Psyllid ID: psy10680

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
MKQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKEESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKNKPITTRQWKREYWRRKSSEILAEW
cccEEEEEcccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHccccEEEEcccHHHHHHHcccccccEEEEEEEHHHHHHcccccHHHHHHHHHccccccccccEEEEEEcccHHHHHHHcccccccccEEEEccHHHcccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccEEEEEEcccccHHccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccccccccEEEccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccHHHccc
ccccEEEEccccccccccccccccHHccccHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHccccEEEEcccHHHHHHHHccccHccEEEEEEcHHHHHccccccHHHHHHHHHccccHccHHccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEcccccEEEEEEcccccEEEEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEHHHHHcccccccccEEEEEcccccHHHHEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccc
MKQSVSVRLVSLEARLPYFRSGYINVLIASdvasrglgknsgygkptsiqaqswpiclsgrdligiaqtgsgktlSLTIENTqvargsqcgrsntskeessWWNNNVVDVKYILPALYHIlkmpkleegdgpialvLAPTRELAQQIQAVISIFSRTMRIRHAClyggtskmyqtrdlcrgaeivvatpgrlidflesgttnvnritYLVLDEADRMLDMGFEPQIRKIIQMTRtrdlcrgaeivvatpgrlidflesgttnvnritYLVLDEADRMLDMGFEPQIRKIIQMtrhahpvvpvslFISERRDTILHFLEsgttnvnriTYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINhngtetkhygVSSSLYRAmgihgdksqwnrdqtLRDFRSGYINVLIASdvasrgldvedikyvvnydfpdntenyvHRIGrtarstktgisytlftplngnkaQDLIDILNEAHQFVPDRLLLLAaknkpittrQWKREYWRRKSSEILAEW
MKQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTqvargsqcgrsntskeesswwnnNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIdflesgttnvnriTYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEivvatpgrlidflesgttnvnriTYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHflesgttnvnriTYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIasdvasrgldveDIKYvvnydfpdntenyvhrigrtarstktgISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLllaaknkpittrqwkreywrrksseilaew
MKQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKEESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKNKPITTRQWKREYWRRKSSEILAEW
******VRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIE********************SWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKNKPITTRQWKREYWR**********
*KQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGS**************WNNNVVDVKYILPALYHILK*******DGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRK*********LCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRL*******************************
MKQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQV*****************WWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKNKPITTRQWKREYWRRKSSEILAEW
MKQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCG**********WWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKN************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQSVSVRLVSLEARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKEESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKNKPITTRQWKREYWRRKSSEILAEW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query537 2.2.26 [Sep-21-2011]
Q5B0J9563 ATP-dependent RNA helicas yes N/A 0.672 0.641 0.405 5e-82
Q2H720562 ATP-dependent RNA helicas N/A N/A 0.666 0.637 0.381 7e-80
Q7SBC6562 ATP-dependent RNA helicas N/A N/A 0.668 0.638 0.384 5e-79
Q1DP69545 ATP-dependent RNA helicas N/A N/A 0.653 0.644 0.377 5e-75
Q501J6 650 Probable ATP-dependent RN yes N/A 0.666 0.550 0.4 1e-73
Q92841 729 Probable ATP-dependent RN yes N/A 0.666 0.491 0.4 1e-73
P24782550 ATP-dependent RNA helicas yes N/A 0.657 0.641 0.367 3e-72
Q4PHU9552 ATP-dependent RNA helicas N/A N/A 0.657 0.639 0.365 4e-70
Q4X195547 ATP-dependent RNA helicas yes N/A 0.653 0.641 0.365 2e-69
Q54CE0785 Probable ATP-dependent RN yes N/A 0.666 0.456 0.369 3e-69
>sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 Back     alignment and function desciption
 Score =  305 bits (781), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 190/469 (40%), Positives = 253/469 (53%), Gaps = 108/469 (23%)

Query: 39  KNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKE 98
           K  G+ KPT+IQ+Q WP+ LSGRD++GIA+TGSGKTLS                      
Sbjct: 156 KAQGFEKPTAIQSQGWPMALSGRDVVGIAETGSGKTLS---------------------- 193

Query: 99  ESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTM 158
                        Y LPA+ HI   P L  GDGPI L+LAPTRELA QIQA IS F ++ 
Sbjct: 194 -------------YCLPAIVHINAQPLLAPGDGPIVLILAPTRELAVQIQAEISKFGKSS 240

Query: 159 RIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRML 218
           RIR+ C+YGG  K  Q RDL RG E+ +ATPGRLID LE+G TN+ R+TYLVLDEADRML
Sbjct: 241 RIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRML 300

Query: 219 DMGFEPQIRKIIQMTRT-RDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRM 277
           DMGFEPQIRKII   R  R  C    +  AT  + +  L S   N     Y+ ++     
Sbjct: 301 DMGFEPQIRKIISQIRPDRQTC----MWSATWPKEVRQLASDFLN----NYIQVNIGS-- 350

Query: 278 LDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADR 337
           +D+    +I +I+++         +S F  E+RD ++  LE    N      LV     R
Sbjct: 351 MDLSANHRITQIVEV---------ISEF--EKRDRMIKHLEKIMENRGN-KCLVFTGTKR 398

Query: 338 MLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVS 397
           + D           ++TRF                           +  +G         
Sbjct: 399 IAD-----------EITRF---------------------------LRQDG--------- 411

Query: 398 SSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNT 457
              + A+ IHGDK Q  RD  L +F++G   +++A+DVASRG+DV DI +V+NYD+P+N+
Sbjct: 412 ---WPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVINYDYPNNS 468

Query: 458 ENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRL 506
           E+YVHRIGRT R+   G + T FT  N  +A+DL+ IL+EA Q +  RL
Sbjct: 469 EDYVHRIGRTGRAGAKGTAITFFTTDNAKQARDLVTILSEAKQQIDPRL 517
ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (taxid: 227321)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-2 PE=3 SV=2 Back     alignment and function description
>sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 Back     alignment and function description
>sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=2 SV=1 Back     alignment and function description
>sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 Back     alignment and function description
>sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 Back     alignment and function description
>sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 Back     alignment and function description
>sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 Back     alignment and function description
>sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
289724644 652 ATP-dependent RNA helicase [Glossina mor 0.685 0.564 0.405 3e-80
67539522563 hypothetical protein AN5931.2 [Aspergill 0.672 0.641 0.405 3e-80
195439780 800 GK12550 [Drosophila willistoni] gi|19416 0.679 0.456 0.408 4e-80
195069886 793 GH22580 [Drosophila grimshawi] gi|193891 0.677 0.459 0.413 3e-79
453083070546 P-loop containing nucleoside triphosphat 0.672 0.661 0.392 4e-79
320580546529 ATP-dependent RNA helicase [Ogataea para 0.685 0.695 0.394 2e-78
241148964 685 ATP-dependent helicase (DEAD box), putat 0.705 0.553 0.401 4e-78
116191655562 hypothetical protein CHGG_05545 [Chaetom 0.666 0.637 0.381 4e-78
336271291602 hypothetical protein SMAC_02116 [Sordari 0.677 0.604 0.386 9e-78
380090926610 unnamed protein product [Sordaria macros 0.677 0.596 0.386 1e-77
>gi|289724644|gb|ADD18300.1| ATP-dependent RNA helicase [Glossina morsitans morsitans] Back     alignment and taxonomy information
 Score =  305 bits (782), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 194/478 (40%), Positives = 252/478 (52%), Gaps = 110/478 (23%)

Query: 39  KNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKE 98
           K  G+ KPT+IQAQ WPI LSGRD++G+AQTGSGKTL+                      
Sbjct: 134 KKLGFAKPTAIQAQGWPIALSGRDMVGVAQTGSGKTLA---------------------- 171

