-10 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 7e-08 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 6e-09 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 2e-08 |
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Spectrin repeat-like superfamily: Spectrin repeat family: Spectrin repeat domain: Spectrin alpha chain species: Human (Homo sapiens) [TaxId: 9606]
Score = 80.2 bits (197), Expect = 2e-19
Identities = 50/154 (32%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
Query: 80 LEKFAKDLLAEHHY-----DSSGIQQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLR 134
+E+F K+ + E + IQ+R Q V+ R KE R ++L +S +Q F R
Sbjct: 1 MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKR 60
Query: 135 NMYEVGGWILQKQQICADESYRDPTNLQSKIQKHAAFESELAANKSRVGAVTAEGESLIS 194
+ ++G WI++K I D+SY DPTN+Q K QKH + E+E+ + + E +
Sbjct: 61 DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFT 120
Query: 195 GGHFAAAEIKTRLDELELEWRQLQESSALKRERL 228
GH A E K ++EL W L E + K ++L
Sbjct: 121 MGHSAHEETKAHIEELRHLWDLLLELTLEKGDQL 154
|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 99.87 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.81 | |
| d1cuna2 | 104 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.8 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.79 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.79 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.79 | |
| d1cuna2 | 104 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.78 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.76 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.76 | |
| d1hcia4 | 114 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1s35a1 | 106 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.74 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1s35a1 | 106 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.73 | |
| d2spca_ | 107 | Spectrin alpha chain {Drosophila sp. [TaxId: 7242] | 99.72 | |
| d1quua2 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1quua2 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d2spca_ | 107 | Spectrin alpha chain {Drosophila sp. [TaxId: 7242] | 99.67 | |
| d1hcia4 | 114 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 99.53 | |
| d1hcia1 | 125 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 97.49 | |
| d1hcia1 | 125 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 97.19 |
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Spectrin repeat-like superfamily: Spectrin repeat family: Spectrin repeat domain: Spectrin alpha chain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=9e-23 Score=153.36 Aligned_cols=136 Identities=34% Similarity=0.530 Sum_probs=130.1
Q ss_pred CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhCCCCCChhhHHHHHHHHHHHHH
Q psy10628 94 DSSGIQQRLQAVIARKDRLKETSTARRKRLIESRQMQQFLRNMYEVGGWILQKQQICADESYRDPTNLQSKIQKHAAFES 173 (238)
Q Consensus 94 ~~~~i~~~l~~L~~rw~~L~~~~~~r~~~L~~~~~l~~f~~~~~~~~~WL~~~~~~l~~~~~~d~~~i~~~l~kh~~~~~ 173 (238)
.+..|+.++..|+.+|+.|+..+.+|+.+|+.++.++.|..+++++..||.+++..+.++.++|+..+..++++|+.|+.
T Consensus 20 ~~~~i~~~~~~l~~rw~~L~~~~~~R~~~Le~~~~~~~F~~~~~~l~~Wl~e~e~~~~~~~~~d~~~~~~~~~~h~~l~~ 99 (156)
T d1owaa_ 20 TAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEA 99 (156)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHCCCSCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSCHHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCHHHHHHHHHHHHHHHH
Confidence 57789999999999999999999999999999999999999999999999999988877667899999999999999999
Q ss_pred HHHhhhhhHHhHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy10628 174 ELAANKSRVGAVTAEGESLISGGHFAAAEIKTRLDELELEWRQLQESSALKRERLS 229 (238)
Q Consensus 174 ei~~~~~~v~~l~~~g~~L~~~~~~~~~~i~~~~~~l~~~W~~L~~~~~~r~~~L~ 229 (238)
+|.++++.|..|+..|+.|+..+|++++.|+.+++.|+.+|..|+..+.+|..+|.
T Consensus 100 ei~~~~~~~~~l~~~g~~L~~~~~~~~~~i~~~l~~l~~~W~~L~~~~~~R~~~L~ 155 (156)
T d1owaa_ 100 EVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLL 155 (156)
T ss_dssp HHHHHHHHHHHHHHHHHHSCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHHHHHHHhcCCccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence 99999999999999999999999999999999999999999999999999999884
|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|