Psyllid ID: psy10677


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MWSATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTVPSYPDPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCVNVKD
cccccccHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEcccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccEEEEcccccHHHcccccccccccHHHHHHHHcccccccccccc
ccccccHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEEccccHcccccccccccccccccEcccccccccccccccccccEccccEEEccccccccHHHHHHccHHHHHHHHHHccEEEEccccccccccHHHccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEEHHHccccccHHHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHcccEEEEEccHHHHHHHHcccccEEcHHHEEEEEEEccccEEEccc
MWSATWPREIQKLAKEFlsdpiqlnvgsanlaanpnIKQFVEICHEyekpakwwdsnnghypksvRFVLGTAGFLLSAVSfslpfrddktsvvtvpsypdpsvnhlqgktKEEIDSFRKEHNItligqnipkpvktldetnipsyilgpmkpkttnnennhnknkkcgdkesknwtiplNFQAKKFISVLQKKAEVQSRSVFTYILPALYHIlkmpkleegdgpialvLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSatntslgiylqqndahspcLSVWRRLQDILglteetcvnvkd
MWSATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTsvvtvpsypdpsvnhlqgkTKEEIDSFRKEHNItligqnipkpvktlDETNIPSYILGpmkpkttnnennhnknkkcgdkeskNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDIlglteetcvnvkd
MWSATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTVPSYPDPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMkpkttnnennhnknkkCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCVNVKD
*********IQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTV*************************HNITLIGQNIPKPVKTLDETNIPSYI***************************NWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCV****
MWSATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTVPSYPDPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCVNV**
MWSATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTVPSYPDPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCVNVKD
**SATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTVPSYPDPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCVNVKD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWSATWPREIQKLAKEFLSDPIQLNVGSANLAANPNIKQFVEICHEYEKPAKWWDSNNGHYPKSVRFVLGTAGFLLSAVSFSLPFRDDKTSVVTVPSYPDPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRILTSATNTSLGIYLQQNDAHSPCLSVWRRLQDILGLTEETCVNVKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
A6RGE3 542 ATP-dependent RNA helicas N/A N/A 0.454 0.265 0.396 1e-27
A1C6C4 549 ATP-dependent RNA helicas N/A N/A 0.454 0.262 0.396 1e-27
A2QC74 565 ATP-dependent RNA helicas yes N/A 0.454 0.254 0.389 2e-27
Q1DP69 545 ATP-dependent RNA helicas N/A N/A 0.454 0.264 0.389 2e-27
Q4X195 547 ATP-dependent RNA helicas yes N/A 0.463 0.268 0.382 5e-27
A4QSS5 548 ATP-dependent RNA helicas N/A N/A 0.454 0.262 0.389 9e-27
A1DGZ7 545 ATP-dependent RNA helicas N/A N/A 0.454 0.264 0.383 2e-26
Q5B0J9 563 ATP-dependent RNA helicas yes N/A 0.454 0.255 0.389 3e-26
Q7SBC6 562 ATP-dependent RNA helicas N/A N/A 0.457 0.258 0.391 3e-26
A7E449 572 ATP-dependent RNA helicas N/A N/A 0.473 0.262 0.392 4e-26
>sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 Back     alignment and function desciption
 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 91/159 (57%), Gaps = 15/159 (9%)

Query: 109 KTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCG 168
           ++  E+D+FRKEH IT+ G+N+P+PV+T DE   P Y++  +K +            +  
Sbjct: 99  RSTHEVDAFRKEHEITVQGKNVPRPVETFDEAGFPQYVMSEVKAQGF---------ARPT 149

Query: 169 DKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALV 228
             +++ W  P+    +  + +    AE  S    TY LPA+ HI   P L  GDGPI LV
Sbjct: 150 AIQAQGW--PMALSGRDVVGI----AETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLV 203

Query: 229 LAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQV 267
           LAPTRELA QIQ  I+ F ++ RIR+ C+YGG  K  Q+
Sbjct: 204 LAPTRELAVQIQTEITKFGKSSRIRNTCVYGGVPKGPQI 242




ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.
Ajellomyces capsulata (strain NAm1 / WU24) (taxid: 339724)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 Back     alignment and function description
>sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 Back     alignment and function description
>sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-2 PE=3 SV=2 Back     alignment and function description
>sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
169610529 668 hypothetical protein SNOG_08367 [Phaeosp 0.473 0.224 0.422 9e-28
449296632 485 hypothetical protein BAUCODRAFT_95810 [B 0.473 0.309 0.398 2e-27
242787406 543 RNA helicase (Dbp), putative [Talaromyce 0.454 0.265 0.402 1e-26
225555683 544 ATP-dependent RNA helicase DBP2 [Ajellom 0.454 0.264 0.402 1e-26
325091997 544 ATP-dependent RNA helicase DBP2 [Ajellom 0.454 0.264 0.402 1e-26
398406623 529 hypothetical protein MYCGRDRAFT_36977 [Z 0.473 0.283 0.392 2e-26
407927140 462 RNA helicase ATP-dependent DEAD-box cons 0.463 0.318 0.401 2e-26
396490503 1226 hypothetical protein LEMA_P074610.1 [Lep 0.473 0.122 0.410 2e-26
427779853 686 Putative atp-dependent rna helicase [Rhi 0.470 0.217 0.383 2e-26
427781447 681 Putative atp-dependent rna helicase [Rhi 0.470 0.218 0.383 2e-26
>gi|169610529|ref|XP_001798683.1| hypothetical protein SNOG_08367 [Phaeosphaeria nodorum SN15] gi|160702090|gb|EAT84643.2| hypothetical protein SNOG_08367 [Phaeosphaeria nodorum SN15] Back     alignment and taxonomy information
 Score =  130 bits (326), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 96/168 (57%), Gaps = 18/168 (10%)