Query: 99  ESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTM 158
                        Y+LPA+ HI   P+LE  DGPIAL+LAPTRELAQQIQ V + F   +
Sbjct: 172 -------------YVLPAVVHINNQPRLEHSDGPIALILAPTRELAQQIQQVANEFGSQI 218

Query: 159 RIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRML 218
                          Q R+ C    I    P                             
Sbjct: 219 ---------------QVRNTC----IFGGAPK---------------------------- 231

Query: 219 DMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRML 278
               +PQ         +RDL RG EIV+ATPGRLIDFLE G TN+ R TYLVLDEADRML
Sbjct: 232 ----QPQ---------SRDLERGVEIVIATPGRLIDFLERGVTNLRRCTYLVLDEADRML 278

Query: 279 DMGFEPQIRKIIQMTRHAHPVVPVSL-FISERRDTILHFLESGTT-NVNRITYLVLDEAD 336
           DMGFEPQIRKII+  R    V+  S  +  E R+    FL++    N+  +T        
Sbjct: 279 DMGFEPQIRKIIKQIRPDRQVLMWSATWPKEVRNLAEEFLDNYIQINIGSLTLSANHNIL 338

Query: 337 RMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGV 396
           +++D+  E +     +  + N    LG +           +  +F+E      E     +
Sbjct: 339 QIVDVCEEAE-----KTNKLNK--LLGEISS-----EKDTKTIIFVETKKRVDEITR-SI 385

Query: 397 SSSLYRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDN 456
           S   +RA  IHGDKSQ  RD  L  FR+G  ++L+A+DVA+RGLDV+D+K+V+NYD+P N
Sbjct: 386 SRQGWRACAIHGDKSQQERDYVLTSFRNGRSSILVATDVAARGLDVDDVKFVINYDYPSN 445

Query: 457 TENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQFVPDRLLLLAAKNK 514
           +E+YVHRIGRT RS  TG +YTLFT  N NKA DLI +L EA Q +  RL+ +A+ +K
Sbjct: 446 SEDYVHRIGRTGRSNNTGTAYTLFTTANANKANDLIQVLREAKQVINPRLVDMASHSK 503

Source: Glossina morsitans morsitans

Species: Glossina morsitans

Genus: Glossina

Family: Glossinidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|67539522|ref|XP_663535.1| hypothetical protein AN5931.2 [Aspergillus nidulans FGSC A4] gi|74657087|sp|Q5B0J9.1|DBP2_EMENI RecName: Full=ATP-dependent RNA helicase dbp2 gi|40738604|gb|EAA57794.1| hypothetical protein AN5931.2 [Aspergillus nidulans FGSC A4] gi|259479898|tpe|CBF70542.1| TPA: ATP-dependent RNA helicase dbp2 (EC 3.6.1.-) [Source:UniProtKB/Swiss-Prot;Acc:Q5B0J9] [Aspergillus nidulans FGSC A4] Back     alignment and taxonomy information
>gi|195439780|ref|XP_002067737.1| GK12550 [Drosophila willistoni] gi|194163822|gb|EDW78723.1| GK12550 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195069886|ref|XP_001997052.1| GH22580 [Drosophila grimshawi] gi|193891570|gb|EDV90436.1| GH22580 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|453083070|gb|EMF11116.1| P-loop containing nucleoside triphosphate hydrolase protein [Mycosphaerella populorum SO2202] Back     alignment and taxonomy information
>gi|320580546|gb|EFW94768.1| ATP-dependent RNA helicase [Ogataea parapolymorpha DL-1] Back     alignment and taxonomy information
>gi|241148964|ref|XP_002405951.1| ATP-dependent helicase (DEAD box), putative [Ixodes scapularis] gi|215493784|gb|EEC03425.1| ATP-dependent helicase (DEAD box), putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|116191655|ref|XP_001221640.1| hypothetical protein CHGG_05545 [Chaetomium globosum CBS 148.51] gi|118575171|sp|Q2H720.1|DBP2_CHAGB RecName: Full=ATP-dependent RNA helicase DBP2 gi|88181458|gb|EAQ88926.1| hypothetical protein CHGG_05545 [Chaetomium globosum CBS 148.51] Back     alignment and taxonomy information
>gi|336271291|ref|XP_003350404.1| hypothetical protein SMAC_02116 [Sordaria macrospora k-hell] Back     alignment and taxonomy information
>gi|380090926|emb|CCC11459.1| unnamed protein product [Sordaria macrospora k-hell] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
UNIPROTKB|F1NM08595 DDX5 "Uncharacterized protein" 0.232 0.210 0.664 2.9e-88
UNIPROTKB|F1NXI3603 DDX5 "Uncharacterized protein" 0.232 0.207 0.664 2.9e-88
MGI|MGI:105037614 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.232 0.203 0.656 5.2e-87
UNIPROTKB|F1MBQ8614 DDX5 "Uncharacterized protein" 0.232 0.203 0.656 5.2e-87
UNIPROTKB|J3KTA4614 DDX5 "Probable ATP-dependent R 0.232 0.203 0.656 5.2e-87
UNIPROTKB|P17844614 DDX5 "Probable ATP-dependent R 0.232 0.203 0.656 5.2e-87
UNIPROTKB|Q5R4I9614 DDX5 "Probable ATP-dependent R 0.232 0.203 0.656 5.2e-87
RGD|619906615 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.232 0.203 0.656 5.6e-87
ZFIN|ZDB-GENE-030131-925617 ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.232 0.202 0.656 8.5e-87
UNIPROTKB|Q4R6M5614 DDX5 "Probable ATP-dependent R 0.232 0.203 0.656 2.8e-86
UNIPROTKB|F1NM08 DDX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 426 (155.0 bits), Expect = 2.9e-88, Sum P(3) = 2.9e-88
 Identities = 83/125 (66%), Positives = 96/125 (76%)

Query:   110 VKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGT 169
             + Y+LPA+ HI   P LE GDGPI LVLAPTRELAQQ+Q V + +SR  R++  C+YGG 
Sbjct:   134 LSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYSRACRLKSTCIYGGA 193

Query:   170 SKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKI 229
              K  Q RDL RG EI +ATPGRLIDFLE+G TN+ R TYLVLDEADRMLDMGFEPQIRKI
Sbjct:   194 PKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKI 253

Query:   230 IQMTR 234
             +   R
Sbjct:   254 VDQIR 258
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003712 "transcription cofactor activity" evidence=IEA
GO:0003724 "RNA helicase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F1NXI3 DDX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:105037 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBQ8 DDX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KTA4 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17844 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4I9 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|619906 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box helicase 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-925 ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R6M5 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CIV2DBP2_KLULA3, ., 6, ., 4, ., 1, 30.36210.64050.6209yesN/A
P0CQ76DBP2_CRYNJ3, ., 6, ., 4, ., 1, 30.36280.66480.6611yesN/A
A2QC74DBP2_ASPNC3, ., 6, ., 4, ., 1, 30.36850.64610.6141yesN/A
Q8SRB2DBP2_ENCCU3, ., 6, ., 4, ., 1, 30.37100.65730.7131yesN/A
Q5B0J9DBP2_EMENI3, ., 6, ., 4, ., 1, 30.40510.67220.6412yesN/A
Q6BY27DBP2_DEBHA3, ., 6, ., 4, ., 1, 30.35710.66290.6641yesN/A
Q5QMN3RH20_ORYSJ3, ., 6, ., 4, ., 1, 30.36660.68900.7489yesN/A
A3LQW7DBP2_PICST3, ., 6, ., 4, ., 1, 30.35240.66850.6773yesN/A
Q6FLF3DBP2_CANGA3, ., 6, ., 4, ., 1, 30.35310.64240.6341yesN/A
Q4X195DBP2_ASPFU3, ., 6, ., 4, ., 1, 30.36550.65360.6416yesN/A
Q9C718RH20_ARATH3, ., 6, ., 4, ., 1, 30.36900.67220.7205yesN/A
Q755N4DBP2_ASHGO3, ., 6, ., 4, ., 1, 30.35240.64430.6211yesN/A
Q2U070DBP2_ASPOR3, ., 6, ., 4, ., 1, 30.37060.64610.6263yesN/A
P24783DBP2_YEAST3, ., 6, ., 4, ., 1, 30.35460.64610.6355yesN/A
P24782DBP2_SCHPO3, ., 6, ., 4, ., 1, 30.36700.65730.6418yesN/A
Q6C4D4DBP2_YARLI3, ., 6, ., 4, ., 1, 30.36260.65730.6394yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-74
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-71
cd00268203 cd00268, DEADc, DEAD-box helicases 8e-69
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-42
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-41
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 7e-35
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-34
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 4e-33
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 7e-33
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-32
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 4e-31
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 7e-30
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-29
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-27
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-26
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-25
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 5e-25
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-24
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-23
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-23
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 4e-23
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-23
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-20
smart0049082 smart00490, HELICc, helicase superfamily c-termina 5e-20
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-19
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 6e-19
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 6e-17
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 3e-16
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-15
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-14
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-12
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-11
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-10
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-10
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 8e-09
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 8e-08
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-07
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 2e-07
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-05
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-04
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-04
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 2e-04
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 3e-04
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 3e-04
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 0.004
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 0.004
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  245 bits (626), Expect = 1e-74
 Identities = 135/521 (25%), Positives = 210/521 (40%), Gaps = 155/521 (29%)

Query: 39  KNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKE 98
           K+ G+ +PT IQ  + P+ L+GRD++G AQTG+GKT +                      
Sbjct: 45  KDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGKTAA---------------------- 82

Query: 99  ESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTM 158
                        ++LP L  ILK     E     AL+LAPTRELA QI   +       
Sbjct: 83  -------------FLLPLLQKILK---SVERKYVSALILAPTRELAVQIAEEL------- 119

Query: 159 RIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRML 218
                            R L +    +                   R+  +         
Sbjct: 120 -----------------RKLGKNLGGL-------------------RVAVVYGG------ 137

Query: 219 DMGFEPQIRKIIQMTRTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRML 278
            +    QI           L RG +IVVATPGRL+D ++ G  +++ +  LVLDEADRML
Sbjct: 138 -VSIRKQIEA---------LKRGVDIVVATPGRLLDLIKRGKLDLSGVETLVLDEADRML 187

Query: 279 DMGFEPQIRKIIQMTRHAHPVVPVSLF-------ISERRDTILH-------FLESGTTNV 324
           DMGF   I KI++        +   LF       I E     L+        +E     +
Sbjct: 188 DMGFIDDIEKILKALPPDRQTL---LFSATMPDDIRELARRYLNDPVEIEVSVEKLERTL 244

Query: 325 NRIT--YLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFM 382
            +I   YL ++  +  L++     + K+++       +                   VF 
Sbjct: 245 KKIKQFYLEVESEEEKLEL-----LLKLLKDEDEGRVI-------------------VF- 279

Query: 383 EINHNGTETKH--YGVSSSL----YRAMGIHGDKSQWNRDQTLRDFRSGYINVLIASDVA 436
                   TK     ++ SL    ++   +HGD  Q  RD+ L  F+ G + VL+A+DVA
Sbjct: 280 ------VRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVA 333

Query: 437 SRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILN 496
           +RGLD+ D+ +V+NYD P + E+YVHRIGRT R+ + G++ +  T     + + L  I  
Sbjct: 334 ARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEE--EEVKKLKRIEK 391

Query: 497 EAHQFVPDRLLLLAAKNKPITTRQWKREYWRRKSSEILAEW 537
              + +P  +LL   + +     +  R     +S       
Sbjct: 392 RLERKLPSAVLLPLDEPEDAKLLKTTRPGLEEESDISDEIK 432

Length = 513
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 537
KOG0331|consensus519 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0330|consensus476 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0336|consensus629 100.0
KOG0328|consensus400 100.0
KOG0335|consensus482 100.0
KOG0333|consensus673 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0339|consensus 731 100.0
KOG0340|consensus442 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338|consensus 691 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0341|consensus610 100.0
KOG0342|consensus543 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0345|consensus 567 100.0
KOG0348|consensus708 100.0
KOG0326|consensus459 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0334|consensus 997 100.0
KOG0347|consensus 731 100.0
KOG0343|consensus 758 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0346|consensus 569 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0332|consensus477 100.0
KOG0344|consensus593 100.0
KOG4284|consensus 980 100.0
KOG0350|consensus620 100.0
KOG0327|consensus397 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0337|consensus 529 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
KOG0354|consensus 746 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
KOG0329|consensus387 99.98
PRK13766 773 Hef nuclease; Provisional 99.98
COG1202 830 Superfamily II helicase, archaea-specific [General 99.98
PRK09401 1176 reverse gyrase; Reviewed 99.97
KOG0352|consensus 641 99.97
COG1205 851 Distinct helicase family with a unique C-terminal 99.97
PRK14701 1638 reverse gyrase; Provisional 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0351|consensus 941 99.97
PHA02653 675 RNA helicase NPH-II; Provisional 99.97
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.97
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.97
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.96
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.96
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK05580679 primosome assembly protein PriA; Validated 99.96
KOG0952|consensus 1230 99.96
KOG0349|consensus725 99.96
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.96
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.96
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.96
KOG0353|consensus 695 99.95
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.95
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.94
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.94
PRK04914 956 ATP-dependent helicase HepA; Validated 99.93
KOG0947|consensus 1248 99.93
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.93
KOG0951|consensus 1674 99.93
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.92
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.92
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.92
PRK09694 878 helicase Cas3; Provisional 99.91
KOG0948|consensus 1041 99.91
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.9
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.9
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.9
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.89
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.88
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.88
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.87
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.87
KOG0950|consensus 1008 99.87
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.86
KOG0949|consensus 1330 99.85
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.85
COG4096 875 HsdR Type I site-specific restriction-modification 99.8
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.79
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.78
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.78
KOG0385|consensus 971 99.78
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.76
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.75
PRK05298652 excinuclease ABC subunit B; Provisional 99.75
COG4889 1518 Predicted helicase [General function prediction on 99.73
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.72
smart00487201 DEXDc DEAD-like helicases superfamily. 99.72
KOG0922|consensus 674 99.71
KOG0390|consensus776 99.69
KOG0387|consensus 923 99.68
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.68
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.67
KOG0920|consensus 924 99.65
KOG0923|consensus 902 99.63
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.63
KOG0384|consensus 1373 99.62
KOG0953|consensus 700 99.62
KOG1123|consensus776 99.62
KOG4150|consensus 1034 99.61
KOG0389|consensus941 99.6
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.59
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.59
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.58
KOG0924|consensus 1042 99.56
KOG0951|consensus 1674 99.56
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.56
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.52
KOG0392|consensus1549 99.49
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.48
KOG1000|consensus689 99.48
PRK14873665 primosome assembly protein PriA; Provisional 99.47
smart0049082 HELICc helicase superfamily c-terminal domain. 99.47
KOG0926|consensus 1172 99.44
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.36
KOG1002|consensus791 99.35
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.33
KOG0925|consensus 699 99.32
KOG4439|consensus901 99.24
KOG0386|consensus 1157 99.2
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.19
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.12
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.12
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.11
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.1
KOG0391|consensus 1958 99.06
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.06
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.03
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.03
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.02
KOG0388|consensus1185 98.99
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.92
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.81
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.8
COG0610 962 Type I site-specific restriction-modification syst 98.78
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.76
KOG1015|consensus 1567 98.63
KOG2340|consensus698 98.63
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.61
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.58
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.54
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.47
KOG0952|consensus1230 98.39
KOG1802|consensus935 98.03
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.02
PRK15483 986 type III restriction-modification system StyLTI en 98.01
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.93
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.88
KOG0921|consensus 1282 97.88
TIGR00376637 DNA helicase, putative. The gene product may repre 97.82
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.78
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.76
KOG1001|consensus674 97.75
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.74
KOG1803|consensus649 97.68
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.67
KOG1016|consensus 1387 97.6
PF1324576 AAA_19: Part of AAA domain 97.56
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.55
KOG1132|consensus 945 97.3
PRK10536262 hypothetical protein; Provisional 97.28
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.19
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.14
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.06
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.02
KOG1805|consensus1100 96.96
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.87
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.82
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.79
PRK08181269 transposase; Validated 96.75
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.71
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.7
PRK06526254 transposase; Provisional 96.64
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.4
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.3
KOG1131|consensus 755 96.28
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.24
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.18
PRK06921266 hypothetical protein; Provisional 96.1
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.06
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.04
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.96
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.93
smart00382148 AAA ATPases associated with a variety of cellular 95.87
PRK07952244 DNA replication protein DnaC; Validated 95.86
PF13871278 Helicase_C_4: Helicase_C-like 95.83
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.81
PRK04296190 thymidine kinase; Provisional 95.78
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.77
KOG0298|consensus 1394 95.67
PRK12377248 putative replication protein; Provisional 95.66
PRK06835329 DNA replication protein DnaC; Validated 95.42
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.33
PRK11054684 helD DNA helicase IV; Provisional 95.32
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.31
PRK08727233 hypothetical protein; Validated 95.26
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.18
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.12
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 95.12
PRK00149450 dnaA chromosomal replication initiation protein; R 95.11
PRK05642234 DNA replication initiation factor; Validated 95.01
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.0
PRK09183259 transposase/IS protein; Provisional 94.99
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.96
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.9
PRK08116268 hypothetical protein; Validated 94.87
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.81
KOG0989|consensus346 94.55
PTZ001121164 origin recognition complex 1 protein; Provisional 94.51
PRK06893229 DNA replication initiation factor; Validated 94.42
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.38
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 94.37
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 94.33
PRK08084235 DNA replication initiation factor; Provisional 94.32
PRK12422445 chromosomal replication initiation protein; Provis 94.29
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.2
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.19
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.12
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.1
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.05
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.0
KOG0331|consensus519 93.98
PRK14088440 dnaA chromosomal replication initiation protein; P 93.94
PRK08939306 primosomal protein DnaI; Reviewed 93.8
PRK11823446 DNA repair protein RadA; Provisional 93.77
COG3973747 Superfamily I DNA and RNA helicases [General funct 93.77
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.68
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.68
KOG0339|consensus731 93.68
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 93.68
PRK14087450 dnaA chromosomal replication initiation protein; P 93.61
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.48
CHL00095 821 clpC Clp protease ATP binding subunit 93.36
PRK10865 857 protein disaggregation chaperone; Provisional 93.33
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 93.32
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.3
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 93.29
PHA03333 752 putative ATPase subunit of terminase; Provisional 93.29
PRK13833323 conjugal transfer protein TrbB; Provisional 93.23
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.22
KOG0701|consensus 1606 93.13
PRK14086617 dnaA chromosomal replication initiation protein; P 93.12
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.11
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.11
PHA02533534 17 large terminase protein; Provisional 93.09
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.09
PRK05707328 DNA polymerase III subunit delta'; Validated 93.05
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.0
COG0470325 HolB ATPase involved in DNA replication [DNA repli 92.99
PHA02544316 44 clamp loader, small subunit; Provisional 92.98
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 92.82
COG2256436 MGS1 ATPase related to the helicase subunit of the 92.74
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 92.63
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 92.57
PRK12402337 replication factor C small subunit 2; Reviewed 92.52
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 92.52
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 92.49
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.41
KOG0744|consensus423 92.39
PRK08769319 DNA polymerase III subunit delta'; Validated 92.38
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.2
COG2255332 RuvB Holliday junction resolvasome, helicase subun 92.18
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 92.18
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 92.15
KOG0330|consensus476 92.14
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 92.08
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.06
PLN03025319 replication factor C subunit; Provisional 92.02
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 91.88
KOG1133|consensus821 91.88
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.85
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 91.77
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 91.69
KOG0991|consensus333 91.64
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 91.57
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.56
KOG0741|consensus744 91.32
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.27
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 91.19
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 91.19
KOG0734|consensus752 91.1
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 90.97
PRK07940394 DNA polymerase III subunit delta'; Validated 90.96
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 90.96
KOG0336|consensus629 90.95
PTZ00293211 thymidine kinase; Provisional 90.94
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 90.87
TIGR02928365 orc1/cdc6 family replication initiation protein. M 90.85
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 90.78
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 90.75
KOG0342|consensus543 90.74
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 90.71
PRK06904472 replicative DNA helicase; Validated 90.71
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 90.7
PRK09112351 DNA polymerase III subunit delta'; Validated 90.67
PHA03368738 DNA packaging terminase subunit 1; Provisional 90.65
TIGR02012321 tigrfam_recA protein RecA. This model describes or 90.59
KOG0328|consensus400 90.59
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 90.57
PRK14974336 cell division protein FtsY; Provisional 90.52
PRK13851344 type IV secretion system protein VirB11; Provision 90.43
KOG0341|consensus610 90.31
TIGR00665434 DnaB replicative DNA helicase. This model describe 90.13
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 90.11
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 90.1
PRK06067234 flagellar accessory protein FlaH; Validated 90.08
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 90.06
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 90.04
PRK13342413 recombination factor protein RarA; Reviewed 90.02
PRK13897606 type IV secretion system component VirD4; Provisio 90.0
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 89.92
KOG0338|consensus691 89.83
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 89.8
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 89.77
PRK05748448 replicative DNA helicase; Provisional 89.71
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 89.56
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 89.46
KOG1807|consensus 1025 89.46
PRK08506472 replicative DNA helicase; Provisional 89.31
PRK06964342 DNA polymerase III subunit delta'; Validated 89.29
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 89.23
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 89.22
PRK04195482 replication factor C large subunit; Provisional 89.17
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 89.16
PRK09354349 recA recombinase A; Provisional 89.09
PRK07004460 replicative DNA helicase; Provisional 89.02
PRK06871325 DNA polymerase III subunit delta'; Validated 88.99
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 88.78
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 88.75
PRK05973237 replicative DNA helicase; Provisional 88.72
cd01128249 rho_factor Transcription termination factor rho is 88.41
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 88.41
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 88.39
PRK08840464 replicative DNA helicase; Provisional 88.38
PRK07993334 DNA polymerase III subunit delta'; Validated 88.34
COG0593408 DnaA ATPase involved in DNA replication initiation 88.23
KOG0058|consensus716 88.18
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 88.04
KOG0739|consensus439 88.04
KOG2228|consensus408 87.96
PRK102631355 DNA translocase FtsK; Provisional 87.87
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 87.86
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 87.86
KOG0730|consensus693 87.73
PRK06090319 DNA polymerase III subunit delta'; Validated 87.73
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 87.51
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 87.4
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 87.2
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 87.18
PRK13850670 type IV secretion system protein VirD4; Provisiona 87.16
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 87.14
TIGR02688449 conserved hypothetical protein TIGR02688. Members 87.13
PRK13341 725 recombination factor protein RarA/unknown domain f 87.06
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 86.98
PRK13880636 conjugal transfer coupling protein TraG; Provision 86.91
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 86.9
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 86.88
PRK07471365 DNA polymerase III subunit delta'; Validated 86.81
PRK106891147 transcription-repair coupling factor; Provisional 86.79
PRK08760476 replicative DNA helicase; Provisional 86.77
PRK08006471 replicative DNA helicase; Provisional 86.74
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 86.58
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 86.52
TIGR00767415 rho transcription termination factor Rho. Members 86.43
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 86.4
PRK09376416 rho transcription termination factor Rho; Provisio 86.32
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 86.28
PRK07399314 DNA polymerase III subunit delta'; Validated 86.26
PRK05595444 replicative DNA helicase; Provisional 86.23
PRK10436462 hypothetical protein; Provisional 86.09
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 86.08
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 85.96
KOG0326|consensus459 85.96
KOG2004|consensus906 85.95
PRK00440319 rfc replication factor C small subunit; Reviewed 85.89
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 85.62
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 85.49
COG11971139 Mfd Transcription-repair coupling factor (superfam 85.44
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 85.34
COG4178604 ABC-type uncharacterized transport system, permeas 85.29
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 85.2
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 85.17
TIGR00064272 ftsY signal recognition particle-docking protein F 85.08
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 85.0
PRK13876663 conjugal transfer coupling protein TraG; Provision 84.99
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 84.97
COG3972660 Superfamily I DNA and RNA helicases [General funct 84.93
TIGR02533486 type_II_gspE general secretory pathway protein E. 84.86
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 84.85
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 84.8
PF1355562 AAA_29: P-loop containing region of AAA domain 84.78
PF12846304 AAA_10: AAA-like domain 84.71
KOG0733|consensus802 84.69
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 84.67
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 84.67
KOG0651|consensus388 84.66
PHA03372668 DNA packaging terminase subunit 1; Provisional 84.65
PRK09165497 replicative DNA helicase; Provisional 84.54
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 84.53
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 84.46
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 84.04
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 83.93
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 83.88
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 83.8
TIGR00763775 lon ATP-dependent protease La. This protein is ind 83.61
KOG0333|consensus673 83.58
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 83.37
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 83.19
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 82.85
PRK14873 665 primosome assembly protein PriA; Provisional 82.74
KOG0745|consensus564 82.7
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 82.65
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 82.64
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.5
KOG2028|consensus554 82.49
COG4626546 Phage terminase-like protein, large subunit [Gener 82.45
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 82.2
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 82.18
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 82.12
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 82.08
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 82.07
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 82.04
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 81.98
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 81.95
PRK13822641 conjugal transfer coupling protein TraG; Provision 81.91
PRK00771437 signal recognition particle protein Srp54; Provisi 81.9
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 81.84
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 81.72
PRK05636505 replicative DNA helicase; Provisional 81.64
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 81.61
KOG0732|consensus 1080 81.38
PHA00350399 putative assembly protein 81.36
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 81.32
PRK05580 679 primosome assembly protein PriA; Validated 81.23
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 80.95
PRK08533230 flagellar accessory protein FlaH; Reviewed 80.87
KOG0348|consensus 708 80.8
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 80.72
KOG0343|consensus 758 80.64
PRK10416318 signal recognition particle-docking protein FtsY; 80.6
PRK06321472 replicative DNA helicase; Provisional 80.51
PRK04328249 hypothetical protein; Provisional 80.47
PF00004132 AAA: ATPase family associated with various cellula 80.44
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 80.44
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 80.35
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 80.15
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 80.03
>KOG0331|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-57  Score=456.73  Aligned_cols=385  Identities=48%  Similarity=0.702  Sum_probs=319.2

Q ss_pred             CcceeeehhhhhhcccccCCCCCCChhhhhhhhccccCCcEEEEccCCCccccccccccchhccccccCCCCCccccccc
Q psy10680         23 YINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKEESSW  102 (537)
Q Consensus        23 ~~~~~~~~~~~~~~l~~~~g~~~~~~~Q~~ai~~~~~~~~vli~apTGsGKT~~~~~~~~~~~~~~~~~~~~~~~~~~~~  102 (537)
                      .+....++..+.+.| +..||..|||+|...||.+++|+|++..|.||||||++                          
T Consensus        92 ~f~~~~ls~~~~~~l-k~~g~~~PtpIQaq~wp~~l~GrD~v~iA~TGSGKTLa--------------------------  144 (519)
T KOG0331|consen   92 AFQELGLSEELMKAL-KEQGFEKPTPIQAQGWPIALSGRDLVGIARTGSGKTLA--------------------------  144 (519)
T ss_pred             hhhcccccHHHHHHH-HhcCCCCCchhhhcccceeccCCceEEEeccCCcchhh--------------------------
Confidence            566777888888888 56999999999999999999999999999999999999                          


Q ss_pred             ccCccccccchhhHhHhhhc-CCCCCCCCCceEEEEcccHHHHHHHHHHHHHhcccceeeEEEEEcCcchhHhHHHhccC
Q psy10680        103 WNNNVVDVKYILPALYHILK-MPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDLCRG  181 (537)
Q Consensus       103 ~~~~~~~~~~~l~~l~~~~~-~~~~~~~~~~~~lil~Pt~~L~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  181 (537)
                               |++|++.++.. ......+.+|++|||+|||+|+.|+.+.+..+...++++..+++||.+...|...+.++
T Consensus       145 ---------y~lP~i~~l~~~~~~~~~~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~~~~~cvyGG~~~~~Q~~~l~~g  215 (519)
T KOG0331|consen  145 ---------YLLPAIVHLNNEQGKLSRGDGPIVLVLAPTRELAVQVQAEAREFGKSLRLRSTCVYGGAPKGPQLRDLERG  215 (519)
T ss_pred             ---------hhhHHHHHHHhccccccCCCCCeEEEEcCcHHHHHHHHHHHHHHcCCCCccEEEEeCCCCccHHHHHHhcC
Confidence                     88889888887 55666677999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEeCCchhHHHHhcCcccccceeEEEecchhhhhhCCChHHHHHHHhhccccccccCCceeecC-chhHHHHhhhCC
Q psy10680        182 AEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRTRDLCRGAEIVVAT-PGRLIDFLESGT  260 (537)
Q Consensus       182 ~~Ivv~Tp~~l~~~l~~~~~~~~~l~liV~DE~h~~~~~~~~~~l~~il~~~~~~~~~~~~~~~saT-p~~~~~~l~~~~  260 (537)
                      .+|+|+||+++..+++.+...++++.++|+||||+|++++|.++++.|+..++....  +..++||| |.++..+.....
T Consensus       216 vdiviaTPGRl~d~le~g~~~l~~v~ylVLDEADrMldmGFe~qI~~Il~~i~~~~r--Qtlm~saTwp~~v~~lA~~fl  293 (519)
T KOG0331|consen  216 VDVVIATPGRLIDLLEEGSLNLSRVTYLVLDEADRMLDMGFEPQIRKILSQIPRPDR--QTLMFSATWPKEVRQLAEDFL  293 (519)
T ss_pred             CcEEEeCChHHHHHHHcCCccccceeEEEeccHHhhhccccHHHHHHHHHhcCCCcc--cEEEEeeeccHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999944221  44499999 877766555422


Q ss_pred             cccccceeeeccchhhhhcCCChHHHHHHHHhhhcCCCcccceeehhhhHHHHHHHHhhccccccceeeeecchhhhhhc
Q psy10680        261 TNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSLFISERRDTILHFLESGTTNVNRITYLVLDEADRMLD  340 (537)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  340 (537)
                      .  +.......... .......-.++......              ..+...+...+.                      
T Consensus       294 ~--~~~~i~ig~~~-~~~a~~~i~qive~~~~--------------~~K~~~l~~lL~----------------------  334 (519)
T KOG0331|consen  294 N--NPIQINVGNKK-ELKANHNIRQIVEVCDE--------------TAKLRKLGKLLE----------------------  334 (519)
T ss_pred             c--CceEEEecchh-hhhhhcchhhhhhhcCH--------------HHHHHHHHHHHH----------------------
Confidence            2  22222211111 00000000011111100              122222222221                      


Q ss_pred             CCChhHHHHHhhhccccceeechhhHHHHHHhHhCceeEEEEeeccCccccccccccccccccccccCCCCHHHHHHHHH
Q psy10680        341 MGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGIHGDKSQWNRDQTLR  420 (537)
Q Consensus       341 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~if~~~~~~~~~l~~~~l~~~~~~~~~~~~~~~~~~r~~~~~  420 (537)
                                                 ... ...+.+.||||+++..++++ +..+...++++..+||+.++.+|..+++
T Consensus       335 ---------------------------~~~-~~~~~KvIIFc~tkr~~~~l-~~~l~~~~~~a~~iHGd~sQ~eR~~~L~  385 (519)
T KOG0331|consen  335 ---------------------------DIS-SDSEGKVIIFCETKRTCDEL-ARNLRRKGWPAVAIHGDKSQSERDWVLK  385 (519)
T ss_pred             ---------------------------HHh-ccCCCcEEEEecchhhHHHH-HHHHHhcCcceeeecccccHHHHHHHHH
Confidence                                       011 22345677999999999999 9999999999999999999999999999


Q ss_pred             HHhcCCCcEEEEecccccCCCcCCccEEEEecCCCChhhhHhhhhcccCCCCCceeEEEecCCCcchHHHHHHHHHHccc
Q psy10680        421 DFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTPLNGNKAQDLIDILNEAHQ  500 (537)
Q Consensus       421 ~f~~g~~~iLvaT~~l~~Gidi~~~~~Vi~~d~p~s~~~~~Q~~GRagR~~~~g~~~~l~~~~~~~~~~~~~~~l~~~~~  500 (537)
                      .|++|+..|||||+++++|+|+|++++||+||+|.+..+|+||+||+||+|+.|.++.|+...+......+.+.+++.++
T Consensus       386 ~FreG~~~vLVATdVAaRGLDi~dV~lVInydfP~~vEdYVHRiGRTGRa~~~G~A~tfft~~~~~~a~~l~~~l~e~~q  465 (519)
T KOG0331|consen  386 GFREGKSPVLVATDVAARGLDVPDVDLVINYDFPNNVEDYVHRIGRTGRAGKKGTAITFFTSDNAKLARELIKVLREAGQ  465 (519)
T ss_pred             hcccCCcceEEEcccccccCCCccccEEEeCCCCCCHHHHHhhcCccccCCCCceEEEEEeHHHHHHHHHHHHHHHHccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccHHHHHHHhcC
Q psy10680        501 FVPDRLLLLAAKN  513 (537)
Q Consensus       501 ~~~~~l~~~~~~~  513 (537)
                      .+|+.|.+++...
T Consensus       466 ~v~~~l~~~~~~~  478 (519)
T KOG0331|consen  466 TVPPDLLEYARVS  478 (519)
T ss_pred             CCChHHHHHHhhc
Confidence            9999999885443

>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 7e-54
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-20
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 4e-12
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 8e-54
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 1e-20
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-12
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 8e-41
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 6e-34
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 3e-13
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-06
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-33
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 2e-30
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 9e-30
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 8e-15
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 5e-08
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 9e-27
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-10
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-26
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 1e-10
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-25
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 4e-09
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-25
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-25
2jgn_A185 Ddx3 Helicase Domain Length = 185 1e-23
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 7e-23
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 7e-23
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 7e-23
2hyi_C413 Structure Of The Human Exon Junction Complex With A 7e-23
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 9e-23
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-22
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-22
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-21
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-21
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 1e-21
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-21
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-21
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-20
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-20
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-20
3ly5_A262 Ddx18 Dead-Domain Length = 262 2e-20
3ly5_A262 Ddx18 Dead-Domain Length = 262 3e-07
2vso_A395 Crystal Structure Of A Translation Initiation Compl 4e-19
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-18
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 7e-19
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 8e-06
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 9e-19
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 9e-06
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-18
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-18
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 5e-05
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 4e-18
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-17
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-17
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 6e-16
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 2e-15
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 2e-04
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 7e-15
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 1e-14
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 8e-14
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-13
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-13
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 6e-13
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 7e-13
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 9e-13
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-12
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-12
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 4e-12
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 6e-12
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 3e-11
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 5e-11
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-10
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-10
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-10
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 1e-10
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 5e-10
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 2e-04
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 2e-09
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-09
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-09
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 4e-09
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 6e-09
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 4e-08
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-04
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 2e-04
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 8e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure 
Iteration: 1

 Score =  208 bits (529), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 105/192 (54%), Positives = 123/192 (64%), Gaps = 35/192 (18%)
Query: 43  YGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKEESSW 102
           + +PT+IQAQ WP+ LSG D++G+AQTGSGKTLS                          
Sbjct: 63  FTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLS-------------------------- 96
Query: 103 WNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRH 162
                    Y+LPA+ HI   P LE GDGPI LVLAPTRELAQQ+Q V + + R  R++ 
Sbjct: 97  ---------YLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKS 147
Query: 163 ACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGF 222
            C+YGG  K  Q RDL RG EI +ATPGRLIDFLE G TN+ R TYLVLDEADRMLDMGF
Sbjct: 148 TCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGF 207
Query: 223 EPQIRKIIQMTR 234
           EPQIRKI+   R
Sbjct: 208 EPQIRKIVDQIR 219
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-97
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 6e-94
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-50
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 3e-92
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-88
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-53
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 5e-88
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-33
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 2e-19
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-83
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-78
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 8e-78
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 7e-76
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 2e-27
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-72
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 4e-59
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 6e-56
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 7e-55
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 4e-11
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-54
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-19
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-10
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-54
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-41
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-53
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 7e-04
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-53
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-51
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 7e-49
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 6e-48
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 9e-48
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-33
3bor_A237 Human initiation factor 4A-II; translation initiat 3e-47
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 3e-47
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-34
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-09
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-46
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 6e-34
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 7e-46
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-35
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 7e-46
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 9e-34
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 4e-09
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 8e-44
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-07
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-42
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-06
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-39
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-31
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-06
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-39
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-31
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-15
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 8e-07
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-39
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 3e-37
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 4e-30
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 4e-37
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 2e-36
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-36
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-30
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 3e-36
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-35
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 5e-31
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-30
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-30
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 7e-28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 4e-08
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-05
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 7e-08
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 8e-08
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-05
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-07
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 9e-07
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-07
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 3e-07
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-05
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-06
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 5e-06
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-05
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
 Score =  294 bits (755), Expect = 2e-97
 Identities = 105/196 (53%), Positives = 123/196 (62%), Gaps = 35/196 (17%)

Query: 39  KNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKE 98
               + +PT+IQAQ WP+ LSG D++G+AQTGSGKTLS                      
Sbjct: 45  ARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLS---------------------- 82

Query: 99  ESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTM 158
                        Y+LPA+ HI   P LE GDGPI LVLAPTRELAQQ+Q V + + R  
Sbjct: 83  -------------YLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRAC 129

Query: 159 RIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRML 218
           R++  C+YGG  K  Q RDL RG EI +ATPGRLIDFLE G TN+ R TYLVLDEADRML
Sbjct: 130 RLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRML 189

Query: 219 DMGFEPQIRKIIQMTR 234
           DMGFEPQIRKI+   R
Sbjct: 190 DMGFEPQIRKIVDQIR 205
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.98
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.98
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
3h1t_A590 Type I site-specific restriction-modification syst 99.97
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.97
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.97
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.96
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.96
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.96
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.96
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.96
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.95
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.95
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.95
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.95
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.95
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.95
3bor_A237 Human initiation factor 4A-II; translation initiat 99.95
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.95
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.95
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.95
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.95
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.95
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.94
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.94
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.94
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.89
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.87
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.87
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.85
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.85
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.85
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.84
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.84
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.84
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.84
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.84
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.8
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.67
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.78
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.74
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.72
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.69
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.54
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.52
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.17
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.41
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.11
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.05
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.0
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.94
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.89
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.73
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.49
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.34
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.34
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.18
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 95.92
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.84
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.71
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.5
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.46
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.45
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.38
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 95.17
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 94.81
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.69
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.63
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.33
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.31
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.17
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 93.81
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.65
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.64
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.57
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.47
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.28
3bos_A242 Putative DNA replication factor; P-loop containing 92.7
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 92.55
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 92.04
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.74
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 91.53
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 90.92
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.3
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 90.22
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 90.14
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.94
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 88.49
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 88.3
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 88.07
2gno_A305 DNA polymerase III, gamma subunit-related protein; 87.48
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 87.46
3co5_A143 Putative two-component system transcriptional RES 86.61
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 86.36
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 85.91
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 85.5
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 85.4
2z43_A324 DNA repair and recombination protein RADA; archaea 85.38
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 85.28
3io5_A333 Recombination and repair protein; storage dimer, i 84.97
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 84.53
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 84.03
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 83.45
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 83.41
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 83.37
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 82.95
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 81.9
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 81.75
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 81.28
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 80.52
2qgz_A308 Helicase loader, putative primosome component; str 80.51
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 80.07
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.6e-52  Score=434.82  Aligned_cols=379  Identities=36%  Similarity=0.527  Sum_probs=303.5

Q ss_pred             ecccceecCCcceeeehhhhhhcccccCCCCCCChhhhhhhhccccCCcEEEEccCCCccccccccccchhccccccCCC
Q psy10680         14 ARLPYFRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRS   93 (537)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~g~~~~~~~Q~~ai~~~~~~~~vli~apTGsGKT~~~~~~~~~~~~~~~~~~~   93 (537)
                      ...+..+-..|+.+.+++.+.++|. ..||..||++|.++|+.+++|++++++||||||||++                 
T Consensus        48 ~~~~p~~~~~f~~~~l~~~l~~~l~-~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a-----------------  109 (434)
T 2db3_A           48 GSDVPQPIQHFTSADLRDIIIDNVN-KSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAA-----------------  109 (434)
T ss_dssp             SSSCCCCCCCGGGSCCCHHHHHHHH-HTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHH-----------------
T ss_pred             CCCCCCCcCChhhcCCCHHHHHHHH-HcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHH-----------------
Confidence            3333345667899999999999995 6999999999999999999999999999999999999                 


Q ss_pred             CCcccccccccCccccccchhhHhHhhhcCCCCCCCCCceEEEEcccHHHHHHHHHHHHHhcccceeeEEEEEcCcchhH
Q psy10680         94 NTSKEESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMY  173 (537)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~lil~Pt~~L~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (537)
                                        |++|++..+..........++++||++||++|+.|+++.++.+....++++..++|+.....
T Consensus       110 ------------------~~lpil~~l~~~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~  171 (434)
T 2db3_A          110 ------------------FLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRH  171 (434)
T ss_dssp             ------------------HHHHHHHHHHHSCCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHH
T ss_pred             ------------------HHHHHHHHHHhcccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHH
Confidence                              88888888876654334457889999999999999999999998888899999999999888


Q ss_pred             hHHHhccCCcEEEeCCchhHHHHhcCcccccceeEEEecchhhhhhCCChHHHHHHHhhcc---ccccccCCceeecC-c
Q psy10680        174 QTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTR---TRDLCRGAEIVVAT-P  249 (537)
Q Consensus       174 ~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~~~~l~liV~DE~h~~~~~~~~~~l~~il~~~~---~~~~~~~~~~~saT-p  249 (537)
                      +...+..+++|+|+||++|.+++.+....+.++++||+||||++.+++|...+..++..+.   .++..    ++||| |
T Consensus       172 ~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l----~~SAT~~  247 (434)
T 2db3_A          172 QNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTL----MFSATFP  247 (434)
T ss_dssp             HHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEE----EEESCCC
T ss_pred             HHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEE----EEeccCC
Confidence            8888888999999999999999998888899999999999999999999999999988753   24444    99999 5


Q ss_pred             hhHHHHhhhCCcccccceeeeccchhhhhcCCChHHHHHHHHhhhcCCCccccee---ehhhhHHHHHHHHhhccccccc
Q psy10680        250 GRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRHAHPVVPVSL---FISERRDTILHFLESGTTNVNR  326 (537)
Q Consensus       250 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~  326 (537)
                      ..+...........  . .........                   .........   ....+...+...+         
T Consensus       248 ~~~~~~~~~~l~~~--~-~i~~~~~~~-------------------~~~~i~~~~~~~~~~~k~~~l~~~l---------  296 (434)
T 2db3_A          248 EEIQRMAGEFLKNY--V-FVAIGIVGG-------------------ACSDVKQTIYEVNKYAKRSKLIEIL---------  296 (434)
T ss_dssp             HHHHHHHHTTCSSC--E-EEEESSTTC-------------------CCTTEEEEEEECCGGGHHHHHHHHH---------
T ss_pred             HHHHHHHHHhccCC--E-EEEeccccc-------------------cccccceEEEEeCcHHHHHHHHHHH---------
Confidence            55544443311110  0 000000000                   000000000   0000111111111         


Q ss_pred             eeeeecchhhhhhcCCChhHHHHHhhhccccceeechhhHHHHHHhHhCceeEEEEeeccCccccccccccccccccccc
Q psy10680        327 ITYLVLDEADRMLDMGFEPQIRKIIQMTRFNTCVFLGYVLYFWFILVAGIERWVFMEINHNGTETKHYGVSSSLYRAMGI  406 (537)
Q Consensus       327 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~if~~~~~~~~~l~~~~l~~~~~~~~~~  406 (537)
                                                                   .....+.+|||.+...+..+ ...|...++.+..+
T Consensus       297 ---------------------------------------------~~~~~~~lVF~~t~~~a~~l-~~~L~~~~~~~~~l  330 (434)
T 2db3_A          297 ---------------------------------------------SEQADGTIVFVETKRGADFL-ASFLSEKEFPTTSI  330 (434)
T ss_dssp             ---------------------------------------------HHCCTTEEEECSSHHHHHHH-HHHHHHTTCCEEEE
T ss_pred             ---------------------------------------------HhCCCCEEEEEeCcHHHHHH-HHHHHhCCCCEEEE
Confidence                                                         11122356999999999998 88888889999999


Q ss_pred             cCCCCHHHHHHHHHHHhcCCCcEEEEecccccCCCcCCccEEEEecCCCChhhhHhhhhcccCCCCCceeEEEecC-CCc
Q psy10680        407 HGDKSQWNRDQTLRDFRSGYINVLIASDVASRGLDVEDIKYVVNYDFPDNTENYVHRIGRTARSTKTGISYTLFTP-LNG  485 (537)
Q Consensus       407 ~~~~~~~~r~~~~~~f~~g~~~iLvaT~~l~~Gidi~~~~~Vi~~d~p~s~~~~~Q~~GRagR~~~~g~~~~l~~~-~~~  485 (537)
                      ||+++..+|..+++.|++|+.+|||||+++++|+|+|++++||+||+|.+..+|+||+||+||.|+.|.+++|+++ .+.
T Consensus       331 hg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~  410 (434)
T 2db3_A          331 HGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDR  410 (434)
T ss_dssp             STTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCG
T ss_pred             eCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999995 577


Q ss_pred             chHHHHHHHHHHccccccHHHHHH
Q psy10680        486 NKAQDLIDILNEAHQFVPDRLLLL  509 (537)
Q Consensus       486 ~~~~~~~~~l~~~~~~~~~~l~~~  509 (537)
                      ....++.+.+.+..+.+|++|.++
T Consensus       411 ~~~~~l~~~l~~~~~~vp~~l~~~  434 (434)
T 2db3_A          411 AIAADLVKILEGSGQTVPDFLRTC  434 (434)
T ss_dssp             GGHHHHHHHHHHTTCCCCGGGC--
T ss_pred             HHHHHHHHHHHHcCCCCCHHHHhC
Confidence            889999999999999999998653
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 537
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 9e-27
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-18
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-09
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-23
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-04
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-20
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-07
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 3e-20
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-20
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-08
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 0.002
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 4e-20
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 7e-05
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-04
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-18
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-05
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-18
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 6e-16
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-16
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-05
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-13
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 2e-12
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-12
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 5e-12
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 5e-12
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 0.002
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 6e-12
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-12
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-11
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 4e-11
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 7e-10
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 3e-09
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 5e-09
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 2e-08
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-06
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 2e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 6e-05
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  105 bits (263), Expect = 9e-27
 Identities = 60/199 (30%), Positives = 91/199 (45%), Gaps = 43/199 (21%)

Query: 39  KNSGYGKPTSIQAQSWPICLSGR-DLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSK 97
           +N G+ KPT IQ +  P+ L+   +++  A+TGSGK                        
Sbjct: 20  RNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGK------------------------ 55

Query: 98  EESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRT 157
                             A + I  +  + E +G  A++L PTRELA Q+   I      
Sbjct: 56  -----------------TASFAIPLIELVNENNGIEAIILTPTRELAIQVADEIESLKGN 98

Query: 158 MRIRHACLYGGTSKMYQTRDLCRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRM 217
             ++ A +YGG +   Q + L + A IVV TPGR++D +  GT N+  + Y +LDEAD M
Sbjct: 99  KNLKIAKIYGGKAIYPQIKAL-KNANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEM 157

Query: 218 LDMGFEPQIRKIIQMTRTR 236
           L+MGF   + KI+      
Sbjct: 158 LNMGFIKDVEKILNACNKD 176
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.97
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.97
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.97
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.97
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.97
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.95
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.94
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.89
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.89
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.89
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.88
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.87
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.87
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.86
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.86
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.85
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.85
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.82
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.82
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.71
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.71
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.7
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.68
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.66
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.66
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.66
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.64
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.56
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.55
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.55
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.54
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.54
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.53
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.25
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.13
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.05
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.01
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.96
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.37
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.35
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.29
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.78
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.27
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.23
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.9
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.61
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.06
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.88
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.54
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.35
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.35
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.33
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.1
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.02
d2qy9a2211 GTPase domain of the signal recognition particle r 94.07
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.71
d1vmaa2213 GTPase domain of the signal recognition particle r 93.6
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.55
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.52
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 93.2
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.51
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.5
d1okkd2207 GTPase domain of the signal recognition particle r 92.16
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 92.07
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.07
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 91.86
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.68
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 91.36
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.05
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 90.17
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.92
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.64
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 89.49
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 89.28
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 89.2
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 88.63
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.23
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 87.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 87.54
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 87.53
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 87.34
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 87.03
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 86.74
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.38
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.74
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 84.74
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 84.33
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 83.86
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 83.71
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 83.42
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 83.12
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 83.04
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 82.57
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.52
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 82.26
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.09
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 82.06
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 81.94
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 81.7
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 81.3
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 80.92
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.4e-33  Score=256.91  Aligned_cols=195  Identities=31%  Similarity=0.466  Sum_probs=173.6

Q ss_pred             eecCCcceeeehhhhhhcccccCCCCCCChhhhhhhhccccCCcEEEEccCCCccccccccccchhccccccCCCCCccc
Q psy10680         19 FRSGYINVLIASDVASRGLGKNSGYGKPTSIQAQSWPICLSGRDLIGIAQTGSGKTLSLTIENTQVARGSQCGRSNTSKE   98 (537)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~l~~~~g~~~~~~~Q~~ai~~~~~~~~vli~apTGsGKT~~~~~~~~~~~~~~~~~~~~~~~~   98 (537)
                      .+..+|+.+++++.+.++|. ..||..||++|..+||.+++|+|++++||||||||++                      
T Consensus        14 ~~~~sF~~l~L~~~l~~~L~-~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTla----------------------   70 (222)
T d2j0sa1          14 DVTPTFDTMGLREDLLRGIY-AYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTAT----------------------   70 (222)
T ss_dssp             CCCCSGGGGCCCHHHHHHHH-HHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHH----------------------
T ss_pred             CCCCCHHHCCCCHHHHHHHH-HCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhh----------------------
Confidence            35568999999999999995 6999999999999999999999999999999999999                      


Q ss_pred             ccccccCccccccchhhHhHhhhcCCCCCCCCCceEEEEcccHHHHHHHHHHHHHhcccceeeEEEEEcCcchhHhHHHh
Q psy10680         99 ESSWWNNNVVDVKYILPALYHILKMPKLEEGDGPIALVLAPTRELAQQIQAVISIFSRTMRIRHACLYGGTSKMYQTRDL  178 (537)
Q Consensus        99 ~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~lil~Pt~~L~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  178 (537)
                                   |++|+++.+....     .+++++|++||++|+.|+++.++.+....++++..++|+.....+...+
T Consensus        71 -------------yllPil~~l~~~~-----~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l  132 (222)
T d2j0sa1          71 -------------FSISVLQCLDIQV-----RETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKL  132 (222)
T ss_dssp             -------------HHHHHHHTCCTTS-----CSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHH
T ss_pred             -------------hcccccccccccc-----cCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHh
Confidence                         7777777765432     2677999999999999999999999988899999999999988888888


Q ss_pred             ccCCcEEEeCCchhHHHHhcCcccccceeEEEecchhhhhhCCChHHHHHHHhhccc-cccccCCceeecC-chhHHHHh
Q psy10680        179 CRGAEIVVATPGRLIDFLESGTTNVNRITYLVLDEADRMLDMGFEPQIRKIIQMTRT-RDLCRGAEIVVAT-PGRLIDFL  256 (537)
Q Consensus       179 ~~~~~Ivv~Tp~~l~~~l~~~~~~~~~l~liV~DE~h~~~~~~~~~~l~~il~~~~~-~~~~~~~~~~saT-p~~~~~~l  256 (537)
                      ..+++|+|+||+++.+++.+....+++++++|+||||.+++.+|...+..++..++. ++..    ++||| |..+.++.
T Consensus       133 ~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~i----lfSAT~~~~v~~l~  208 (222)
T d2j0sa1         133 DYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVV----LISATLPHEILEMT  208 (222)
T ss_dssp             HHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTSCTTCEEE----EEESCCCHHHHTTG
T ss_pred             ccCCeEEeCCCCcHHhcccccccccccceeeeecchhHhhhcCcHHHHHHHHHhCCCCCEEE----EEEEeCCHHHHHHH
Confidence            889999999999999999999999999999999999999999999999999999876 4444    99999 76665554


Q ss_pred             hh
Q psy10680        257 ES  258 (537)
Q Consensus       257 ~~  258 (537)
                      ..
T Consensus       209 ~~  210 (222)
T d2j0sa1         209 NK  210 (222)
T ss_dssp             GG
T ss_pred             HH
Confidence            44
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure