Psyllid ID: psy10683

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMTNQGVKGGGPKTAAPASAAAPGTPKAKGRPKKSLTKEKKNVDPSDHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
ccHHHHHHHHHHHcccccccccEEcccccccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEcccccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccccccEEEccHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHccccccccHHHHHHHHHHHcHHHHHHcHHHHHHcccccEEEEEEEcccHHHHHHHHHHc
cccHHHHHHHHHHcccccccEEEEcccccHHccccHHHHHHHHHHHHHHHHHcccccEEHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHcccccccccHHHccccHHHcccccccccccHHHccHHHHcccccccHHHcccHHHHHHHHHcccccccccEEEEEccccHHccccHHHHHHHHHHHHHHHHHccccEEEHHHcccHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccccccEEEEEEHHHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHc
MTEQEEDEELLANAntegktivsfenspfyikggemrdYQVRGLNWMISLYENGIngilademglgkTLQTIsllgpkidrfdYLLKQTEIFSHfmtnqgvkgggpktaapasaaapgtpkakgrpkksltkekknvdpsdhrhrmteqEEDEELLANAntegktivsfenspfyikggemrdYQVRGLNWMISLYENGIngilademglgktlQTISLLGYMKHYrniagphivivpKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMirdvmmpgewDVCITSYEMCIRergvfkkfnwRYLVIDEAHRIKNEKSKLSEIVREFKTTnrllltgtplqNNLHELWALLNFllpdifsssddfdswfnteefmgdhSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
MTEQEEDEELLanantegktivsfenspfyikgGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMTNQGVKGGGPKTAapasaaapgtpkakgrpkksltkekknvdpsdhrhrmteqeedEELLANantegktivsfenspfyikgGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEahrikneksklsEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKsevekrlkpkkelkvyvglskmqrewytkvc
MTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMTNQGVkgggpktaapasaaapgtpkakgrpkkSLTKEKKNVDPSDHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPdifsssddfdsWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
*******************TIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMTN******************************************************************TIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVE******KELKVYVGLSKMQREWY****
MTEQEED**************************GEMRDYQVRGLNWMISLYE*************************KIDRFDYLLKQTEIFS****************************************************************************ENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
**********LANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMTNQGV*****************************************************LLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
*****EDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMT****************************************************************EGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGPKIDRFDYLLKQTEIFSHFMTNQGVKGGGPKTAAPASAAAPGTPKAKGRPKKSLTKEKKNVDPSDHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query429 2.2.26 [Sep-21-2011]
Q24368 1027 Chromatin-remodeling comp yes N/A 0.769 0.321 0.75 1e-149
Q91ZW3 1051 SWI/SNF-related matrix-as yes N/A 0.792 0.323 0.689 1e-147
O60264 1052 SWI/SNF-related matrix-as yes N/A 0.792 0.323 0.686 1e-147
P28370 1054 Probable global transcrip no N/A 0.780 0.317 0.68 1e-141
Q6PGB8 1046 Probable global transcrip no N/A 0.801 0.328 0.662 1e-140
P41877 1009 Chromatin-remodeling comp yes N/A 0.773 0.329 0.649 1e-132
P38144 1129 ISWI chromatin-remodeling yes N/A 0.778 0.295 0.501 4e-98
Q08773 1120 ISWI chromatin-remodeling no N/A 0.780 0.299 0.522 6e-97
Q7G8Y3 1107 Probable chromatin-remode no N/A 0.736 0.285 0.504 7e-96
Q8RWY3 1055 Putative chromatin-remode yes N/A 0.738 0.300 0.507 1e-95
>sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 Back     alignment and function desciption
 Score =  527 bits (1357), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/348 (75%), Positives = 295/348 (84%), Gaps = 18/348 (5%)

Query: 81  RFDYLLKQTEIFSHFMTNQGVKGGGPKTAAPASAAAPGTPKAKGRPKKSLTKEKKNVDPS 140
           RFD+LLKQTEIF+HFMTN              SA +P  PK  GRPKK   K+K+    +
Sbjct: 46  RFDFLLKQTEIFTHFMTN--------------SAKSPTKPK--GRPKKIKDKDKEKD-VA 88

Query: 141 DHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGI 200
           DHRHR TEQEE +E L   ++  K I  F+ SP YIK GEMRDYQ+RGLNWMISLYENGI
Sbjct: 89  DHRHRKTEQEE-DEELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGI 147

Query: 201 NGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAIC 260
           NGILADEMGLGKTLQTISLLGY+KH++N AGPHIVIVPKSTL NW+NEFKKWCP+LRA+C
Sbjct: 148 NGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVC 207

Query: 261 LIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSK 320
           LIGDQD RN  IRDV+MPGEWDVC+TSYEMCIRE+ VFKKFNWRYLVIDEAHRIKNEKSK
Sbjct: 208 LIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSK 267

Query: 321 LSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHS 380
           LSEI+REFKT NRLL+TGTPLQNNLHELWALLNFLLPD+F+SS+DFD WFNT   +GD +
Sbjct: 268 LSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDA 327

Query: 381 IIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKV 428
           +I RLH+VLKPFLLRRLK+EVEKRLKPKKE+K++VGLSKMQR+WYTKV
Sbjct: 328 LITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKV 375
Energy-transducing component of the chromatin-remodeling complexes NURF (nucleosome-remodeling factor), ACF (ATP-utilizing chromatin assembly and remodeling factor), and CHRAC (chromatin accessibility complex). NURF catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. It is required for homeotic gene expression, proper larval blood cell development, normal male X chromosome morphology, ecdysteroid signaling and metamorphosis.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 Back     alignment and function description
>sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 Back     alignment and function description
>sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 Back     alignment and function description
>sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 Back     alignment and function description
>sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 Back     alignment and function description
>sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 Back     alignment and function description
>sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 Back     alignment and function description
>sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 Back     alignment and function description
>sp|Q8RWY3|ISW2_ARATH Putative chromatin-remodeling complex ATPase chain OS=Arabidopsis thaliana GN=At3g06400 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
307191525 1010 Chromatin-remodeling complex ATPase chai 0.780 0.331 0.768 1e-159
332021363 1007 Chromatin-remodeling complex ATPase chai 0.776 0.330 0.768 1e-158
383866448 1009 PREDICTED: chromatin-remodeling complex 0.778 0.331 0.774 1e-158
307211542 1008 Chromatin-remodeling complex ATPase chai 0.776 0.330 0.771 1e-158
322787688 1008 hypothetical protein SINV_08345 [Solenop 0.783 0.333 0.770 1e-158
328785433 959 PREDICTED: chromatin-remodeling complex 0.778 0.348 0.765 1e-158
380022776 959 PREDICTED: chromatin-remodeling complex 0.778 0.348 0.765 1e-157
350403453 959 PREDICTED: chromatin-remodeling complex 0.778 0.348 0.765 1e-157
340728394 959 PREDICTED: LOW QUALITY PROTEIN: chromati 0.778 0.348 0.762 1e-157
118781335 1026 AGAP010700-PA [Anopheles gambiae str. PE 0.771 0.322 0.75 1e-156
>gi|307191525|gb|EFN75028.1| Chromatin-remodeling complex ATPase chain Iswi [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  568 bits (1464), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/350 (76%), Positives = 297/350 (84%), Gaps = 15/350 (4%)