Query: 100 DPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNEN 159
           DP+V     +T EE+D++RKEH +T+ G NIPKPV T DE   PSY++  +K +  +   
Sbjct: 330 DPAVT---ARTPEEVDAYRKEHQMTVQGTNIPKPVTTFDEAGFPSYVMSEVKAQGFD--- 383

Query: 160 NHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLE 219
                 K    +++ W  P+    +  + V    AE  S    TY LPA+ HI   P L 
Sbjct: 384 ------KPTAIQAQGW--PMALSGRDVVGV----AETGSGKTLTYCLPAIVHINAQPLLA 431

Query: 220 EGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQV 267
            GDGPI L+LAPTRELA QIQ  IS F ++ RIR+ C+YGG  K  Q+
Sbjct: 432 PGDGPIVLILAPTRELAVQIQQEISKFGKSSRIRNTCVYGGVPKGPQI 479




Source: Phaeosphaeria nodorum SN15

Species: Parastagonospora nodorum

Genus: Parastagonospora

Family: Phaeosphaeriaceae

Order: Pleosporales

Class: Dothideomycetes

Phylum: Ascomycota

Superkingdom: Eukaryota

>gi|449296632|gb|EMC92651.1| hypothetical protein BAUCODRAFT_95810 [Baudoinia compniacensis UAMH 10762] Back     alignment and taxonomy information
>gi|242787406|ref|XP_002481000.1| RNA helicase (Dbp), putative [Talaromyces stipitatus ATCC 10500] gi|218721147|gb|EED20566.1| RNA helicase (Dbp), putative [Talaromyces stipitatus ATCC 10500] Back     alignment and taxonomy information
>gi|225555683|gb|EEH03974.1| ATP-dependent RNA helicase DBP2 [Ajellomyces capsulatus G186AR] Back     alignment and taxonomy information
>gi|325091997|gb|EGC45307.1| ATP-dependent RNA helicase DBP2 [Ajellomyces capsulatus H88] Back     alignment and taxonomy information
>gi|398406623|ref|XP_003854777.1| hypothetical protein MYCGRDRAFT_36977 [Zymoseptoria tritici IPO323] gi|339474661|gb|EGP89753.1| hypothetical protein MYCGRDRAFT_36977 [Zymoseptoria tritici IPO323] Back     alignment and taxonomy information
>gi|407927140|gb|EKG20043.1| RNA helicase ATP-dependent DEAD-box conserved site [Macrophomina phaseolina MS6] Back     alignment and taxonomy information
>gi|396490503|ref|XP_003843351.1| hypothetical protein LEMA_P074610.1 [Leptosphaeria maculans JN3] gi|312219930|emb|CBX99872.1| hypothetical protein LEMA_P074610.1 [Leptosphaeria maculans JN3] Back     alignment and taxonomy information
>gi|427779853|gb|JAA55378.1| Putative atp-dependent rna helicase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427781447|gb|JAA56175.1| Putative atp-dependent rna helicase [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
UNIPROTKB|A4QSS5 548 DBP2 "ATP-dependent RNA helica 0.454 0.262 0.383 3.7e-24
ASPGD|ASPL0000006660 563 AN5931 [Emericella nidulans (t 0.454 0.255 0.377 3.9e-23
SGD|S000005056 546 DBP2 "ATP-dependent RNA helica 0.473 0.274 0.365 3.3e-21
UNIPROTKB|J3QRQ7212 DDX5 "Probable ATP-dependent R 0.463 0.693 0.345 4.9e-21
MGI|MGI:105037 614 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.463 0.239 0.351 1.5e-20
RGD|619906 615 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.463 0.239 0.351 1.5e-20
TAIR|locus:2035741 501 RH20 "RNA helicase 20" [Arabid 0.451 0.285 0.367 3.2e-20
CGD|CAL0003204 562 DBP2 [Candida albicans (taxid: 0.454 0.256 0.364 3.4e-20
GENEDB_PFALCIPARUM|PF14_0437 527 PF14_0437 "helicase, truncated 0.457 0.275 0.366 3.7e-20
UNIPROTKB|Q8IL13 527 PF14_0437 "Helicase, putative" 0.457 0.275 0.366 3.7e-20
UNIPROTKB|A4QSS5 DBP2 "ATP-dependent RNA helicase DBP2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
 Score = 283 (104.7 bits), Expect = 3.7e-24, P = 3.7e-24
 Identities = 61/159 (38%), Positives = 88/159 (55%)

Query:   109 KTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMXXXXXXXXXXXXXXXXCG 168
             +++ E+D FR+EH++ + G ++PKPV+T DE   P Y++  +                  
Sbjct:    99 RSQAEVDKFRREHSMAVQGSDVPKPVETFDEAGFPRYVMDEVKAQGFPAPTAI------- 151

Query:   169 DKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALV 228
               +S+ W  P+    +  + +    AE  S    TY LPA+ HI   P L  GDGPI L+
Sbjct:   152 --QSQGW--PMALSGRDVVGI----AETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLI 203

Query:   229 LAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQV 267
             LAPTRELA QIQA IS F ++ RIR+ C+YGG  K  Q+
Sbjct:   204 LAPTRELAVQIQAEISKFGKSSRIRNTCVYGGVPKGPQI 242


GO:0043581 "mycelium development" evidence=IEP
ASPGD|ASPL0000006660 AN5931 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000005056 DBP2 "ATP-dependent RNA helicase of the DEAD-box protein family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|J3QRQ7 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105037 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619906 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box helicase 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2035741 RH20 "RNA helicase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003204 DBP2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0437 PF14_0437 "helicase, truncated, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IL13 PF14_0437 "Helicase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 4e-31
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-16
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 9e-14
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-11
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-10
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-08
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 4e-07
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-06
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-06
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 8e-06
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-05
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-05
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-04
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 2e-04
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 5e-04
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 6e-04
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-04
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
 Score =  122 bits (307), Expect = 4e-31
 Identities = 61/163 (37%), Positives = 87/163 (53%), Gaps = 16/163 (9%)

Query: 110 TKEEIDSFRKEHNITLI-GQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCG 168
           + +E+D  RKE  IT+I G+N+PKPV + + T+ P YIL  +K         +    +  
Sbjct: 104 SSKEVDEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLK---------NAGFTEPT 154

Query: 169 DKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALV 228
             + + W I L+   +  I      AE  S     ++LPA+ HI   P L  GDGPI LV
Sbjct: 155 PIQVQGWPIALS--GRDMIG----IAETGSGKTLAFLLPAIVHINAQPLLRYGDGPIVLV 208

Query: 229 LAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLR 271
           LAPTRELA+QI+   + F  + +IR+   YGG  K  Q+  LR
Sbjct: 209 LAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQIYALR 251


Length = 545

>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
KOG0339|consensus 731 100.0
KOG0331|consensus 519 100.0
KOG0341|consensus 610 100.0
PTZ00110 545 helicase; Provisional 100.0
KOG0334|consensus 997 100.0
KOG0330|consensus 476 100.0
KOG0333|consensus 673 100.0
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0336|consensus 629 100.0
KOG0348|consensus 708 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0338|consensus 691 100.0
KOG0335|consensus 482 100.0
KOG0343|consensus 758 100.0
KOG0345|consensus 567 100.0
KOG0342|consensus 543 100.0
KOG0340|consensus 442 100.0
KOG0346|consensus 569 100.0
KOG0347|consensus 731 100.0
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.97
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.97
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.97
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.97
KOG0328|consensus 400 99.97
KOG0326|consensus 459 99.97
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.97
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.96
KOG0337|consensus 529 99.95
KOG0327|consensus 397 99.95
KOG0350|consensus 620 99.95
PTZ00424 401 helicase 45; Provisional 99.94
KOG0344|consensus 593 99.94
KOG4284|consensus 980 99.93
KOG0332|consensus 477 99.92
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.92
KOG0329|consensus 387 99.92
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.92
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.89
PRK02362 737 ski2-like helicase; Provisional 99.89
PRK00254 720 ski2-like helicase; Provisional 99.87
PRK13767 876 ATP-dependent helicase; Provisional 99.87
PRK09401 1176 reverse gyrase; Reviewed 99.85
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.85
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.84
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.84
PRK01172 674 ski2-like helicase; Provisional 99.84
PRK14701 1638 reverse gyrase; Provisional 99.83
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.81
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.8
KOG0328|consensus400 99.8
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.8
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.8
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.79
KOG0331|consensus519 99.78
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.76
KOG0349|consensus 725 99.76
KOG0336|consensus629 99.75
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.75
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.75
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.74
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.73
PRK10689 1147 transcription-repair coupling factor; Provisional 99.73
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.73
COG1205 851 Distinct helicase family with a unique C-terminal 99.72
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.71
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.7
KOG0330|consensus476 99.7
KOG0335|consensus482 99.7
KOG0333|consensus673 99.69
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.68
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.67
KOG0341|consensus610 99.65
KOG0326|consensus459 99.64
KOG0332|consensus477 99.62
KOG0344|consensus593 99.6
KOG0327|consensus397 99.6
COG1204 766 Superfamily II helicase [General function predicti 99.59
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.58
PHA02558 501 uvsW UvsW helicase; Provisional 99.57
PHA02653 675 RNA helicase NPH-II; Provisional 99.54
KOG0342|consensus543 99.54
KOG0952|consensus 1230 99.53
PRK05580 679 primosome assembly protein PriA; Validated 99.51
KOG0338|consensus691 99.5
smart00487201 DEXDc DEAD-like helicases superfamily. 99.5
KOG0345|consensus567 99.49
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.48
KOG0339|consensus731 99.47
KOG0334|consensus 997 99.47
KOG0346|consensus569 99.44
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.44
PTZ00110545 helicase; Provisional 99.43
PRK13766 773 Hef nuclease; Provisional 99.42
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.42
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.42
KOG0343|consensus 758 99.41
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.39
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.39
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.34
KOG0340|consensus442 99.33
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.31
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.31
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.27
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.26
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.25
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.25
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.21
COG1202 830 Superfamily II helicase, archaea-specific [General 99.19
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.16
KOG0951|consensus 1674 99.13
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.13
KOG0329|consensus387 99.12
KOG4284|consensus 980 99.12
KOG0348|consensus708 99.09
KOG0354|consensus 746 99.06
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.06
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.06
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.02
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.01
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.98
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.96
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.95
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.9
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.89
KOG0337|consensus529 98.85
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.79
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.77
PTZ00424401 helicase 45; Provisional 98.74
KOG0350|consensus620 98.74
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.72
KOG0352|consensus 641 98.69
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.69
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.67
KOG0951|consensus 1674 98.65
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 98.61
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 98.61
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.59
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.58
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.58
KOG0353|consensus 695 98.57
KOG0351|consensus 941 98.56
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.55
PRK09694 878 helicase Cas3; Provisional 98.5
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.49
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.47
PRK09401 1176 reverse gyrase; Reviewed 98.46
PHA02653675 RNA helicase NPH-II; Provisional 98.46
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.34
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.33
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.32
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 98.3
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.26
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 98.11
PRK106891147 transcription-repair coupling factor; Provisional 98.1
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.09
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.0
PRK14701 1638 reverse gyrase; Provisional 97.98
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.92
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 97.92
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 97.91
KOG0347|consensus731 97.88
KOG0349|consensus725 97.87
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 97.84
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 97.84
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 97.83
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 97.81
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.78
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 97.76
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 97.69
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.68
KOG0947|consensus 1248 97.65
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.63
KOG0952|consensus 1230 97.58
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.57
PF1324576 AAA_19: Part of AAA domain 97.54
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.52
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.49
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.39
KOG0948|consensus 1041 97.31
KOG0949|consensus 1330 97.09
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.09
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 97.08
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.06
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.03
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 96.96
PRK04914 956 ATP-dependent helicase HepA; Validated 96.94
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 96.93
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.9
PRK14873 665 primosome assembly protein PriA; Provisional 96.89
COG4096 875 HsdR Type I site-specific restriction-modification 96.84
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 96.72
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 96.7
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.67
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.58
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.54
COG4889 1518 Predicted helicase [General function prediction on 96.52
PRK04914 956 ATP-dependent helicase HepA; Validated 96.45
KOG0390|consensus 776 96.26
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 96.13
TIGR00643630 recG ATP-dependent DNA helicase RecG. 96.08
KOG1803|consensus 649 95.99
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 95.89
KOG0950|consensus 1008 95.81
PRK09200790 preprotein translocase subunit SecA; Reviewed 95.8
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 95.77
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.77
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.74
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 95.69
KOG1802|consensus 935 95.65
KOG2340|consensus 698 95.42
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 95.25
PRK13767 876 ATP-dependent helicase; Provisional 95.23
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 95.1
PRK11054 684 helD DNA helicase IV; Provisional 95.05
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.02
COG0610 962 Type I site-specific restriction-modification syst 94.94
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 94.85
PRK05298 652 excinuclease ABC subunit B; Provisional 94.49
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 94.46
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 94.26
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.25
KOG0385|consensus 971 94.11
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 94.07
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 94.06
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.02
PRK05298652 excinuclease ABC subunit B; Provisional 93.99
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.77
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.76
PRK15483 986 type III restriction-modification system StyLTI en 93.6
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 93.42
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 93.32
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 93.03
PRK10875 615 recD exonuclease V subunit alpha; Provisional 93.01
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 92.95
KOG1123|consensus 776 92.88
PRK13833323 conjugal transfer protein TrbB; Provisional 92.85
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.8
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.74
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 92.62
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 92.41
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.41
PRK10536262 hypothetical protein; Provisional 92.37
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 92.26
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.23
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 92.21
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 92.19
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 92.19
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 92.09
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.92
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 91.81
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 91.66
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.58
PHA02558501 uvsW UvsW helicase; Provisional 91.33
COG3973 747 Superfamily I DNA and RNA helicases [General funct 91.16
KOG4150|consensus 1034 91.05
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 91.0
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 90.99
PRK13889 988 conjugal transfer relaxase TraA; Provisional 90.95
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 90.93
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 90.85
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 90.83
COG1484254 DnaC DNA replication protein [DNA replication, rec 90.7
PF12846 304 AAA_10: AAA-like domain 90.63
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 90.58
PRK13897 606 type IV secretion system component VirD4; Provisio 90.36
KOG0389|consensus 941 90.36
KOG0384|consensus 1373 89.98
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 89.95
PRK13851344 type IV secretion system protein VirB11; Provision 89.9
KOG0920|consensus 924 89.7
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 89.65
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 89.08
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 89.03
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 89.02
PRK13764 602 ATPase; Provisional 88.86
COG1200677 RecG RecG-like helicase [DNA replication, recombin 88.73
smart0049082 HELICc helicase superfamily c-terminal domain. 88.68
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 88.53
PRK13850 670 type IV secretion system protein VirD4; Provisiona 88.42
PRK13766 773 Hef nuclease; Provisional 88.38
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 88.23
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 88.09
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 88.04
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 87.94
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 87.93
KOG0391|consensus 1958 87.78
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 87.59
PRK12377248 putative replication protein; Provisional 87.53
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 87.51
KOG0387|consensus 923 87.48
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 87.34
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 87.32
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.17
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 87.12
PRK10867 433 signal recognition particle protein; Provisional 87.1
KOG4439|consensus 901 87.05
PRK08769 319 DNA polymerase III subunit delta'; Validated 86.97
smart00382148 AAA ATPases associated with a variety of cellular 86.74
KOG0060|consensus659 86.41
TIGR02533 486 type_II_gspE general secretory pathway protein E. 86.12
PRK13876 663 conjugal transfer coupling protein TraG; Provision 85.84
COG3587 985 Restriction endonuclease [Defense mechanisms] 85.84
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 85.83
PRK08181269 transposase; Validated 85.64
TIGR00064272 ftsY signal recognition particle-docking protein F 85.55
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 85.51
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 85.34
PRK10436 462 hypothetical protein; Provisional 85.28
PRK06526254 transposase; Provisional 85.24
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 85.1
PRK08533230 flagellar accessory protein FlaH; Reviewed 85.07
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 84.75
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 84.74
PRK13822 641 conjugal transfer coupling protein TraG; Provision 84.56
PRK00771 437 signal recognition particle protein Srp54; Provisi 84.42
PF1355562 AAA_29: P-loop containing region of AAA domain 84.3
KOG0742|consensus 630 84.28
KOG1805|consensus 1100 84.24
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 84.23
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 84.05
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 83.98
TIGR00959 428 ffh signal recognition particle protein. This mode 83.86
PRK02362 737 ski2-like helicase; Provisional 83.85
PRK13880 636 conjugal transfer coupling protein TraG; Provision 83.81
PRK10416318 signal recognition particle-docking protein FtsY; 83.39
KOG0953|consensus 700 83.1
PRK06835329 DNA replication protein DnaC; Validated 83.01
KOG1132|consensus 945 82.9
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 82.84
KOG1533|consensus 290 82.66
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 82.64
PRK06921266 hypothetical protein; Provisional 82.44
PRK04328 249 hypothetical protein; Provisional 82.12
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 81.82
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 81.67
cd03115173 SRP The signal recognition particle (SRP) mediates 81.66
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 81.59
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 81.4
PRK11823 446 DNA repair protein RadA; Provisional 81.07
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 81.04
PRK14974336 cell division protein FtsY; Provisional 80.89
PRK05973237 replicative DNA helicase; Provisional 80.78
PF05729166 NACHT: NACHT domain 80.55
PRK09183259 transposase/IS protein; Provisional 80.53
KOG1002|consensus 791 80.45
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 80.29
PRK13700 732 conjugal transfer protein TraD; Provisional 80.24
PRK06871 325 DNA polymerase III subunit delta'; Validated 80.23
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 80.22
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 80.13
>KOG0339|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-42  Score=320.67  Aligned_cols=219  Identities=23%  Similarity=0.361  Sum_probs=201.9

Q ss_pred             cccCCcCCCCCCcccccCCCC---CCCccccCCCCHHHHHHHHHHCCceeecCCCCCCcccccCCCCChhhhcccCcCCC
Q psy10677         79 VSFSLPFRDDKTSVVTVPSYP---DPSVNHLQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTT  155 (317)
Q Consensus        79 rg~~~~lr~~~~d~~~v~nf~---~p~~~~i~~~~~~~i~~~~~~~~i~~~g~~~~~~~~~f~~~~l~~~l~~~l~~~g~  155 (317)
                      |-+| +++..++....+++|.   .++..+++.+++.++-.++...++.+.|...|+|+++|+++++++.|..++++..|
T Consensus       165 r~id-pl~~idhs~i~y~p~~kdfy~e~esI~gl~~~d~~~~r~~Lnlrv~g~s~~rpvtsfeh~gfDkqLm~airk~Ey  243 (731)
T KOG0339|consen  165 RQID-PLPPIDHSEIDYEPFNKDFYEEHESIEGLTKMDVIDLRLTLNLRVSGSSPPRPVTSFEHFGFDKQLMTAIRKSEY  243 (731)
T ss_pred             ccCC-CCCCcchhhccccccccccccChhhhhccccccchhhHhhhcceeccCCCCCCcchhhhcCchHHHHHHHhhhhc
Confidence            4454 4555666666666665   56667799999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCCCCCCCCchhhhhccccccccCcCcccccceeccCCChhHHHHHHHHHHHHHcCCCCCCCCCceEEEEcCcHHH
Q psy10677        156 NNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTREL  235 (317)
Q Consensus       156 ~~p~~~~~~~~~t~iQ~~~ip~~l~~~g~dvi~~~~~~a~tGsGKTla~~lp~l~~l~~~~~~~~~~~~~alil~PtreL  235 (317)
                      +.|         ||||.+++|..+  +|+||+    .+|.||||||.||+.|++.|++.++.+..+++|.+||+||||||
T Consensus       244 ~kp---------tpiq~qalptal--sgrdvi----gIAktgSgktaAfi~pm~~himdq~eL~~g~gPi~vilvPTrel  308 (731)
T KOG0339|consen  244 EKP---------TPIQCQALPTAL--SGRDVI----GIAKTGSGKTAAFIWPMIVHIMDQPELKPGEGPIGVILVPTREL  308 (731)
T ss_pred             ccC---------Cccccccccccc--ccccch----heeeccCcchhHHHHHHHHHhcchhhhcCCCCCeEEEEeccHHH
Confidence            999         999999999999  999999    99999999999999999999999999888999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCcEEEEEECCCCHHHHHHHccC---cEEECcHHHHHHHhcC-----CCCCCCCchhHHHhhhcCC
Q psy10677        236 AQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRI---LTSATNTSLGIYLQQN-----DAHSPCLSVWRRLQDILGL  307 (317)
Q Consensus       236 a~Qi~~~~~~l~~~~~~~~~~~~gg~~~~~~~~~~~~---ilv~TP~~l~~~l~~~-----~~~~~~lde~d~l~~~~gf  307 (317)
                      |.||+.++++|++.+|++++++|||.+..+|.+.++.   |||||||||+++++.+     .+.|+++||||+|+| |||
T Consensus       309 a~Qi~~eaKkf~K~ygl~~v~~ygGgsk~eQ~k~Lk~g~EivVaTPgRlid~VkmKatn~~rvS~LV~DEadrmfd-mGf  387 (731)
T KOG0339|consen  309 ASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQSKELKEGAEIVVATPGRLIDMVKMKATNLSRVSYLVLDEADRMFD-MGF  387 (731)
T ss_pred             HHHHHHHHHHhhhhccceEEEeecCCcHHHHHHhhhcCCeEEEechHHHHHHHHhhcccceeeeEEEEechhhhhc-ccc
Confidence            9999999999999999999999999999999999987   8999999999999987     455788999999999 999


Q ss_pred             cHHHHhh
Q psy10677        308 TEETCVN  314 (317)
Q Consensus       308 ~~~~~~~  314 (317)
                      +++.+-+
T Consensus       388 e~qVrSI  394 (731)
T KOG0339|consen  388 EPQVRSI  394 (731)
T ss_pred             HHHHHHH
Confidence            9998754



>KOG0331|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 4e-23
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-23
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-06
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 4e-05
2vso_A 395 Crystal Structure Of A Translation Initiation Compl 1e-04
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 2e-04
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 3e-04
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 5e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure

Iteration: 1

Score = 105 bits (262), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 59/167 (35%), Positives = 86/167 (51%), Gaps = 25/167 (14%) Query: 106 LQGKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMXXXXXXXXXXXXXXX 165 L +T +E++++R+ IT+ G N PKPV E N P+ ++ + Sbjct: 14 LARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIA-------------- 59 Query: 166 XCGDKESKNWTIPLNFQAKKFISVLQK-----KAEVQSRSVFTYILPALYHILKMPKLEE 220 +N+T P QA+ + L A+ S +Y+LPA+ HI P LE Sbjct: 60 ------RQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLER 113 Query: 221 GDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQV 267 GDGPI LVLAPTRELAQQ+Q V + + R R++ C+YGG K Q+ Sbjct: 114 GDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQI 160
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-39
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-13
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 7e-30
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 6e-20
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-24
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-10
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 6e-24
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 9e-20
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 4e-23
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 4e-10
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-22
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-16
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-12
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-12
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-11
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 9e-11
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-04
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 9e-11
3bor_A237 Human initiation factor 4A-II; translation initiat 3e-10
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-10
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-05
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-10
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-05
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 5e-10
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-06
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-10
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 3e-06
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-09
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 7e-06
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 2e-09
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-05
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 3e-09
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 9e-05
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-09
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-05
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-09
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-05
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 5e-09
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-06
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 7e-09
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 8e-09
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 9e-09
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-08
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-05
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-08
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 6e-08
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 6e-08
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-07
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-07
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 5e-05
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-07
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-04
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
 Score =  138 bits (350), Expect = 1e-39
 Identities = 59/167 (35%), Positives = 85/167 (50%), Gaps = 25/167 (14%)

Query: 110 TKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGD 169
           T +E++++R+   IT+ G N PKPV    E N P+ ++  +                   
Sbjct: 4   TAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIA------------------ 45

Query: 170 KESKNWTIPLNFQAKKFISVLQKK-----AEVQSRSVFTYILPALYHILKMPKLEEGDGP 224
              +N+T P   QA+ +   L        A+  S    +Y+LPA+ HI   P LE GDGP
Sbjct: 46  --RQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGP 103

Query: 225 IALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLR 271
           I LVLAPTRELAQQ+Q V + + R  R++  C+YGG  K  Q+  L 
Sbjct: 104 ICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 150


>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.97
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.97
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.97
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.97
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.97
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.97
3bor_A237 Human initiation factor 4A-II; translation initiat 99.97
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.96
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.96
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.96
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.96
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.96
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.96
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.95
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.93
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.93
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.93
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.93
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.92
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.92
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.92
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.92
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.91
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.91
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.91
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.9
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.88
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.88
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.86
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.86
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.85
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.85
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.84
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.84
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.84
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.83
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.83
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.83
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.83
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.83
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.81
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.81
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.81
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.8
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.8
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.78
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.78
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.76
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.71
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.7
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.69
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.69
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.68
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.66
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.65
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.64
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.63
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.63
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.58
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.56
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.55
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.54
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.51
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.49
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.49
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.42
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.4
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.35
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.33
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.32
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.31
3h1t_A 590 Type I site-specific restriction-modification syst 99.3
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.15
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.12
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.1
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.09
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.98
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.93
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.85
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.85
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.72
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.72
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.7
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.69
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.64
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.63
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 98.61
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.61
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.6
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.58
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.52
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.51
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.47
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.42
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.41
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.41
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 97.64
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.24
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.24
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 98.23
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.14
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.12
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.07
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.99
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.71
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 97.63
3jux_A822 Protein translocase subunit SECA; protein transloc 97.58
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 97.5
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.33
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 97.32
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.11
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 96.99
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.9
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 96.87
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 96.84
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.79
1yks_A440 Genome polyprotein [contains: flavivirin protease 96.62
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.55
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.55
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 96.53
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.51
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.47
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.4
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 96.32
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.25
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.17
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 95.68
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 95.51
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 95.33
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.28
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.19
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.14
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 94.95
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.87
4gl2_A699 Interferon-induced helicase C domain-containing P; 94.59
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 94.37
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 94.34
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.67
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 93.64
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 93.33
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 93.08
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 92.96
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 92.75
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 92.66
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 92.48
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 92.37
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 91.99
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 91.93
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 91.92
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 91.78
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 91.63
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 91.63
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 91.05
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 91.0
3h1t_A590 Type I site-specific restriction-modification syst 89.35
2eyu_A 261 Twitching motility protein PILT; pilus retraction 89.09
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 87.74
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 87.15
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 86.96
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 85.16
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 84.87
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 83.79
3co5_A143 Putative two-component system transcriptional RES 82.78
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 82.55
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 83.11
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 81.75
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 80.87
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 80.74
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
Probab=100.00  E-value=9.8e-37  Score=270.54  Aligned_cols=192  Identities=33%  Similarity=0.555  Sum_probs=172.7

Q ss_pred             CCCHHHHHHHHHHCCceeecCCCCCCcccccCCCCChhhhcccCcCCCCCCCcCCCCCCCCchhhhhccccccccCcCcc
Q psy10677        108 GKTKEEIDSFRKEHNITLIGQNIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFI  187 (317)
Q Consensus       108 ~~~~~~i~~~~~~~~i~~~g~~~~~~~~~f~~~~l~~~l~~~l~~~g~~~p~~~~~~~~~t~iQ~~~ip~~l~~~g~dvi  187 (317)
                      .+++++++.+++.+++.+.|.+.|.|+.+|+++++++.++++|.+.||..|         +++|.++||.++  +|+|++
T Consensus         2 ~~~~~~~~~~~~~~~i~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~~---------~~~Q~~~i~~~~--~g~~~l   70 (242)
T 3fe2_A            2 MRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEP---------TAIQAQGWPVAL--SGLDMV   70 (242)
T ss_dssp             ----CHHHHHHHHHTEEEESSCCCCCCSSTTTTTCCHHHHHHHHTTTCCSC---------CHHHHHHHHHHH--HTCCEE
T ss_pred             CCCHHHHHHHHhcCceEEeCCCCCCccCCHhhcCCCHHHHHHHHHCCCCCC---------CHHHHHHHHHHh--CCCCEE
Confidence            346789999999999999999999999999999999999999999999999         999999999999  999999


Q ss_pred             cccceeccCCChhHHHHHHHHHHHHHcCCCCCCCCCceEEEEcCcHHHHHHHHHHHHHHhcCCCcEEEEEECCCCHHHHH
Q psy10677        188 SVLQKKAEVQSRSVFTYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQV  267 (317)
Q Consensus       188 ~~~~~~a~tGsGKTla~~lp~l~~l~~~~~~~~~~~~~alil~PtreLa~Qi~~~~~~l~~~~~~~~~~~~gg~~~~~~~  267 (317)
                          ++||||||||++|++|++.++...+......++++||++|||+||.|+++.++++.+..++++.+++||.+...+.
T Consensus        71 ----~~apTGsGKT~~~~l~~l~~l~~~~~~~~~~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~  146 (242)
T 3fe2_A           71 ----GVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQI  146 (242)
T ss_dssp             ----EEECTTSCHHHHHHHHHHHHHHTSCCCCTTCCCSEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEECTTSCHHHHH
T ss_pred             ----EECCCcCHHHHHHHHHHHHHHHhccccccCCCCEEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEECCCChHHHH
Confidence                9999999999999999999998765545567899999999999999999999999999999999999999988877


Q ss_pred             HHcc---CcEEECcHHHHHHHhcC-----CCCCCCCchhHHHhhhcCCcHHHHhhc
Q psy10677        268 ILLR---ILTSATNTSLGIYLQQN-----DAHSPCLSVWRRLQDILGLTEETCVNV  315 (317)
Q Consensus       268 ~~~~---~ilv~TP~~l~~~l~~~-----~~~~~~lde~d~l~~~~gf~~~~~~~~  315 (317)
                      ..+.   +|+||||++|.+++..+     .+++.++||||+|++ .||.++....+
T Consensus       147 ~~~~~~~~I~v~Tp~~l~~~l~~~~~~~~~~~~lViDEah~l~~-~~~~~~~~~i~  201 (242)
T 3fe2_A          147 RDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLD-MGFEPQIRKIV  201 (242)
T ss_dssp             HHHHHCCSEEEECHHHHHHHHHHTSCCCTTCCEEEETTHHHHHH-TTCHHHHHHHH
T ss_pred             HHhcCCCCEEEECHHHHHHHHHcCCCCcccccEEEEeCHHHHhh-hCcHHHHHHHH
Confidence            7664   39999999999998865     566788999999999 99988766543



>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-06
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-06
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-06
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-06
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-05
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-05
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-05
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-05
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-05
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-04
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase VlgB
species: Flatworm (Dugesia japonica) [TaxId: 6161]
 Score = 46.8 bits (110), Expect = 1e-06
 Identities = 16/27 (59%), Positives = 22/27 (81%)

Query: 1   MWSATWPREIQKLAKEFLSDPIQLNVG 27
           M+SAT+P+EIQKLA +FL + I + VG
Sbjct: 212 MFSATFPKEIQKLAADFLYNYIFMTVG 238


>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.97
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.89
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.82
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.8
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.7
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.5
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.49
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.47
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.18
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.06
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.98
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.94
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.9
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.89
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.84
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 98.8
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 98.77
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.69
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.39
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.35
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 98.31
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.27
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.12
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.99
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 97.41
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 97.4
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.38
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.16
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 97.05
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 96.89
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.59
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.43
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.95
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 95.86
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.85
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.6
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.57
d1vmaa2213 GTPase domain of the signal recognition particle r 93.43
d2qy9a2211 GTPase domain of the signal recognition particle r 93.18
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 92.91
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 92.9
d1okkd2207 GTPase domain of the signal recognition particle r 92.36
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 92.1
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.85
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 91.72
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.48
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 91.3
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 91.27
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 90.09
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 90.05
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 89.16
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 89.12
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 89.02
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.83
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 87.03
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 86.75
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 84.95
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 83.77
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 83.46
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 82.38
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 82.1
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 81.93
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 81.03
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 80.84
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 80.75
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.7e-40  Score=287.16  Aligned_cols=166  Identities=17%  Similarity=0.159  Sum_probs=150.9

Q ss_pred             CCCCCcccccCCCCChhhhcccCcCCCCCCCcCCCCCCCCchhhhhccccccccCcCcccccceeccCCChhHHHHHHHH
Q psy10677        129 NIPKPVKTLDETNIPSYILGPMKPKTTNNENNHNKNKKCGDKESKNWTIPLNFQAKKFISVLQKKAEVQSRSVFTYILPA  208 (317)
Q Consensus       129 ~~~~~~~~f~~~~l~~~l~~~l~~~g~~~p~~~~~~~~~t~iQ~~~ip~~l~~~g~dvi~~~~~~a~tGsGKTla~~lp~  208 (317)
                      .......+|++++|++.++++|+++||..|         ||||++|||.++  +|+|++    ++||||||||+||++|+
T Consensus        11 ~~~~~~~sF~~l~L~~~l~~~L~~~g~~~p---------t~IQ~~aIp~il--~g~dvi----~~a~TGSGKTlayllPi   75 (222)
T d2j0sa1          11 EEVDVTPTFDTMGLREDLLRGIYAYGFEKP---------SAIQQRAIKQII--KGRDVI----AQSQSGTGKTATFSISV   75 (222)
T ss_dssp             TTCCCCCSGGGGCCCHHHHHHHHHHTCCSC---------CHHHHHHHHHHH--TTCCEE----EECCTTSSHHHHHHHHH
T ss_pred             CCCCCCCCHHHCCCCHHHHHHHHHCCCCCC---------CHHHHHHHHHHH--CCCCeE----EEcCcchhhhhhhcccc
Confidence            334556799999999999999999999999         999999999999  999999    99999999999999999


Q ss_pred             HHHHHcCCCCCCCCCceEEEEcCcHHHHHHHHHHHHHHhcCCCcEEEEEECCCCHHHHHHHccC---cEEECcHHHHHHH
Q psy10677        209 LYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQVILLRI---LTSATNTSLGIYL  285 (317)
Q Consensus       209 l~~l~~~~~~~~~~~~~alil~PtreLa~Qi~~~~~~l~~~~~~~~~~~~gg~~~~~~~~~~~~---ilv~TP~~l~~~l  285 (317)
                      ++++...     ..+|+++|++||||||.|++++++++++..++++.+++||.+..++...++.   |+|||||||.+++
T Consensus        76 l~~l~~~-----~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~  150 (222)
T d2j0sa1          76 LQCLDIQ-----VRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMI  150 (222)
T ss_dssp             HHTCCTT-----SCSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHH
T ss_pred             ccccccc-----ccCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcc
Confidence            9998754     3579999999999999999999999999999999999999999888776654   8999999999999


Q ss_pred             hcC-----CCCCCCCchhHHHhhhcCCcHHHHhhc
Q psy10677        286 QQN-----DAHSPCLSVWRRLQDILGLTEETCVNV  315 (317)
Q Consensus       286 ~~~-----~~~~~~lde~d~l~~~~gf~~~~~~~~  315 (317)
                      ..+     .++++++||||+|+| .||.++....+
T Consensus       151 ~~~~~~~~~l~~lVlDEaD~ll~-~~f~~~i~~I~  184 (222)
T d2j0sa1         151 RRRSLRTRAIKMLVLDEADEMLN-KGFKEQIYDVY  184 (222)
T ss_dssp             HTTSSCCTTCCEEEEETHHHHTS-TTTHHHHHHHH
T ss_pred             cccccccccceeeeecchhHhhh-cCcHHHHHHHH
Confidence            886     466888999999999 99998876654



>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure