Psyllid ID: psy10659
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| 307211652 | 688 | E3 ubiquitin-protein ligase RFWD2 [Harpe | 0.857 | 0.174 | 0.569 | 6e-37 | |
| 242021289 | 642 | RING finger and WD repeat domain protein | 0.985 | 0.214 | 0.527 | 6e-37 | |
| 91077676 | 662 | PREDICTED: similar to E3 ubiquitin-ligas | 0.892 | 0.188 | 0.516 | 7e-36 | |
| 340725942 | 676 | PREDICTED: e3 ubiquitin-protein ligase R | 0.864 | 0.178 | 0.534 | 6e-35 | |
| 345496707 | 675 | PREDICTED: E3 ubiquitin-protein ligase R | 0.864 | 0.179 | 0.520 | 7e-35 | |
| 170033008 | 685 | E3 ubiquitin-ligase protein COP1 [Culex | 0.864 | 0.176 | 0.557 | 2e-34 | |
| 312384230 | 1283 | hypothetical protein AND_02381 [Anophele | 0.864 | 0.094 | 0.454 | 8e-33 | |
| 347970796 | 817 | AGAP013233-PA [Anopheles gambiae str. PE | 0.864 | 0.148 | 0.433 | 3e-30 | |
| 432914419 | 705 | PREDICTED: E3 ubiquitin-protein ligase R | 0.864 | 0.171 | 0.462 | 2e-27 | |
| 260828987 | 584 | hypothetical protein BRAFLDRAFT_93483 [B | 0.985 | 0.236 | 0.401 | 3e-27 |
| >gi|307211652|gb|EFN87676.1| E3 ubiquitin-protein ligase RFWD2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 158 bits (400), Expect = 6e-37, Method: Compositional matrix adjust.
Identities = 82/144 (56%), Positives = 100/144 (69%), Gaps = 24/144 (16%)
Query: 20 NDLLCPICFELIREAHITRCGHTFCFSCISKCVELQIKCPKCSASLPDMNSVFPNFLLNE 79
ND LCPICF+LI EAHITRCGHTFC+SCI K +E + +CPKCS +L + +FPNFLL+E
Sbjct: 43 NDYLCPICFDLIDEAHITRCGHTFCYSCIVKSLETKDRCPKCSFTLSKQD-IFPNFLLHE 101
Query: 80 LVQKHKIKS---------AQDS--------------DGLRDFVASESQNLSLPDVNLMLE 116
L+ K+KI+S A D DGLR+ VA+ES NL+LPDVN+MLE
Sbjct: 102 LILKYKIRSKGLSQIGSYATDGRRKSAGTDSLSSACDGLRNIVAAESANLTLPDVNVMLE 161
Query: 117 VLNQRKHLLEAESSVAQYKLLYEL 140
VL QRKHLLEAE+ AQ KLL+E
Sbjct: 162 VLTQRKHLLEAETCTAQNKLLHEF 185
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242021289|ref|XP_002431077.1| RING finger and WD repeat domain protein, putative [Pediculus humanus corporis] gi|212516326|gb|EEB18339.1| RING finger and WD repeat domain protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91077676|ref|XP_974586.1| PREDICTED: similar to E3 ubiquitin-ligase protein COP1 [Tribolium castaneum] gi|270001535|gb|EEZ97982.1| hypothetical protein TcasGA2_TC000377 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|340725942|ref|XP_003401323.1| PREDICTED: e3 ubiquitin-protein ligase RFWD2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345496707|ref|XP_003427793.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|170033008|ref|XP_001844371.1| E3 ubiquitin-ligase protein COP1 [Culex quinquefasciatus] gi|167873485|gb|EDS36868.1| E3 ubiquitin-ligase protein COP1 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|312384230|gb|EFR29000.1| hypothetical protein AND_02381 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|347970796|ref|XP_003436639.1| AGAP013233-PA [Anopheles gambiae str. PEST] gi|333466835|gb|EGK96393.1| AGAP013233-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|432914419|ref|XP_004079103.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|260828987|ref|XP_002609444.1| hypothetical protein BRAFLDRAFT_93483 [Branchiostoma floridae] gi|229294800|gb|EEN65454.1| hypothetical protein BRAFLDRAFT_93483 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| UNIPROTKB|F1S705 | 425 | RFWD2 "Uncharacterized protein | 0.921 | 0.303 | 0.402 | 4e-25 | |
| UNIPROTKB|F1NQ64 | 717 | RFWD2 "Uncharacterized protein | 0.957 | 0.186 | 0.393 | 1e-24 | |
| ZFIN|ZDB-GENE-070410-134 | 694 | rfwd2 "ring finger and WD repe | 0.857 | 0.172 | 0.419 | 1.6e-24 | |
| UNIPROTKB|E2RRJ5 | 733 | RFWD2 "Uncharacterized protein | 0.857 | 0.163 | 0.422 | 2.3e-24 | |
| UNIPROTKB|Q8NHY2 | 731 | RFWD2 "E3 ubiquitin-protein li | 0.921 | 0.176 | 0.402 | 2.9e-24 | |
| MGI|MGI:1347046 | 733 | Rfwd2 "ring finger and WD repe | 0.921 | 0.175 | 0.402 | 2.9e-24 | |
| UNIPROTKB|F1MHX1 | 735 | RFWD2 "Uncharacterized protein | 0.921 | 0.175 | 0.402 | 3.8e-24 | |
| UNIPROTKB|E9PJB5 | 189 | RFWD2 "E3 ubiquitin-protein li | 0.785 | 0.582 | 0.4 | 7.2e-20 | |
| UNIPROTKB|H0Y339 | 566 | RFWD2 "E3 ubiquitin-protein li | 0.757 | 0.187 | 0.396 | 8.3e-18 | |
| TAIR|locus:2059359 | 675 | COP1 "CONSTITUTIVE PHOTOMORPHO | 0.85 | 0.176 | 0.36 | 2.5e-17 |
| UNIPROTKB|F1S705 RFWD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 286 (105.7 bits), Expect = 4.0e-25, P = 4.0e-25
Identities = 58/144 (40%), Positives = 90/144 (62%)
Query: 11 LKRQHSPPDNDLLCPICFELIREAHITRCGHTFCFSCISKCVELQIKCPKCSASLPDMNS 70
L + ND +CPICF++I EA++T+CGH+FC+ CI + +E +CPKC+ + +++
Sbjct: 122 LINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDH 181
Query: 71 VFPNFLLNELVQKHKIK----------SAQDSDGLR-----DFVASESQNLSLPDVNLML 115
++PNFL+NEL+ K K + S ++G R D + ++ NL L +VNLML
Sbjct: 182 LYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDLLGTDQDNLDLANVNLML 241
Query: 116 EVLNQRKHLLEAESSVAQYKLLYE 139
E+L Q+K LEAES AQ ++L E
Sbjct: 242 ELLVQKKKQLEAESHAAQLQILME 265
|
|
| UNIPROTKB|F1NQ64 RFWD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070410-134 rfwd2 "ring finger and WD repeat domain 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRJ5 RFWD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NHY2 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347046 Rfwd2 "ring finger and WD repeat domain 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MHX1 RFWD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PJB5 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y339 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059359 COP1 "CONSTITUTIVE PHOTOMORPHOGENIC 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 8e-10 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-09 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 9e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 9e-08 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 1e-07 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 3e-07 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 5e-07 | |
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 2e-05 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 2e-04 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 2e-04 | |
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 2e-04 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 3e-04 | |
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 3e-04 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 8e-04 |
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
Score = 55.0 bits (132), Expect = 8e-10
Identities = 32/83 (38%), Positives = 42/83 (50%), Gaps = 7/83 (8%)
Query: 4 TSTPSRSLKRQHSPPDNDLLCPICFELIREAHITRCGHTFCFSCISKCVELQIKCPKCSA 63
+TP SL P D L C IC + +T C HTFC CI +C+ Q KCP C A
Sbjct: 13 LTTPIPSLY----PLDTSLRCHICKDFFDVPVLTSCSHTFCSLCIRRCLSNQPKCPLCRA 68
Query: 64 SLPDMNSVF-PNFLLNELVQKHK 85
D S N+L++E+V+ K
Sbjct: 69 --EDQESKLRSNWLVSEIVESFK 89
|
All proteins in this family for which functions are known are involved in nucleotide excision repair.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 397 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.66 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.62 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.61 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.6 | |
| KOG0287|consensus | 442 | 99.56 | ||
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.55 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.5 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 99.47 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.45 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.44 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.44 | |
| KOG0320|consensus | 187 | 99.43 | ||
| KOG0823|consensus | 230 | 99.43 | ||
| KOG0317|consensus | 293 | 99.42 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.39 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.35 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 99.26 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.25 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.24 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.19 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 99.17 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 99.16 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.15 | |
| KOG2177|consensus | 386 | 99.14 | ||
| KOG0978|consensus | 698 | 99.14 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 99.11 | |
| KOG2164|consensus | 513 | 99.11 | ||
| KOG4628|consensus | 348 | 98.98 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.97 | |
| KOG0311|consensus | 381 | 98.9 | ||
| KOG1002|consensus | 791 | 98.87 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.86 | |
| KOG2660|consensus | 331 | 98.8 | ||
| KOG0802|consensus | 543 | 98.78 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.71 | |
| KOG0297|consensus | 391 | 98.7 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 98.65 | |
| KOG4159|consensus | 398 | 98.65 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.57 | |
| KOG0824|consensus | 324 | 98.56 | ||
| KOG1813|consensus | 313 | 98.53 | ||
| KOG2879|consensus | 298 | 98.46 | ||
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.44 | |
| KOG1734|consensus | 328 | 98.25 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.22 | |
| KOG4172|consensus | 62 | 98.12 | ||
| KOG0804|consensus | 493 | 98.05 | ||
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.05 | |
| KOG1645|consensus | 463 | 98.04 | ||
| KOG0828|consensus | 636 | 97.98 | ||
| KOG1039|consensus | 344 | 97.93 | ||
| KOG3039|consensus | 303 | 97.93 | ||
| KOG4265|consensus | 349 | 97.93 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.9 | |
| KOG4692|consensus | 489 | 97.89 | ||
| KOG1785|consensus | 563 | 97.87 | ||
| KOG0827|consensus | 465 | 97.82 | ||
| KOG4367|consensus | 699 | 97.77 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.74 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 97.72 | |
| KOG0825|consensus | 1134 | 97.71 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 97.71 | |
| KOG2930|consensus | 114 | 97.65 | ||
| KOG0826|consensus | 357 | 97.57 | ||
| KOG4739|consensus | 233 | 97.55 | ||
| KOG4185|consensus | 296 | 97.49 | ||
| KOG1493|consensus | 84 | 97.41 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 97.36 | |
| KOG1814|consensus | 445 | 97.26 | ||
| KOG1001|consensus | 674 | 97.2 | ||
| KOG0298|consensus | 1394 | 97.2 | ||
| KOG3800|consensus | 300 | 97.18 | ||
| KOG4275|consensus | 350 | 97.12 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 97.02 | |
| KOG1571|consensus | 355 | 96.98 | ||
| KOG3002|consensus | 299 | 96.91 | ||
| KOG1941|consensus | 518 | 96.9 | ||
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.76 | |
| KOG2114|consensus | 933 | 96.72 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 96.55 | |
| KOG2817|consensus | 394 | 96.54 | ||
| KOG3970|consensus | 299 | 96.52 | ||
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 96.47 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 96.37 | |
| KOG4362|consensus | 684 | 96.34 | ||
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 96.31 | |
| KOG1940|consensus | 276 | 96.2 | ||
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 96.2 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.78 | |
| KOG3579|consensus | 352 | 95.57 | ||
| KOG1428|consensus | 3738 | 95.55 | ||
| KOG3268|consensus | 234 | 95.51 | ||
| KOG3161|consensus | 861 | 95.43 | ||
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 95.43 | |
| KOG3039|consensus | 303 | 95.4 | ||
| KOG2932|consensus | 389 | 95.32 | ||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 95.21 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.58 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 94.38 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 94.26 | |
| KOG3113|consensus | 293 | 94.18 | ||
| KOG1952|consensus | 950 | 94.14 | ||
| PHA02862 | 156 | 5L protein; Provisional | 94.1 | |
| KOG1812|consensus | 384 | 94.08 | ||
| KOG4445|consensus | 368 | 94.06 | ||
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 93.5 | |
| KOG1100|consensus | 207 | 93.05 | ||
| KOG1815|consensus | 444 | 92.68 | ||
| KOG2034|consensus | 911 | 92.17 | ||
| COG3813 | 84 | Uncharacterized protein conserved in bacteria [Fun | 92.13 | |
| KOG4718|consensus | 235 | 91.61 | ||
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 91.55 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 91.4 | |
| TIGR01562 | 305 | FdhE formate dehydrogenase accessory protein FdhE. | 90.8 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 90.55 | |
| PF10235 | 90 | Cript: Microtubule-associated protein CRIPT; Inter | 90.49 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 90.48 | |
| KOG0825|consensus | 1134 | 90.08 | ||
| KOG2979|consensus | 262 | 89.4 | ||
| KOG1812|consensus | 384 | 89.02 | ||
| KOG3899|consensus | 381 | 88.67 | ||
| PRK03564 | 309 | formate dehydrogenase accessory protein FdhE; Prov | 88.56 | |
| KOG2042|consensus | 943 | 88.37 | ||
| KOG4642|consensus | 284 | 87.08 | ||
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 87.01 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 86.57 | |
| PF14353 | 128 | CpXC: CpXC protein | 86.52 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 86.47 | |
| KOG0309|consensus | 1081 | 86.33 | ||
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 86.33 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 86.21 | |
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 86.06 | |
| KOG0827|consensus | 465 | 85.81 | ||
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 82.9 | |
| KOG3053|consensus | 293 | 82.73 | ||
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 82.34 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 82.3 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 81.59 | |
| COG5627 | 275 | MMS21 DNA repair protein MMS21 [DNA replication, r | 81.53 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 81.14 | |
| PF06844 | 68 | DUF1244: Protein of unknown function (DUF1244); In | 80.25 |
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
Probab=99.66 E-value=1.3e-16 Score=92.48 Aligned_cols=62 Identities=26% Similarity=0.486 Sum_probs=56.7
Q ss_pred CcccccccchhhhceecCCCCcccHhhHHHHhhcCCCCCCCCCCCCCCCCCccchHHHHHHHH
Q psy10659 21 DLLCPICFELIREAHITRCGHTFCFSCISKCVELQIKCPKCSASLPDMNSVFPNFLLNELVQK 83 (140)
Q Consensus 21 ~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~C~~~~~~~~~~~~~~~~~~~~~~ 83 (140)
++.||||.+.+.+|+.++|||+||..||..|+.....||.|+.+++..+ +.+|..+.+.++.
T Consensus 1 ~~~Cpi~~~~~~~Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~~-l~~~~~l~~~i~~ 62 (63)
T smart00504 1 EFLCPISLEVMKDPVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTHED-LIPNLALKSAIQE 62 (63)
T ss_pred CcCCcCCCCcCCCCEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCChhh-ceeCHHHHHHHHh
Confidence 4789999999999999999999999999999998889999999997777 8899888887764
|
Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. |
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG3113|consensus | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >KOG1815|consensus | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >COG3813 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4718|consensus | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >TIGR01562 FdhE formate dehydrogenase accessory protein FdhE | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG2979|consensus | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG3899|consensus | Back alignment and domain information |
|---|
| >PRK03564 formate dehydrogenase accessory protein FdhE; Provisional | Back alignment and domain information |
|---|
| >KOG2042|consensus | Back alignment and domain information |
|---|
| >KOG4642|consensus | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG3053|consensus | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 140 | ||||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 7e-05 | ||
| 4epo_C | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 1e-04 | ||
| 4ayc_A | 138 | Rnf8 Ring Domain Structure Length = 138 | 1e-04 | ||
| 2y43_A | 99 | Rad18 Ubiquitin Ligase Ring Domain Structure Length | 1e-04 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 3e-04 | ||
| 3hct_A | 118 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 5e-04 | ||
| 2ckl_B | 165 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 6e-04 |
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
|
| >pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
| >pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|2Y43|A Chain A, Rad18 Ubiquitin Ligase Ring Domain Structure Length = 99 | Back alignment and structure |
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
| >pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 | Back alignment and structure |
| >pdb|2CKL|B Chain B, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 165 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 5e-16 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 8e-15 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-14 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 5e-14 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-13 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 2e-13 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 2e-13 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 2e-13 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 3e-13 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-13 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 7e-13 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 8e-13 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 1e-12 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 5e-12 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 1e-11 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-11 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 3e-11 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-11 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 3e-11 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 9e-11 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 1e-10 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-10 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-10 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 3e-10 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 7e-10 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-09 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 3e-09 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 5e-09 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 5e-09 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 5e-09 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 9e-09 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 9e-09 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 2e-08 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 3e-08 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 4e-08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 4e-08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 6e-05 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 2e-07 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 4e-07 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 7e-07 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 1e-06 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 1e-06 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 2e-06 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 2e-06 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 4e-06 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 4e-06 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 5e-06 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 2e-05 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 3e-05 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 5e-05 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 7e-05 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 1e-04 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 4e-04 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 5e-04 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 6e-04 |
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Score = 67.9 bits (166), Expect = 5e-16
Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
Query: 19 DNDLLCPICFELIREAH-ITRCGHTFCFSCISKCVELQIKCPKCSASLPDMNSVFPNFLL 77
D+ L C ICFE A I +C H +C CI K + + +CP C ++ + + + N +L
Sbjct: 20 DDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPD-LKNNRIL 78
Query: 78 NELVQKHK 85
+ELV+
Sbjct: 79 DELVKSLN 86
|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.82 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.82 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.8 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.8 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.8 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.77 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.76 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.75 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.75 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.74 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.74 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.73 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.73 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.73 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.72 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.72 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.72 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.71 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.71 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.71 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.71 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.71 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.71 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.71 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.7 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.69 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.68 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.67 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.67 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.67 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.66 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.64 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.64 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.62 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.62 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.62 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.6 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.6 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.6 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.59 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.59 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.57 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.57 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.57 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.57 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.57 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.56 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.54 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.53 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.53 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.51 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.5 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.46 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.43 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.42 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.41 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.37 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.36 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.34 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.33 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.32 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.24 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.22 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.22 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.22 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.19 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 99.13 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.05 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.64 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.58 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.49 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 98.31 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.67 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 97.59 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 96.04 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 96.0 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 95.78 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 95.38 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 92.36 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 91.43 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 89.53 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 89.0 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 88.87 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 88.81 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 87.61 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 87.37 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 87.27 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 87.24 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 87.11 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 87.09 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 86.9 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 86.73 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 86.51 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 86.02 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 85.9 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 85.47 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 84.91 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 84.14 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 83.99 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 83.0 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 82.97 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 82.87 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 82.7 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 82.57 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 81.56 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 80.61 | |
| 2d8v_A | 67 | Zinc finger FYVE domain-containing protein 19; zfy | 80.08 |
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
Probab=99.82 E-value=1.1e-20 Score=113.24 Aligned_cols=73 Identities=26% Similarity=0.479 Sum_probs=65.6
Q ss_pred CCCCCCcccccccchhhhceecCCCCcccHhhHHHHhhc-CCCCCCCCCCCCCCCCCccchHHHHHHHHHHhcCC
Q psy10659 16 SPPDNDLLCPICFELIREAHITRCGHTFCFSCISKCVEL-QIKCPKCSASLPDMNSVFPNFLLNELVQKHKIKSA 89 (140)
Q Consensus 16 ~~~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~-~~~CP~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 89 (140)
.++.+++.|+||++.+.+|+.++|||+||..||..|+.. ...||.|+..+...+ +.+|..+.++++.+....+
T Consensus 3 ~~~~~~~~C~IC~~~~~~Pv~~~CgH~fc~~Ci~~~~~~~~~~CP~C~~~~~~~~-l~~n~~l~~~i~~~~~~~~ 76 (78)
T 1t1h_A 3 PEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAG-LTPNYVLKSLIALWCESNG 76 (78)
T ss_dssp CCCSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHTTTCCBCTTTCCBCSSCC-CEECTTTHHHHHHHHHHSC
T ss_pred cCCcccCCCCCccccccCCEEcCCCCeecHHHHHHHHHHCcCCCCCCcCCCChhh-CccCHHHHHHHHHHHHHcC
Confidence 356789999999999999999999999999999999986 788999999998776 8899999999999877543
|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 140 | ||||
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 5e-13 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 5e-12 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-10 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 8e-10 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 9e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 5e-09 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-08 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 6e-08 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-07 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 7e-07 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 1e-05 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 3e-04 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 6e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 8e-04 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.004 |
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: brca1 RING domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 58.9 bits (142), Expect = 5e-13
Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 5/97 (5%)
Query: 1 MSATSTPSRSLKRQHSPPDNDLLCPICFELIREAHITRCGHTFCFSCISKCVELQ---IK 57
M ++ ++ + L CPIC ELI+E T+C H FC C+ K + + +
Sbjct: 1 MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ 60
Query: 58 CPKCSASLPDMNSVFPNFLLNELVQK-HKIKSAQDSD 93
CP C + S+ + ++LV++ KI A D
Sbjct: 61 CPLCKNDIT-KRSLQESTRFSQLVEELLKIICAFQLD 96
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.83 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.82 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.79 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.79 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.74 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.73 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.66 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.61 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.61 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.6 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.6 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.51 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.44 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.35 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.21 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.78 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 96.36 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 94.36 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 93.62 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 91.95 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 91.15 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 88.48 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 87.33 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 86.9 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 86.78 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 86.74 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 86.7 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 86.46 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 84.3 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 80.97 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 80.46 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 80.41 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 80.39 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.83 E-value=4.3e-21 Score=114.27 Aligned_cols=72 Identities=24% Similarity=0.324 Sum_probs=65.1
Q ss_pred CCCCCcccccccchhhhceecCCCCcccHhhHHHHhh-cCCCCCCCCCCCCCCCCCccchHHHHHHHHHHhcCC
Q psy10659 17 PPDNDLLCPICFELIREAHITRCGHTFCFSCISKCVE-LQIKCPKCSASLPDMNSVFPNFLLNELVQKHKIKSA 89 (140)
Q Consensus 17 ~~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~-~~~~CP~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 89 (140)
++.+++.||||+++|.+||+++|||+||..||..|+. ....||.|+.++...+ +.+|..+.++++.|....+
T Consensus 3 eiP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~-l~pN~~L~~~I~~~l~~~~ 75 (80)
T d2c2la2 3 DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQ-LIPNLAMKEVIDAFISENG 75 (80)
T ss_dssp CCCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGG-CEECHHHHHHHHHHHTTCS
T ss_pred CCCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCccCCCccccccccc-cccHHHHHHHHHHHHHHCC
Confidence 5678999999999999999999999999999999997 4568999999988776 8999999999999987655
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|