Query: 81  RFDYLLKQTEIFSHFMTN-QGVKGGGP-KTAAPASAAAPGTPKAKGRPKKSLTKEKKNVD 138
           RFDYLLKQTEIFSHFMTN Q  K G P K  A             GRP+K   + +   D
Sbjct: 43  RFDYLLKQTEIFSHFMTNNQKDKAGSPLKIKA-------------GRPRKQQPENQPKAD 89

Query: 139 PSDHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYEN 198
             DHRHR TEQEEDEELLA +N        FE+SP YIK GE+RDYQ+RGLNWMISLYE+
Sbjct: 90  SGDHRHRKTEQEEDEELLAESNASVAPTTRFESSPHYIKSGELRDYQIRGLNWMISLYEH 149

Query: 199 GINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRA 258
           GINGILADEMGLGKTLQTISLLGYMKH+RNI GPHIVIVPKSTL NWMNEFKKWCP+LRA
Sbjct: 150 GINGILADEMGLGKTLQTISLLGYMKHFRNIPGPHIVIVPKSTLANWMNEFKKWCPSLRA 209

Query: 259 ICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEK 318
           +CLIGD + RN  IRDVMMPGEWDVC+TSYEM I+E+ VFKKFNWRY+VIDEAHRIKNEK
Sbjct: 210 VCLIGDAETRNTFIRDVMMPGEWDVCVTSYEMVIKEKSVFKKFNWRYMVIDEAHRIKNEK 269

Query: 319 SKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGD 378
           SKLSEI+REFKTTNRLLLTGTPLQNNLHELW+LLNFLLPD+F+SSDDFDSWFNT  F+GD
Sbjct: 270 SKLSEILREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSDDFDSWFNTNSFLGD 329

Query: 379 HSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKV 428
           +S++ERLH+VL+PFLLRRLKSEVEK LKPKKE+KVY+GLSKMQREWYTKV
Sbjct: 330 NSLVERLHAVLRPFLLRRLKSEVEKGLKPKKEIKVYIGLSKMQREWYTKV 379

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332021363|gb|EGI61737.1| Chromatin-remodeling complex ATPase chain Iswi [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383866448|ref|XP_003708682.1| PREDICTED: chromatin-remodeling complex ATPase chain Iswi-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307211542|gb|EFN87620.1| Chromatin-remodeling complex ATPase chain Iswi [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322787688|gb|EFZ13700.1| hypothetical protein SINV_08345 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328785433|ref|XP_396195.3| PREDICTED: chromatin-remodeling complex ATPase chain Iswi isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380022776|ref|XP_003695213.1| PREDICTED: chromatin-remodeling complex ATPase chain Iswi-like [Apis florea] Back     alignment and taxonomy information
>gi|350403453|ref|XP_003486806.1| PREDICTED: chromatin-remodeling complex ATPase chain Iswi-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728394|ref|XP_003402510.1| PREDICTED: LOW QUALITY PROTEIN: chromatin-remodeling complex ATPase chain Iswi-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|118781335|ref|XP_311417.3| AGAP010700-PA [Anopheles gambiae str. PEST] gi|116130122|gb|EAA07020.3| AGAP010700-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
FB|FBgn0011604 1027 Iswi "Imitation SWI" [Drosophi 0.689 0.288 0.785 1.1e-135
UNIPROTKB|E1C0M8 1038 SMARCA5 "Uncharacterized prote 0.689 0.285 0.740 2.1e-128
UNIPROTKB|F1P0A4469 SMARCA5 "Uncharacterized prote 0.689 0.631 0.740 2.1e-128
MGI|MGI:1935129 1051 Smarca5 "SWI/SNF related, matr 0.689 0.281 0.730 3e-127
ZFIN|ZDB-GENE-021125-1 1035 smarca5 "SWI/SNF related, matr 0.689 0.285 0.734 3.8e-127
UNIPROTKB|F1N052 1052 SMARCA5 "Uncharacterized prote 0.689 0.281 0.727 6.3e-127
UNIPROTKB|E2QWV0 1052 SMARCA5 "Uncharacterized prote 0.689 0.281 0.727 6.3e-127
UNIPROTKB|O60264 1052 SMARCA5 "SWI/SNF-related matri 0.689 0.281 0.727 6.3e-127
UNIPROTKB|F1RRG9 1052 SMARCA5 "Uncharacterized prote 0.689 0.281 0.727 6.3e-127
RGD|1308832 1051 Smarca5 "SWI/SNF related, matr 0.689 0.281 0.727 6.3e-127
FB|FBgn0011604 Iswi "Imitation SWI" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1261 (449.0 bits), Expect = 1.1e-135, Sum P(2) = 1.1e-135
 Identities = 234/298 (78%), Positives = 260/298 (87%)

Query:   132 KEK-KNVDPSDHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLN 190
             K+K K  D +DHRHR TEQEEDEELLA  ++  K I  F+ SP YIK GEMRDYQ+RGLN
Sbjct:    79 KDKDKEKDVADHRHRKTEQEEDEELLAE-DSATKEIFRFDASPAYIKSGEMRDYQIRGLN 137

Query:   191 WMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFK 250
             WMISLYENGINGILADEMGLGKTLQTISLLGY+KH++N AGPHIVIVPKSTL NW+NEFK
Sbjct:   138 WMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFK 197

Query:   251 KWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDE 310
             KWCP+LRA+CLIGDQD RN  IRDV+MPGEWDVC+TSYEMCIRE+ VFKKFNWRYLVIDE
Sbjct:   198 KWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDE 257

Query:   311 AHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPXXXXXXXXXXXWF 370
             AHRIKNEKSKLSEI+REFKT NRLL+TGTPLQNNLHELWALLNFLLP           WF
Sbjct:   258 AHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWF 317

Query:   371 NTEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKV 428
             NT   +GD ++I RLH+VLKPFLLRRLK+EVEKRLKPKKE+K++VGLSKMQR+WYTKV
Sbjct:   318 NTNTCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKV 375
GO:0006338 "chromatin remodeling" evidence=ISS;NAS;TAS
GO:0016589 "NURF complex" evidence=NAS;IDA;TAS
GO:0005524 "ATP binding" evidence=ISS
GO:0005634 "nucleus" evidence=IDA
GO:0008094 "DNA-dependent ATPase activity" evidence=IGI;IDA
GO:0000166 "nucleotide binding" evidence=TAS
GO:0016584 "nucleosome positioning" evidence=IDA
GO:0006334 "nucleosome assembly" evidence=IDA
GO:0016590 "ACF complex" evidence=NAS;IDA;TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP;IDA
GO:0008623 "CHRAC" evidence=NAS;IDA;TAS
GO:0006333 "chromatin assembly or disassembly" evidence=IDA;TAS
GO:0042766 "nucleosome mobilization" evidence=IDA;TAS
GO:0016887 "ATPase activity" evidence=NAS
GO:0035060 "brahma complex" evidence=IDA
GO:0003678 "DNA helicase activity" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0006351 "transcription, DNA-dependent" evidence=IDA
GO:0005667 "transcription factor complex" evidence=IPI
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=TAS
GO:0043044 "ATP-dependent chromatin remodeling" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0031491 "nucleosome binding" evidence=IEA
GO:0008134 "transcription factor binding" evidence=IPI
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0035076 "ecdysone receptor-mediated signaling pathway" evidence=IGI
GO:0007517 "muscle organ development" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0042752 "regulation of circadian rhythm" evidence=IMP
GO:0006325 "chromatin organization" evidence=IMP
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0031213 "RSF complex" evidence=IPI
GO:0005700 "polytene chromosome" evidence=IDA
GO:0070615 "nucleosome-dependent ATPase activity" evidence=IDA
GO:0035063 "nuclear speck organization" evidence=IMP
UNIPROTKB|E1C0M8 SMARCA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0A4 SMARCA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1935129 Smarca5 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021125-1 smarca5 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N052 SMARCA5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWV0 SMARCA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O60264 SMARCA5 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRG9 SMARCA5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1308832 Smarca5 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P38144ISW1_YEAST3, ., 6, ., 4, ., -0.50140.77850.2958yesN/A
Q8RWY3ISW2_ARATH3, ., 6, ., 4, ., -0.50720.73890.3004yesN/A
O60264SMCA5_HUMAN3, ., 6, ., 4, ., -0.68660.79250.3231yesN/A
P41877ISW1_CAEEL3, ., 6, ., 4, ., -0.64940.77380.3290yesN/A
Q91ZW3SMCA5_MOUSE3, ., 6, ., 4, ., -0.68940.79250.3235yesN/A
Q24368ISWI_DROME3, ., 6, ., 4, ., -0.750.76920.3213yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-145
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-116
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 9e-62
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-31
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-27
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-24
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-16
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 4e-11
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-05
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-05
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 8e-05
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily 9e-05
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information 
 Score =  438 bits (1129), Expect = e-145
 Identities = 182/347 (52%), Positives = 234/347 (67%), Gaps = 32/347 (9%)

Query: 81  RFDYLLKQTEIFSHFMTNQGVKGGGPKTAAPASAAAPGTPKAKGRPKKSLTKEKKNVDPS 140
           R  YLL+QTEIF+HF             A    +A+    K +GR               
Sbjct: 98  RLKYLLQQTEIFAHF-------------AKGDQSASAKKAKGRGR--------------- 129

Query: 141 DHRHRMTEQEEDEELLANAN--TEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYEN 198
            H  ++TE+EEDEE L        G         P  IKG +MRDYQ+ GLNW+I LYEN
Sbjct: 130 -HASKLTEEEEDEEYLKEEEDGLGGSGGTRLLVQPSCIKG-KMRDYQLAGLNWLIRLYEN 187

Query: 199 GINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRA 258
           GINGILADEMGLGKTLQTISLLGY+  YR I GPH+V+ PKSTL NWMNE +++CP LRA
Sbjct: 188 GINGILADEMGLGKTLQTISLLGYLHEYRGITGPHMVVAPKSTLGNWMNEIRRFCPVLRA 247

Query: 259 ICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEK 318
           +   G+ + R     ++++ G++DVC+TS+EM I+E+   K+F+WRY++IDEAHRIKNE 
Sbjct: 248 VKFHGNPEERAHQREELLVAGKFDVCVTSFEMAIKEKTALKRFSWRYIIIDEAHRIKNEN 307

Query: 319 SKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGD 378
           S LS+ +R F T  RLL+TGTPLQNNLHELWALLNFLLP+IFSS++ FD WF        
Sbjct: 308 SLLSKTMRLFSTNYRLLITGTPLQNNLHELWALLNFLLPEIFSSAETFDEWFQISGENDQ 367

Query: 379 HSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWY 425
             ++++LH VL+PFLLRRLKS+VEK L PKKE  + VG+S+MQ+++Y
Sbjct: 368 QEVVQQLHKVLRPFLLRRLKSDVEKGLPPKKETILKVGMSQMQKQYY 414

Length = 1033
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 429
KOG0385|consensus 971 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0388|consensus 1185 100.0
KOG0391|consensus 1958 100.0
KOG0387|consensus 923 100.0
KOG0389|consensus 941 100.0
KOG0384|consensus 1373 100.0
KOG0386|consensus 1157 100.0
KOG0392|consensus 1549 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
KOG0390|consensus 776 100.0
KOG1015|consensus 1567 100.0
KOG4439|consensus 901 100.0
KOG1002|consensus 791 100.0
KOG1016|consensus 1387 100.0
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1000|consensus 689 100.0
KOG0383|consensus 696 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
KOG0298|consensus 1394 99.98
KOG1001|consensus 674 99.97
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.91
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.79
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.78
PRK13766 773 Hef nuclease; Provisional 99.68
PHA02558 501 uvsW UvsW helicase; Provisional 99.68
smart00487201 DEXDc DEAD-like helicases superfamily. 99.64
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.62
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.62
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 99.57
COG4096 875 HsdR Type I site-specific restriction-modification 99.54
KOG1123|consensus 776 99.53
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.5
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.47
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.47
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.42
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.41
KOG0385|consensus 971 99.4
KOG0354|consensus 746 99.4
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.34
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.29
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.29
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.28
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.28
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.26
PTZ00424 401 helicase 45; Provisional 99.25
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.25
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.25
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.24
PRK02362 737 ski2-like helicase; Provisional 99.24
COG4889 1518 Predicted helicase [General function prediction on 99.22
PRK10689 1147 transcription-repair coupling factor; Provisional 99.22
PRK00254 720 ski2-like helicase; Provisional 99.21
KOG0384|consensus 1373 99.2
PRK01172 674 ski2-like helicase; Provisional 99.2
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 99.18
PRK09401 1176 reverse gyrase; Reviewed 99.16
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.16
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.16
KOG0388|consensus 1185 99.15
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.14
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.14
PTZ00110 545 helicase; Provisional 99.14
PRK13767 876 ATP-dependent helicase; Provisional 99.12
PRK05580 679 primosome assembly protein PriA; Validated 99.11
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.11
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.1
COG1204 766 Superfamily II helicase [General function predicti 99.09
KOG0387|consensus 923 99.06
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.04
COG1205 851 Distinct helicase family with a unique C-terminal 99.03
KOG0389|consensus 941 99.0
KOG0386|consensus 1157 99.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.97
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.96
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.91
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.89
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 98.85
COG0610 962 Type I site-specific restriction-modification syst 98.85
KOG0391|consensus 1958 98.84
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 98.83
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.79
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.78
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.77
PRK14701 1638 reverse gyrase; Provisional 98.76
PRK15483 986 type III restriction-modification system StyLTI en 98.76
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.75
PHA02653 675 RNA helicase NPH-II; Provisional 98.65
KOG0952|consensus 1230 98.62
KOG0350|consensus 620 98.6
PRK09694 878 helicase Cas3; Provisional 98.57
KOG0392|consensus 1549 98.54
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.51
KOG0331|consensus 519 98.49
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.48
KOG1002|consensus 791 98.48
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.4
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.4
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 98.4
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 98.39
KOG0353|consensus 695 98.38
KOG0330|consensus 476 98.36
KOG1015|consensus 1567 98.36
KOG0390|consensus 776 98.35
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.34
KOG0338|consensus 691 98.2
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.19
KOG0345|consensus 567 98.17
KOG0343|consensus 758 98.17
KOG1000|consensus689 98.15
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.14
COG1202 830 Superfamily II helicase, archaea-specific [General 98.13
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.13
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.1
KOG1016|consensus 1387 98.06
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.05
KOG0351|consensus 941 98.01
KOG0348|consensus 708 98.0
PRK09200 790 preprotein translocase subunit SecA; Reviewed 97.99
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.98
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.97
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.96
KOG0352|consensus 641 97.93
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 97.89
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.87
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.86
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.85
KOG0335|consensus 482 97.85
KOG4439|consensus 901 97.84
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.82
KOG0342|consensus 543 97.81
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.8
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.79
KOG0947|consensus 1248 97.77
KOG0383|consensus696 97.76
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 97.74
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 97.68
KOG0347|consensus 731 97.56
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 97.56
KOG0951|consensus 1674 97.54
KOG4284|consensus 980 97.51
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.5
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.43
KOG0328|consensus 400 97.43
PRK14873 665 primosome assembly protein PriA; Provisional 97.43
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 97.41
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.4
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 97.39
KOG0948|consensus 1041 97.38
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.37
KOG0340|consensus 442 97.36
PRK10536262 hypothetical protein; Provisional 97.35
KOG1513|consensus 1300 97.34
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.3
KOG0334|consensus 997 97.21
KOG0339|consensus 731 97.18
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.15
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 97.11
PRK12904 830 preprotein translocase subunit SecA; Reviewed 97.08
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.07
KOG1132|consensus 945 97.03
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.0
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.95
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.92
KOG1802|consensus 935 96.89
KOG1803|consensus 649 96.89
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.81
KOG0346|consensus 569 96.7
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 96.69
KOG0341|consensus 610 96.67
KOG0949|consensus 1330 96.66
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 96.63
KOG0922|consensus 674 96.6
KOG0337|consensus 529 96.6
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 96.58
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.41
KOG0336|consensus 629 96.4
PLN03025319 replication factor C subunit; Provisional 96.39
smart00382148 AAA ATPases associated with a variety of cellular 96.35
PRK10875 615 recD exonuclease V subunit alpha; Provisional 96.35
PRK04296190 thymidine kinase; Provisional 96.31
KOG0333|consensus 673 96.29
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.23
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.23
KOG0344|consensus 593 96.2
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.18
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.16
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 95.83
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.82
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 95.8
KOG0950|consensus 1008 95.77
PRK09112351 DNA polymerase III subunit delta'; Validated 95.77
KOG1805|consensus 1100 95.71
KOG0920|consensus 924 95.69
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 95.68
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 95.67
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.61
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.6
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 95.6
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.58
PRK04914 956 ATP-dependent helicase HepA; Validated 95.54
CHL00122 870 secA preprotein translocase subunit SecA; Validate 95.49
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.47
PRK05298 652 excinuclease ABC subunit B; Provisional 95.43
KOG0326|consensus 459 95.4
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.21
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 95.18
KOG0924|consensus 1042 95.18
KOG0989|consensus346 95.09
PF1324576 AAA_19: Part of AAA domain 95.08
PRK12402337 replication factor C small subunit 2; Reviewed 95.06
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.02
PRK08181269 transposase; Validated 95.01
CHL00181287 cbbX CbbX; Provisional 94.92
KOG0332|consensus 477 94.91
KOG0329|consensus387 94.89
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 94.88
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.81
KOG0327|consensus397 94.79
KOG0991|consensus333 94.79
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 94.78
KOG0925|consensus 699 94.76
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.73
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.68
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.67
PRK06835329 DNA replication protein DnaC; Validated 94.66
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.57
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.56
KOG0951|consensus 1674 94.5
PRK08084235 DNA replication initiation factor; Provisional 94.47
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.42
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.36
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 94.02
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 93.99
PRK06526254 transposase; Provisional 93.96
PF00004132 AAA: ATPase family associated with various cellula 93.95
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 93.89
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 93.88
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.88
PRK07471365 DNA polymerase III subunit delta'; Validated 93.87
PRK05707328 DNA polymerase III subunit delta'; Validated 93.86
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 93.85
KOG0926|consensus 1172 93.83
PRK08058329 DNA polymerase III subunit delta'; Validated 93.82
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 93.8
PRK14974336 cell division protein FtsY; Provisional 93.8
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 93.71
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 93.7
PTZ00112 1164 origin recognition complex 1 protein; Provisional 93.62
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 93.58
PRK07940 394 DNA polymerase III subunit delta'; Validated 93.55
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 93.47
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 93.45
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 93.34
PRK00440319 rfc replication factor C small subunit; Reviewed 93.31
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 93.3
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 93.25
PRK00149450 dnaA chromosomal replication initiation protein; R 93.24
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 93.19
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 93.18
PHA02533 534 17 large terminase protein; Provisional 93.16
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 93.08
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 93.07
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 93.07
PF13173128 AAA_14: AAA domain 93.06
KOG0923|consensus 902 93.01
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 92.81
PRK04195 482 replication factor C large subunit; Provisional 92.79
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.69
PHA02544316 44 clamp loader, small subunit; Provisional 92.68
TIGR00362405 DnaA chromosomal replication initiator protein Dna 92.61
PRK14087450 dnaA chromosomal replication initiation protein; P 92.61
PRK08116268 hypothetical protein; Validated 92.59
PRK14088440 dnaA chromosomal replication initiation protein; P 92.44
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.43
PRK07993334 DNA polymerase III subunit delta'; Validated 92.36
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 92.36
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.24
KOG1131|consensus 755 92.19
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 92.07
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 92.03
PRK05642234 DNA replication initiation factor; Validated 92.0
PRK06871325 DNA polymerase III subunit delta'; Validated 91.99
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 91.89
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 91.89
PRK08727233 hypothetical protein; Validated 91.84
PHA03368 738 DNA packaging terminase subunit 1; Provisional 91.78
PRK08769319 DNA polymerase III subunit delta'; Validated 91.78
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 91.75
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.7
PRK13889 988 conjugal transfer relaxase TraA; Provisional 91.59
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 91.5
PRK06893229 DNA replication initiation factor; Validated 91.44
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 91.34
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 91.25
PRK08903227 DnaA regulatory inactivator Hda; Validated 91.18
PRK06090319 DNA polymerase III subunit delta'; Validated 91.01
PRK13342 413 recombination factor protein RarA; Reviewed 90.83
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 90.83
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 90.79
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 90.78
PTZ00293211 thymidine kinase; Provisional 90.78
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 90.74
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 90.64
PRK11823 446 DNA repair protein RadA; Provisional 90.57
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 90.5
PRK00411 394 cdc6 cell division control protein 6; Reviewed 90.37
PRK13826 1102 Dtr system oriT relaxase; Provisional 90.31
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 89.96
COG0552340 FtsY Signal recognition particle GTPase [Intracell 89.92
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 89.85
COG2256 436 MGS1 ATPase related to the helicase subunit of the 89.79
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 89.78
KOG0740|consensus428 89.78
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 89.67
CHL00095 821 clpC Clp protease ATP binding subunit 89.6
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 89.48
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 89.45
PRK06904472 replicative DNA helicase; Validated 89.33
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.32
PHA03372 668 DNA packaging terminase subunit 1; Provisional 89.14
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 88.98
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 88.83
PRK00771 437 signal recognition particle protein Srp54; Provisi 88.63
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 88.62
COG0593408 DnaA ATPase involved in DNA replication initiation 88.62
PRK14086 617 dnaA chromosomal replication initiation protein; P 88.44
PRK09165497 replicative DNA helicase; Provisional 88.32
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 88.06
KOG0737|consensus386 88.04
cd03115173 SRP The signal recognition particle (SRP) mediates 87.98
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 87.98
COG0470325 HolB ATPase involved in DNA replication [DNA repli 87.75
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 87.56
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 87.55
PHA03333 752 putative ATPase subunit of terminase; Provisional 87.48
PRK12422445 chromosomal replication initiation protein; Provis 87.43
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 87.38
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.35
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 87.2
PRK09376416 rho transcription termination factor Rho; Provisio 87.18
cd01128249 rho_factor Transcription termination factor rho is 87.18
PRK08760476 replicative DNA helicase; Provisional 87.04
CHL00176 638 ftsH cell division protein; Validated 86.87
CHL00206 2281 ycf2 Ycf2; Provisional 86.84
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 86.8
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 86.69
COG4626 546 Phage terminase-like protein, large subunit [Gener 86.55
PRK11054 684 helD DNA helicase IV; Provisional 86.51
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 86.46
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 86.4
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 86.39
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 86.23
PRK10416318 signal recognition particle-docking protein FtsY; 86.18
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 86.17
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 86.0
PRK05748448 replicative DNA helicase; Provisional 85.86
PRK10865 857 protein disaggregation chaperone; Provisional 85.72
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 85.59
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 85.49
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 85.47
PRK03992389 proteasome-activating nucleotidase; Provisional 85.38
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 85.34
PRK08840464 replicative DNA helicase; Provisional 85.31
COG1484254 DnaC DNA replication protein [DNA replication, rec 85.31
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 85.2
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 85.09
PRK08506472 replicative DNA helicase; Provisional 85.07
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 85.07
KOG0952|consensus1230 85.05
KOG1001|consensus 674 84.93
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 84.92
PRK10867 433 signal recognition particle protein; Provisional 84.9
PRK13849231 putative crown gall tumor protein VirC1; Provision 84.9
PRK07952244 DNA replication protein DnaC; Validated 84.88
PRK07004460 replicative DNA helicase; Provisional 84.87
PRK04132846 replication factor C small subunit; Provisional 84.86
PRK13341 725 recombination factor protein RarA/unknown domain f 84.7
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 84.35
PHA00673154 acetyltransferase domain containing protein 84.35
TIGR00665434 DnaB replicative DNA helicase. This model describe 84.33
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 84.2
KOG0780|consensus 483 84.15
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 84.13
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 84.12
PRK09183259 transposase/IS protein; Provisional 84.08
PRK06964342 DNA polymerase III subunit delta'; Validated 83.88
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 83.52
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 83.41
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 83.33
TIGR00064272 ftsY signal recognition particle-docking protein F 83.24
PRK08533230 flagellar accessory protein FlaH; Reviewed 83.2
TIGR00767415 rho transcription termination factor Rho. Members 82.96
PRK13833323 conjugal transfer protein TrbB; Provisional 82.95
PRK07276290 DNA polymerase III subunit delta'; Validated 82.54
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 82.32
KOG0739|consensus439 82.26
PHA02542473 41 41 helicase; Provisional 82.11
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 82.08
TIGR00959 428 ffh signal recognition particle protein. This mode 82.05
KOG0733|consensus802 82.0
PRK08006471 replicative DNA helicase; Provisional 81.97
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 81.93
PRK05636505 replicative DNA helicase; Provisional 81.76
PRK06067234 flagellar accessory protein FlaH; Validated 81.13
COG3973 747 Superfamily I DNA and RNA helicases [General funct 81.11
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 81.1
PRK06321472 replicative DNA helicase; Provisional 81.03
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 81.0
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 80.98
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 80.87
PF04851184 ResIII: Type III restriction enzyme, res subunit; 80.87
PRK08699325 DNA polymerase III subunit delta'; Validated 80.77
PRK05595444 replicative DNA helicase; Provisional 80.52
PRK12608380 transcription termination factor Rho; Provisional 80.49
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 80.4
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 80.31
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 80.16
>KOG0385|consensus Back     alignment and domain information 
Probab=100.00  E-value=1e-69  Score=539.74  Aligned_cols=341  Identities=62%  Similarity=1.045  Sum_probs=301.4

Q ss_pred             CCcchhhhhhhhhcccccccccCCCCCCCCCCCCCccccCCCCCCcCCCCCcchhhhccCCCCcccccCCChhhhHHHHH
Q psy10683         77 PKIDRFDYLLKQTEIFSHFMTNQGVKGGGPKTAAPASAAAPGTPKAKGRPKKSLTKEKKNVDPSDHRHRMTEQEEDEELL  156 (429)
Q Consensus        77 ~~~~r~~~Ll~q~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (429)
                      ....++..|+.+++.+.+|+..+.........      .....   .++.++   ...+.......+++.++++++.+++
T Consensus        74 ~~~kr~e~Ll~~te~f~~f~~~~~~~~~~~~~------~~~~~---~~~k~~---~~~~~~~~~~~~~r~te~eed~e~~  141 (971)
T KOG0385|consen   74 DQAKRFEKLLKQTELFQHFIQPKAQKIDTKPL------MELLR---PRKKND---AKKKESSSGDVRHRKTEQEEDEELL  141 (971)
T ss_pred             HHHHHHHHHHHHHHHHHHHccchhhcCccccc------chhcc---chhhcc---chhccccccccccccccccchHHHH
Confidence            44677889999999999999876644322111      00000   010110   1223344556778888998888888


Q ss_pred             hcccc--CCCccccccCCCccccCCCChHHHHHHHHHHHHHHhcCCCeEeecCCCCCHHHHHHHHHHHHhhhcccCCCeE
Q psy10683        157 ANANT--EGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHI  234 (429)
Q Consensus       157 ~~~~~--~~~~~~~~~~~p~~~~~~~Lr~~Q~~~v~~l~~~~~~~~~~ilad~~GlGKT~~~i~~~~~l~~~~~~~~~~L  234 (429)
                      .....  .......+..+|.++.++.|||||++|++||+.+++++.+|||||+||+|||+|+|+++.++....+..||+|
T Consensus       142 ~~~~~e~~~~~~~~~~~sP~~v~~g~lr~YQveGlnWLi~l~engingILaDEMGLGKTlQtIs~l~yl~~~~~~~GPfL  221 (971)
T KOG0385|consen  142 KEEEKEEETTVQNRFEDSPSYVKGGELRDYQLEGLNWLISLYENGINGILADEMGLGKTLQTISLLGYLKGRKGIPGPFL  221 (971)
T ss_pred             HHhhhhhhhhhhccccCCchhhcCCccchhhhccHHHHHHHHhcCcccEeehhcccchHHHHHHHHHHHHHhcCCCCCeE
Confidence            75443  2333344566899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeccchHHHHHHHHHhhcCCCceEEEeCChhhHHHHHHhhcCCCCccEEEcchHHHHHHhhhhhccCceEEEecCcccc
Q psy10683        235 VIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRI  314 (429)
Q Consensus       235 IV~P~~ll~qW~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~dvvitty~~l~~~~~~l~~~~~~~vIiDEaH~~  314 (429)
                      ||||.|++.||.+||++|+|++++++|+|.+..|....++....+.|||+||||+++.++.+.|.+++|.++||||||++
T Consensus       222 Vi~P~StL~NW~~Ef~rf~P~l~~~~~~Gdk~eR~~~~r~~~~~~~fdV~iTsYEi~i~dk~~lk~~~W~ylvIDEaHRi  301 (971)
T KOG0385|consen  222 VIAPKSTLDNWMNEFKRFTPSLNVVVYHGDKEERAALRRDIMLPGRFDVCITSYEIAIKDKSFLKKFNWRYLVIDEAHRI  301 (971)
T ss_pred             EEeeHhhHHHHHHHHHHhCCCcceEEEeCCHHHHHHHHHHhhccCCCceEeehHHHHHhhHHHHhcCCceEEEechhhhh
Confidence            99999999999999999999999999999999999999999998999999999999999999999999999999999999


Q ss_pred             cCchhHHHHHHHhccCCcEEEEeCCccCCCHHHHHHHHhhhCCCCCCChHHHHhhhcccccCCChhHHHHHHHHhhhhhh
Q psy10683        315 KNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLL  394 (429)
Q Consensus       315 kn~~s~~~~~~~~l~~~~r~~lTgTP~~n~~~dl~~ll~fl~p~~~~~~~~f~~~~~~~~~~~~~~~~~~L~~~l~~~~l  394 (429)
                      ||.+|.+++.++.+.+.+|+++||||+|||+.|||+||+||.|++|++.+.|..||......++...+.+||.+|+||++
T Consensus       302 KN~~s~L~~~lr~f~~~nrLLlTGTPLQNNL~ELWaLLnFllPdiF~~~e~F~swF~~~~~~~~~e~v~~Lh~vL~pFlL  381 (971)
T KOG0385|consen  302 KNEKSKLSKILREFKTDNRLLLTGTPLQNNLHELWALLNFLLPDIFNSAEDFDSWFDFTNCEGDQELVSRLHKVLRPFLL  381 (971)
T ss_pred             cchhhHHHHHHHHhcccceeEeeCCcccccHHHHHHHHHhhchhhccCHHHHHHHHcccccccCHHHHHHHHhhhhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999998888888999999999999999


Q ss_pred             hhchhHHhhcCCCceEEEEEEcCCHHHHHHHHHhC
Q psy10683        395 RRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKVC  429 (429)
Q Consensus       395 Rr~k~~v~~~LP~~~e~~v~v~~s~~Q~~~Y~~il  429 (429)
                      ||.|.+|.+.||||.|.+++|.||+.|+++|.++|
T Consensus       382 RR~K~dVe~sLppKkE~~iyvgms~mQkk~Y~~iL  416 (971)
T KOG0385|consen  382 RRIKSDVEKSLPPKKELIIYVGMSSMQKKWYKAIL  416 (971)
T ss_pred             HHHHHhHhhcCCCcceeeEeccchHHHHHHHHHHH
Confidence            99999999999999999999999999999999875

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 4e-59
1z6a_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 4e-37
1z63_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 3e-35
1z3i_X 644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 3e-16
3dmq_A 968 Crystal Structure Of Rapa, A Swi2SNF2 PROTEIN THAT 3e-04
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score =  225 bits (573), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 164/266 (61%), Gaps = 14/266 (5%)
Query: 173 PFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGP 232
           P +IKGGE+RD+Q+ G+NWM  L+  G NGILADEMGLGKT+QT++ + ++   R   GP
Sbjct: 229 PPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGP 288
Query: 233 HIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMM----------PGEWD 282
           HI++VP ST+  W++ F+KW P L  IC +G+Q +R+  IR+               +++
Sbjct: 289 HIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDT-IREYEFYTNPRAKGKKTMKFN 347
Query: 283 VCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQ 342
           V +T+YE  +++R       W+++ +DEAHR+KN +S L E +  FK  NR+L+TGTPLQ
Sbjct: 348 VLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQ 407
Query: 343 NNLHELWALLNFLLPXXXXXXXXXXXWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVE 402
           NN+ EL AL+NFL+P               EE       I  LH  ++PF+LRRLK +VE
Sbjct: 408 NNIKELAALVNFLMPGRFTIDQEIDFENQDEE---QEEYIHDLHRRIQPFILRRLKKDVE 464
Query: 403 KRLKPKKELKVYVGLSKMQREWYTKV 428
           K L  K E  + V LS +Q E+Y  +
Sbjct: 465 KSLPSKTERILRVELSDVQTEYYKNI 490
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure
>pdb|3DMQ|A Chain A, Crystal Structure Of Rapa, A Swi2SNF2 PROTEIN THAT Recycles Rna Polymerase During Transcription Length = 968 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-150
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 5e-25
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 1e-125
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 5e-19
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 6e-83
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 6e-18
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-47
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-09
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 7e-13
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-12
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
3h1t_A 590 Type I site-specific restriction-modification syst 2e-05
1z5z_A 271 Helicase of the SNF2/RAD54 family; hydrolase, reco 4e-05
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-04
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  444 bits (1143), Expect = e-150
 Identities = 115/297 (38%), Positives = 172/297 (57%), Gaps = 12/297 (4%)

Query: 141 DHRHRMTEQEEDEELLANANTEGKTIVSFENSPFYIKGGEMRDYQVRGLNWMISLYENGI 200
            H       +   +  +N  ++          P +IKGGE+RD+Q+ G+NWM  L+  G 
Sbjct: 197 KHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGD 256

Query: 201 NGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKKWCPTLRAIC 260
           NGILADEMGLGKT+QT++ + ++   R   GPHI++VP ST+  W++ F+KW P L  IC
Sbjct: 257 NGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCIC 316

Query: 261 LIGDQDARNAMIRDVMMPGE---------WDVCITSYEMCIRERGVFKKFNWRYLVIDEA 311
            +G+Q +R+ +                  ++V +T+YE  +++R       W+++ +DEA
Sbjct: 317 YMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEA 376

Query: 312 HRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFN 371
           HR+KN +S L E +  FK  NR+L+TGTPLQNN+ EL AL+NFL+P  F+   + D    
Sbjct: 377 HRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ 436

Query: 372 TEEFMGDHSIIERLHSVLKPFLLRRLKSEVEKRLKPKKELKVYVGLSKMQREWYTKV 428
            EE       I  LH  ++PF+LRRLK +VEK L  K E  + V LS +Q E+Y  +
Sbjct: 437 DEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI 490
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Length = 590 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 100.0
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.97
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.9
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.87
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.83
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.8
3h1t_A 590 Type I site-specific restriction-modification syst 99.78
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.77
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.76
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.75
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.75
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.74
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.74
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.71
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.71
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.71
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.68
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.68
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.68
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.67
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.67
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.66
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.66
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.66
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.65
3bor_A237 Human initiation factor 4A-II; translation initiat 99.64
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.63
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.63
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.62
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.62
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.61
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.61
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.61
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.6
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.58
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.57
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.57
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.55
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.53
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.53
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.5
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.5
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.49
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.48
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.47
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.46
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.43
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.42
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.39
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.37
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.37
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.35
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.34
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.33
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.29
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.28
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.28
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.27
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.09
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.97
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.95
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.94
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.85
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.8
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.7
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.59
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.56
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.55
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.54
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.51
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.44
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.42
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.36
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.24
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.17
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.17
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.04
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 97.98
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.96
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 97.93
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.89
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.7
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.68
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.55
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 97.55
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.4
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 97.37
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.12
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.8
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.63
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.44
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.43
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 96.39
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.38
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.38
3jux_A 822 Protein translocase subunit SECA; protein transloc 96.3
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.19
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.93
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.92
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.89
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.72
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.47
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.35
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.27
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.09
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.03
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.83
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.74
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.52
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.31
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.26
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.2
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.18
3bos_A242 Putative DNA replication factor; P-loop containing 94.13
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 94.08
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.07
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.06
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.06
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.0
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 93.83
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 93.65
2gno_A305 DNA polymerase III, gamma subunit-related protein; 93.34
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.28
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 93.19
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.02
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 92.87
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.81
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 92.54
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 92.38
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.22
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 92.02
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 91.88
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 91.87
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 91.86
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 91.85
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 91.64
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 91.64
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 91.62
3h1t_A590 Type I site-specific restriction-modification syst 91.58
3co5_A143 Putative two-component system transcriptional RES 91.57
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 91.55
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.15
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 90.99
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 90.82
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 90.77
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 90.33
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.21
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.14
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 89.74
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 89.26
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 89.09
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 89.03
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.0
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.79
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 88.7
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 88.62
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 88.48
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 88.34
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 88.32
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 88.3
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 88.25
3pvs_A 447 Replication-associated recombination protein A; ma 87.7
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 87.63
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 86.77
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 86.68
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 86.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.29
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 86.01
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 85.75
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 85.72
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 85.24
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 85.05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 84.96
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 84.76
2kjq_A149 DNAA-related protein; solution structure, NESG, st 84.34
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.77
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 83.26
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 83.14
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 82.8
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 82.42
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 82.37
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 82.09
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 81.61
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 81.46
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 80.28
4gl2_A 699 Interferon-induced helicase C domain-containing P; 80.22
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.9e-47  Score=410.27  Aligned_cols=258  Identities=43%  Similarity=0.802  Sum_probs=225.1

Q ss_pred             ccCCCccccCCCChHHHHHHHHHHHHHHhcCCCeEeecCCCCCHHHHHHHHHHHHhhhcccCCCeEEEeccchHHHHHHH
Q psy10683        169 FENSPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNE  248 (429)
Q Consensus       169 ~~~~p~~~~~~~Lr~~Q~~~v~~l~~~~~~~~~~ilad~~GlGKT~~~i~~~~~l~~~~~~~~~~LIV~P~~ll~qW~~e  248 (429)
                      +..+|++..++.|||||++|++||...+.++.+|||||+||+|||+++++++..+.......+|+|||||.+++.||.+|
T Consensus       225 ~~~~p~~~~~~~Lr~yQ~egv~~l~~~~~~~~~~ILademGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~~E  304 (800)
T 3mwy_W          225 LSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDT  304 (800)
T ss_dssp             CSSCCTTCCSSCCCTHHHHHHHHHHHHHTTTCCEEECCCTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHHHH
T ss_pred             cccCCCccCCCCcCHHHHHHHHHHHHHhhcCCCEEEEeCCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHHHH
Confidence            45668888889999999999999999999999999999999999999999999887767788999999999999999999


Q ss_pred             HHhhcCCCceEEEeCChhhHHHHHHhh---------cCCCCccEEEcchHHHHHHhhhhhccCceEEEecCcccccCchh
Q psy10683        249 FKKWCPTLRAICLIGDQDARNAMIRDV---------MMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKS  319 (429)
Q Consensus       249 ~~~~~~~~~~~~~~g~~~~~~~~~~~~---------~~~~~~dvvitty~~l~~~~~~l~~~~~~~vIiDEaH~~kn~~s  319 (429)
                      |.+|+|++++.+++|....+.......         .....++|+||||+++.++...+..+.|++|||||||+++|..+
T Consensus       305 ~~~~~p~~~v~~~~g~~~~r~~~~~~~~~~~~~~~~~~~~~~dvvitTy~~l~~~~~~l~~~~w~~vIvDEaH~lkn~~s  384 (800)
T 3mwy_W          305 FEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAES  384 (800)
T ss_dssp             HHHHSTTCCEEECCCSSHHHHHHHHHHSCSCC-----CCCCCSEEEECTTHHHHTHHHHHTSEEEEEEETTGGGGCCSSS
T ss_pred             HHHHCCCceEEEEeCCHHHHHHHHHHHhhccccccccccccCCEEEecHHHHHhhHHHHhcCCcceeehhhhhhhcCchh
Confidence            999999999999999988776543322         23457899999999999999999999999999999999999999


Q ss_pred             HHHHHHHhccCCcEEEEeCCccCCCHHHHHHHHhhhCCCCCCChHHHHhhhcccccCCChhHHHHHHHHhhhhhhhhchh
Q psy10683        320 KLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKS  399 (429)
Q Consensus       320 ~~~~~~~~l~~~~r~~lTgTP~~n~~~dl~~ll~fl~p~~~~~~~~f~~~~~~~~~~~~~~~~~~L~~~l~~~~lRr~k~  399 (429)
                      +.++++..+.+.+||+|||||++|++.|||++++||.|+.|.....|.-....   ......+.+|+.+++|+++||+++
T Consensus       385 ~~~~~l~~l~~~~rl~LTgTPiqN~l~el~~ll~fL~p~~~~~~~~~~~~~~~---~~~~~~~~~L~~~l~p~~lRR~k~  461 (800)
T 3mwy_W          385 SLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQD---EEQEEYIHDLHRRIQPFILRRLKK  461 (800)
T ss_dssp             HHHHHHTTSEEEEEEEECSCCCSSCSHHHHHHHHHHCSCCC---------CCT---THHHHHHHHHHHTTGGGEEECCGG
T ss_pred             HHHHHHHHhhhccEEEeeCCcCCCCHHHHHHHHHHhCccccCchhhhcccccc---hhHHHHHHHHHHHHhHHHhhhhHH
Confidence            99999999999999999999999999999999999999999877666422211   122456788999999999999999


Q ss_pred             HHhhcCCCceEEEEEEcCCHHHHHHHHHhC
Q psy10683        400 EVEKRLKPKKELKVYVGLSKMQREWYTKVC  429 (429)
Q Consensus       400 ~v~~~LP~~~e~~v~v~~s~~Q~~~Y~~il  429 (429)
                      ++...||++.+.+++|+||+.|+++|+.++
T Consensus       462 dv~~~LP~k~~~~v~v~ls~~q~~~Y~~i~  491 (800)
T 3mwy_W          462 DVEKSLPSKTERILRVELSDVQTEYYKNIL  491 (800)
T ss_dssp             GGTTTSCCEEEEEEEECCCHHHHHHHHHHH
T ss_pred             hhhhccCCcEEEEEEeCCCHHHHHHHHHHH
Confidence            999999999999999999999999998763
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 429
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 1e-48
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 9e-15
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 5e-42
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 6e-11
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 8e-17
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 1e-07
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 3e-07
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 3e-06
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 0.001
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 0.001
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 0.003
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

 Score =  163 bits (413), Expect = 1e-48
 Identities = 84/230 (36%), Positives = 131/230 (56%), Gaps = 11/230 (4%)

Query: 173 PFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGP 232
           P+ IK   +R YQ++G +WM  + + G    LAD+MGLGKTLQTI++    K    +  P
Sbjct: 6   PYNIKA-NLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENEL-TP 63

Query: 233 HIVIVPKSTLLNWMNEFKKWCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCI 292
            +VI P S L NW  E  K+ P LR      D+              ++D+ +T+Y + +
Sbjct: 64  SLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKLE--------DYDIILTTYAVLL 115

Query: 293 RERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALL 352
           R+    K+  W+Y+VIDEA  IKN ++K+ + V+E K+  R+ LTGTP++N + +LW+++
Sbjct: 116 RDTR-LKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVDDLWSIM 174

Query: 353 NFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSEVE 402
            FL P +  S  +F S F T    GD+   E L +++ PF+LRR K +  
Sbjct: 175 TFLNPGLLGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKYDKA 224
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.88
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.83
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.77
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.64
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.58
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.56
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.52
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.5
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.5
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.37
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.25
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.22
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.17
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.17
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.12
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.1
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.07
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.04
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.02
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.9
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.8
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.12
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.07
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.66
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.3
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.67
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.37
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.34
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.03
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.77
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.23
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 94.15
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.03
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.91
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.87
d2qy9a2211 GTPase domain of the signal recognition particle r 93.7
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.6
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.35
d1okkd2207 GTPase domain of the signal recognition particle r 93.2
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.1
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.76
d1vmaa2213 GTPase domain of the signal recognition particle r 92.56
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 92.21
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.13
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.92
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.45
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 91.14
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.69
d1ls1a2207 GTPase domain of the signal sequence recognition p 90.27
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.87
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.74
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.32
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.04
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.57
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 87.12
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.08
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.7
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 81.86
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 80.99
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=100.00  E-value=3.5e-47  Score=349.47  Aligned_cols=224  Identities=38%  Similarity=0.714  Sum_probs=200.3

Q ss_pred             CCccccCCCChHHHHHHHHHHHHHHhcCCCeEeecCCCCCHHHHHHHHHHHHhhhcccCCCeEEEeccchHHHHHHHHHh
Q psy10683        172 SPFYIKGGEMRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIAGPHIVIVPKSTLLNWMNEFKK  251 (429)
Q Consensus       172 ~p~~~~~~~Lr~~Q~~~v~~l~~~~~~~~~~ilad~~GlGKT~~~i~~~~~l~~~~~~~~~~LIV~P~~ll~qW~~e~~~  251 (429)
                      +|..++ ..|+|||++||.||......+.||||||+||+|||+++++++..+.. .....++|||||.+++.||.+|+.+
T Consensus         5 ~P~~~~-~~L~~yQ~~~v~~~~~~~~~~~g~iLaDe~GlGKT~~~i~~~~~~~~-~~~~~~~LIv~p~~l~~~W~~e~~~   82 (230)
T d1z63a1           5 EPYNIK-ANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKK-ENELTPSLVICPLSVLKNWEEELSK   82 (230)
T ss_dssp             CCCSCS-SCCCHHHHHHHHHHHHHHHTTCCEEECCCTTSCHHHHHHHHHHHHHH-TTCCSSEEEEECSTTHHHHHHHHHH
T ss_pred             Cchhhh-cchhHHHHHHHHHHHHhhhcCCCEEEEeCCCCChHHHHHHhhhhhhh-cccccccceecchhhhhHHHHHHHh
Confidence            455554 48999999999999999999999999999999999999999988776 5566799999999999999999999


Q ss_pred             hcCCCceEEEeCChhhHHHHHHhhcCCCCccEEEcchHHHHHHhhhhhccCceEEEecCcccccCchhHHHHHHHhccCC
Q psy10683        252 WCPTLRAICLIGDQDARNAMIRDVMMPGEWDVCITSYEMCIRERGVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTT  331 (429)
Q Consensus       252 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~dvvitty~~l~~~~~~l~~~~~~~vIiDEaH~~kn~~s~~~~~~~~l~~~  331 (429)
                      |++...+..+.......        ...+++|++++|+.+.+. ..+..+.|++||+||||+++|+.+..++++..+.+.
T Consensus        83 ~~~~~~~~~~~~~~~~~--------~~~~~~vvi~~~~~~~~~-~~l~~~~~~~vI~DEah~~k~~~s~~~~~~~~l~a~  153 (230)
T d1z63a1          83 FAPHLRFAVFHEDRSKI--------KLEDYDIILTTYAVLLRD-TRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSK  153 (230)
T ss_dssp             HCTTSCEEECSSSTTSC--------CGGGSSEEEEEHHHHTTC-HHHHTCCEEEEEEETGGGGSCTTSHHHHHHHTSCEE
T ss_pred             hcccccceeeccccchh--------hccCcCEEEeeHHHHHhH-HHHhcccceEEEEEhhhcccccchhhhhhhhhhccc
Confidence            99888777765543321        124678999999998764 457788999999999999999999999999999999


Q ss_pred             cEEEEeCCccCCCHHHHHHHHhhhCCCCCCChHHHHhhhcccccCCChhHHHHHHHHhhhhhhhhchhH--HhhcCC
Q psy10683        332 NRLLLTGTPLQNNLHELWALLNFLLPDIFSSSDDFDSWFNTEEFMGDHSIIERLHSVLKPFLLRRLKSE--VEKRLK  406 (429)
Q Consensus       332 ~r~~lTgTP~~n~~~dl~~ll~fl~p~~~~~~~~f~~~~~~~~~~~~~~~~~~L~~~l~~~~lRr~k~~--v~~~LP  406 (429)
                      +||+|||||++|++.|||++++||+|+++++...|.+.|+.+...++....++|+.++++|++||+|+|  |..+||
T Consensus       154 ~r~~LTgTPi~n~~~dl~~ll~~l~p~~~~~~~~F~~~~~~~~~~~~~~~~~~L~~~l~~~~lRr~K~d~~v~~dLP  230 (230)
T d1z63a1         154 YRIALTGTPIENKVDDLWSIMTFLNPGLLGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKYDKAIINDLP  230 (230)
T ss_dssp             EEEEECSSCSTTCHHHHHHHHHHHSTTTTCCHHHHHTTTHHHHHTTCHHHHHHHHHHHTTTEECCCTTCHHHHTTSC
T ss_pred             eEEEEecchHHhHHHHHHHHHHhhCCCcCCCHHHHHHHHhhhhhccCHHHHHHHHHHhhccEEEEecCCccHhhcCC
Confidence            999999999999999999999999999999999999999999888889999999999999999999998  567887
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure