Psyllid ID: psy10797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MVRLSSADIIFRQDYPMLTLSRGKVEPNGGPSSLIPMSPHHKMMPGTGRDMKMIESDQVRDLKSQLNGQNTAKRSNHLNQTFCVASLLIAQLRRKTERMKKIEQAGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNIYGSLEFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTNGPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRKCPKCNAKANDYHRLYLGS
ccccccccEEEccccccEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEEEEcEEEcccccEEEEEEEccccccccccEEEEEEEHHHHHccccEEEEEHHHHccccccEEEEEEEEHHHHHcccEEEEEEEEccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccc
ccEcccHcEEEEcccccEEEccccEccccccccccccccccccccccccccHHHccHHHHHHHHHHcccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccEEEEEEEEEEEEEccEEEEEEEEEEEEEEccEEEEEEEEEEEEEEccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEccEEEEEEEEEEEEEEcHHEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcc
mvrlssadiifrqdypmltlsrgkvepnggpsslipmsphhkmmpgtgrdmkmIESDQVRDLKSqlngqntakrsnhlNQTFCVASLLIAQLRRKTERMKKIeqagtldettpwdssfgifrlsstVFVYHCFSIfrfssstvFVYHCFSIfrfssstvFVYHCFSIfrfssstvFVYHCFSIfrfssstvFVYHCFSIfrfssstvFVYHCFSIfrfssstifvyhcfdifsLTSTLFVSICTSAFQMSfyksrwfdfrslsdsasniygslefRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTngparlefgkdrefSAKFVNFRRKSYFFVEFLDCLRTRYEtrqrkcpkcnakandyhrlylgs
mvrlssadiifrqdypmltlsrgkvepnggpsslipmsphHKMMPGTGRDMKMIESDQVRDLKSQLNGQNtakrsnhlnqtfCVASLLIAQLRRKTERMKKieqagtldettpwdsSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNiygslefrkfacvvrdSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTEriksnqlhklarEEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTNgparlefgkdREFSAKFVNFRRKSYFFVEFLDCLRTRyetrqrkcpkcnakandyhrlylgs
MVRLSSADIIFRQDYPMLTLSRGKVEPNGGPSSLIPMSPHHKMMPGTGRDMKMIESDQVRDLKSQLNGQNTAKRSNHLNQTFCVASLLIAQLRRKTERMKKIEQAGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCfsifrfssstifVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNIYGSLEFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTNGPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRKCPKCNAKANDYHRLYLGS
********IIFRQDYP*************************************************************LNQTFCVASLLIAQLRRKT*****IEQAGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNIYGSLEFRKFACVVR*********************************************************************************************************LSLQIEAMHTAIRKLEEKERFLQTVLTNA************************AADLKLHLVIIYTNGPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRKCPKCNAKANDYHRLY***
*****SADIIFRQDYPMLTLSR************IPMSPHHKM*P**GRD*KMIES*Q*******************LNQTFCVASLLIAQLRRKTERMKKIEQAGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAF****************************************************************************************************************************************************************************************************************************************YFFVEFLDC***********************RLYLG*
MVRLSSADIIFRQDYPMLTLSRGKVEPNGGPSSLIPMSPHHKMMPGTGRDMKMIESDQVRDLKSQLNGQNTAKRSNHLNQTFCVASLLIAQLRRKTERMKKIEQAGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNIYGSLEFRKFACVVR***********DEEAMRKIKQLEDQ*************EEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTNGPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRKCPKCNAKANDYHRLYLGS
***LSSADIIFRQDYPMLTLSRGKVEPNGGPSSLIP***************K*IESDQVRDLKSQLNGQNTAKRSNHLNQTFCVASLLIAQLRRKTERMKKIEQAGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNIYGSLEFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTNGPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRKCPKCNAKANDYHRLYLGS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRLSSADIIFRQDYPMLTLSRGKVEPNGGPSSLIPMSPHHKMMPGTGRDMKMIESDQVRDLKSQLNGQNTAKRSNHLNQTFCVxxxxxxxxxxxxxxxxxxxxxGTLDETTPWDSSFGIFRLSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTVFVYHCFSIFRFSSSTIFVYHCFDIFSLTSTLFVSICTSAFQMSFYKSRWFDFRSLSDSASNIYGSLEFRKFACVVRDSKRDERKKLAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMEVTGQAxxxxxxxxxxxxxxxxxxxxxNFKLMTERIKSNQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHLRNQAMDLNKRKAIESAQSAADLKLHLVIIYTNGPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRKCPKCNAKANDYHRLYLGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query517 2.2.26 [Sep-21-2011]
Q9VRP91044 E3 ubiquitin-protein liga yes N/A 0.468 0.231 0.507 8e-74
Q8CJB91002 E3 ubiquitin-protein liga yes N/A 0.452 0.233 0.486 7e-61
Q5RAU71001 E3 ubiquitin-protein liga yes N/A 0.433 0.223 0.480 2e-60
Q3U3191001 E3 ubiquitin-protein liga yes N/A 0.435 0.224 0.489 3e-60
O751501001 E3 ubiquitin-protein liga yes N/A 0.433 0.223 0.480 3e-60
Q4R7K71001 E3 ubiquitin-protein liga N/A N/A 0.433 0.223 0.477 2e-59
Q5DTM8973 E3 ubiquitin-protein liga no N/A 0.433 0.230 0.476 3e-54
Q5VTR2975 E3 ubiquitin-protein liga no N/A 0.433 0.229 0.476 3e-54
A2VDP1975 E3 ubiquitin-protein liga no N/A 0.433 0.229 0.476 4e-54
Q5ZLS3984 E3 ubiquitin-protein liga yes N/A 0.290 0.152 0.636 1e-44
>sp|Q9VRP9|BRE1_DROME E3 ubiquitin-protein ligase Bre1 OS=Drosophila melanogaster GN=Bre1 PE=1 SV=2 Back     alignment and function desciption
 Score =  278 bits (711), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 164/323 (50%), Positives = 191/323 (59%), Gaps = 81/323 (25%)

Query: 274  EFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHK------------- 320
            E R+    +++SKR+ERKKLADEEA+RKIKQLE+Q ++LQKQ+A HK             
Sbjct: 721  ELRQQLKKLQESKREERKKLADEEALRKIKQLEEQKYELQKQMANHKPTDNSWGSGAPGT 780

Query: 321  ----------QEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQ 370
                       EEEALLNEMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLM+ERIK+NQ
Sbjct: 781  ANYTRPFVGSHEEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMSERIKANQ 840

Query: 371  LHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDL 430
            LHKL REEK  L +Q+   + QIEAMH  +RKLEEKER LQ  + + EKEL LR QAM++
Sbjct: 841  LHKLLREEKTVLEDQMATATTQIEAMHIVLRKLEEKERSLQATVASIEKELMLRQQAMEM 900

Query: 431  NKRKAIESAQSAADLKLHL------------VIIYTNGPARLEFGKDREFSAKFVNFRRK 478
            +KRKAIESAQSAADLKLHL            V+         E  K +    +   F+RK
Sbjct: 901  HKRKAIESAQSAADLKLHLEKYHAQMKEAQQVVAEKTSSLEAEAYKTKRLQEELAQFKRK 960

Query: 479  SY--------------------------------------------FFVEFLDCLRTRYE 494
            +                                             F V   DCLRTRYE
Sbjct: 961  AERMKKMEMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYE 1020

Query: 495  TRQRKCPKCNAK--ANDYHRLYL 515
            TRQRKCPKCN    ANDYHRLYL
Sbjct: 1021 TRQRKCPKCNCAFGANDYHRLYL 1043




E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-117' of histone H2B. H2B 'Lys-117' ubiquitination gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It thereby plays a central role in histone code and gene regulation. Required for the expression of Notch target genes in development by affecting the levels of Su(H) in imaginal disk cells and stimulating the Su(H)-mediated transcription of Notch-specific genes.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8CJB9|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAU7|BRE1B_PONAB E3 ubiquitin-protein ligase BRE1B OS=Pongo abelii GN=RNF40 PE=2 SV=1 Back     alignment and function description
>sp|Q3U319|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=2 SV=2 Back     alignment and function description
>sp|O75150|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens GN=RNF40 PE=1 SV=4 Back     alignment and function description
>sp|Q4R7K7|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1 Back     alignment and function description
>sp|Q5DTM8|BRE1A_MOUSE E3 ubiquitin-protein ligase BRE1A OS=Mus musculus GN=Rnf20 PE=1 SV=2 Back     alignment and function description
>sp|Q5VTR2|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens GN=RNF20 PE=1 SV=2 Back     alignment and function description
>sp|A2VDP1|BRE1A_BOVIN E3 ubiquitin-protein ligase BRE1A OS=Bos taurus GN=RNF20 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLS3|BRE1A_CHICK E3 ubiquitin-protein ligase BRE1A OS=Gallus gallus GN=RNF20 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
193678945 953 PREDICTED: e3 ubiquitin-protein ligase B 0.520 0.282 0.527 7e-78
345483701 955 PREDICTED: E3 ubiquitin-protein ligase B 0.471 0.255 0.554 3e-77
350402387 957 PREDICTED: E3 ubiquitin-protein ligase B 0.471 0.254 0.551 2e-76
383857052 957 PREDICTED: E3 ubiquitin-protein ligase B 0.471 0.254 0.551 2e-76
328778821 930 PREDICTED: e3 ubiquitin-protein ligase B 0.471 0.262 0.551 2e-76
340711825 957 PREDICTED: e3 ubiquitin-protein ligase B 0.471 0.254 0.551 2e-76
307199111 957 E3 ubiquitin-protein ligase Bre1 [Harpeg 0.471 0.254 0.548 7e-76
332020263 676 E3 ubiquitin-protein ligase Bre1 [Acromy 0.471 0.360 0.548 1e-75
321469893 958 hypothetical protein DAPPUDRAFT_188104 [ 0.450 0.243 0.555 1e-74
307180966 964 E3 ubiquitin-protein ligase Bre1 [Campon 0.471 0.253 0.534 1e-73
>gi|193678945|ref|XP_001949533.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  297 bits (761), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 174/330 (52%), Positives = 204/330 (61%), Gaps = 61/330 (18%)

Query: 249 MSFYKSRWFDFRS---LSDSASNIYGSLEFRKFACV-VRDSKRDERKKLADEEAMRKIKQ 304
           +  YK    D R    L  +   +   LE  K A   +++ KR+ERKKLADE+A+RKIKQ
Sbjct: 624 LDMYKGVSKDQRDKVQLMAAEKKLRAELEEAKQALKKIQEGKREERKKLADEDALRKIKQ 683

Query: 305 LEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTE 364
           LE+   QLQKQVATHKQEEEA+L+EMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLMTE
Sbjct: 684 LEEHIVQLQKQVATHKQEEEAMLSEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMTE 743

Query: 365 RIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLR 424
           RIKSNQLHK+AREE DTL+E ++ L+ Q+E  +T +RKLEEKER LQ  L   EKE  +R
Sbjct: 744 RIKSNQLHKMAREETDTLKELIKTLTNQVEMTNTVVRKLEEKERILQNSLATVEKECSIR 803

Query: 425 NQAMDLNKRKAIESAQSAADLKLHL------------VIIYTNGPARLEFGKDREFSAKF 472
            QAM+++KRKAIESAQSAADLKLHL            V+         E  K +    + 
Sbjct: 804 QQAMEMHKRKAIESAQSAADLKLHLDKYHAQMKEAQQVVTEKTSALEAEAYKTKRLQEEI 863

Query: 473 VNFRRKS-------------YFFVEFL------------------------------DCL 489
           V  RRK+                VE +                              DCL
Sbjct: 864 VQLRRKTERMKKIEQAGTLDEVMVEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCL 923

Query: 490 RTRYETRQRKCPKCNA--KANDYHRLYLGS 517
           RTRYETRQRKCPKCNA   ANDYHRLYLGS
Sbjct: 924 RTRYETRQRKCPKCNATFGANDYHRLYLGS 953




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345483701|ref|XP_001601663.2| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350402387|ref|XP_003486466.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383857052|ref|XP_003704020.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328778821|ref|XP_625025.3| PREDICTED: e3 ubiquitin-protein ligase Bre1, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|340711825|ref|XP_003394469.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307199111|gb|EFN79821.1| E3 ubiquitin-protein ligase Bre1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332020263|gb|EGI60697.1| E3 ubiquitin-protein ligase Bre1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|321469893|gb|EFX80871.1| hypothetical protein DAPPUDRAFT_188104 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307180966|gb|EFN68754.1| E3 ubiquitin-protein ligase Bre1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
UNIPROTKB|F8W8Z4693 RNF40 "E3 ubiquitin-protein li 0.423 0.316 0.543 4.4e-52
ZFIN|ZDB-GENE-030131-66071004 rnf40 "ring finger protein 40" 0.340 0.175 0.607 9.2e-52
RGD|6286381002 Rnf40 "ring finger protein 40, 0.408 0.210 0.56 2.2e-51
UNIPROTKB|H3BP71961 RNF40 "E3 ubiquitin-protein li 0.423 0.227 0.543 3e-51
UNIPROTKB|O751501001 RNF40 "E3 ubiquitin-protein li 0.423 0.218 0.543 3.6e-51
UNIPROTKB|Q5RAU71001 RNF40 "E3 ubiquitin-protein li 0.423 0.218 0.543 3.6e-51
UNIPROTKB|E2R1L51001 RNF40 "Uncharacterized protein 0.423 0.218 0.543 3.6e-51
MGI|MGI:21420481001 Rnf40 "ring finger protein 40" 0.423 0.218 0.543 3.6e-51
UNIPROTKB|E1BCI21001 RNF40 "Uncharacterized protein 0.408 0.210 0.554 4.6e-51
RGD|1311936973 Rnf20 "ring finger protein 20, 0.423 0.225 0.519 5.2e-51
UNIPROTKB|F8W8Z4 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 540 (195.1 bits), Expect = 4.4e-52, P = 4.4e-52
 Identities = 125/230 (54%), Positives = 156/230 (67%)

Query:   274 EFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVT 333
             E R     + +  R E KK+ADE+A+R+I+Q E+Q   LQ+++   KQEEEALL+EM+VT
Sbjct:   394 ELRSRIRELEERDRRESKKIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVT 453

Query:   334 GQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQI 393
             GQAFEDMQEQN RLLQQLREKDDANFKLM+ERIK+NQ+HKL REEKD L EQV  L  Q+
Sbjct:   454 GQAFEDMQEQNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQV 513

Query:   394 EAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIY 453
             +A    ++KLEEKER LQ  L   EKEL LR+QA++LNKRKA+E+AQ A DLK+ L  + 
Sbjct:   514 DAQLLTVQKLEEKERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQ 573

Query:   454 TN----GPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRK 499
             T      P   E    RE    F N +R      E +  LR + E +QRK
Sbjct:   574 TRLREIQPCLAESRAARE-KESF-NLKRAQ----EDISRLRRKLE-KQRK 616


GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-030131-6607 rnf40 "ring finger protein 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|628638 Rnf40 "ring finger protein 40, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H3BP71 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75150 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAU7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1L5 RNF40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2142048 Rnf40 "ring finger protein 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCI2 RNF40 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311936 Rnf20 "ring finger protein 20, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VRP9BRE1_DROME6, ., 3, ., 2, ., -0.50770.46800.2318yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-07
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 5e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
pfam01576859 pfam01576, Myosin_tail_1, Myosin tail 1e-05
COG1322 448 COG1322, COG1322, Predicted nuclease of restrictio 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-05
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 1e-04
pfam09731 493 pfam09731, Mitofilin, Mitochondrial inner membrane 2e-04
TIGR03321246 TIGR03321, alt_F1F0_F0_B, alternate F1F0 ATPase, F 2e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-04
pfam0864796 pfam08647, BRE1, BRE1 E3 ubiquitin ligase 2e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 3e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
pfam10174 774 pfam10174, Cast, RIM-binding protein of the cytoma 6e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02338110 TIGR02338, gimC_beta, prefoldin, beta subunit, arc 0.001
pfam10168717 pfam10168, Nup88, Nuclear pore component 0.001
pfam00430132 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) 0.001
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
pfam06008263 pfam06008, Laminin_I, Laminin Domain I 0.002
pfam11180192 pfam11180, DUF2968, Protein of unknown function (D 0.002
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.002
pfam00038312 pfam00038, Filament, Intermediate filament protein 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
MTH00059289 MTH00059, ND2, NADH dehydrogenase subunit 2; Provi 0.003
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 0.003
PRK10920 390 PRK10920, PRK10920, putative uroporphyrinogen III 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
TIGR03185 650 TIGR03185, DNA_S_dndD, DNA sulfur modification pro 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 55.9 bits (135), Expect = 3e-08
 Identities = 32/151 (21%), Positives = 76/151 (50%)

Query: 296 EEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKD 355
           EE  R++++LE Q  +L++++A  ++E E L + +E   +  E+++E+   L ++L E +
Sbjct: 705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELE 764

Query: 356 DANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLT 415
           +    L     K  +  +   E++  L+E+++ L  ++E     +  LE +   L+    
Sbjct: 765 EELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRE 824

Query: 416 NAEKELHLRNQAMDLNKRKAIESAQSAADLK 446
             E+E+    + ++  + K  E  +   +L+
Sbjct: 825 RLEQEIEELEEEIEELEEKLDELEEELEELE 855


Length = 1163

>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|132364 TIGR03321, alt_F1F0_F0_B, alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|192111 pfam08647, BRE1, BRE1 E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|131391 TIGR02338, gimC_beta, prefoldin, beta subunit, archaeal Back     alignment and domain information
>gnl|CDD|118696 pfam10168, Nup88, Nuclear pore component Back     alignment and domain information
>gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|218852 pfam06008, Laminin_I, Laminin Domain I Back     alignment and domain information
>gnl|CDD|221016 pfam11180, DUF2968, Protein of unknown function (DUF2968) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|177131 MTH00059, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 517
KOG0978|consensus698 100.0
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 99.72
KOG0320|consensus187 99.05
KOG0978|consensus698 98.47
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 98.46
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.42
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.41
PRK02224 880 chromosome segregation protein; Provisional 98.39
KOG0823|consensus 230 98.37
PRK02224 880 chromosome segregation protein; Provisional 98.37
KOG0317|consensus293 98.35
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.29
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.28
PRK11637 428 AmiB activator; Provisional 98.22
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.21
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.2
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.16
PRK11637 428 AmiB activator; Provisional 98.13
KOG0971|consensus 1243 98.07
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.06
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.03
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.01
PF14662193 CCDC155: Coiled-coil region of CCDC155 98.01
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.0
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.0
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.99
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.95
PRK03918 880 chromosome segregation protein; Provisional 97.91
PRK04778569 septation ring formation regulator EzrA; Provision 97.9
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.87
KOG0161|consensus 1930 97.87
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.82
KOG2164|consensus 513 97.82
PHA02562 562 46 endonuclease subunit; Provisional 97.8
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.77
PF1463444 zf-RING_5: zinc-RING finger domain 97.72
KOG0161|consensus 1930 97.71
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.71
KOG0963|consensus 629 97.7
KOG0250|consensus 1074 97.7
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.69
PHA02562 562 46 endonuclease subunit; Provisional 97.69
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.66
KOG0250|consensus 1074 97.64
KOG0996|consensus 1293 97.59
KOG1029|consensus 1118 97.57
PRK09039343 hypothetical protein; Validated 97.55
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.55
PHA02926242 zinc finger-like protein; Provisional 97.51
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.48
PRK04863 1486 mukB cell division protein MukB; Provisional 97.48
KOG4673|consensus 961 97.48
KOG1029|consensus 1118 97.45
PHA02929238 N1R/p28-like protein; Provisional 97.42
PRK03918 880 chromosome segregation protein; Provisional 97.4
COG4942 420 Membrane-bound metallopeptidase [Cell division and 97.39
KOG0971|consensus 1243 97.39
KOG0976|consensus 1265 97.38
KOG0996|consensus 1293 97.37
PRK04863 1486 mukB cell division protein MukB; Provisional 97.36
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.34
KOG0933|consensus 1174 97.28
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 97.28
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 97.28
PRK09039343 hypothetical protein; Validated 97.27
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.26
COG4372 499 Uncharacterized protein conserved in bacteria with 97.21
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.18
KOG0612|consensus 1317 97.18
KOG0977|consensus 546 97.17
PRK01156 895 chromosome segregation protein; Provisional 97.16
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.15
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.15
KOG4674|consensus 1822 97.14
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 97.13
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 97.13
PF14662193 CCDC155: Coiled-coil region of CCDC155 97.12
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.11
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.1
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.09
KOG0933|consensus 1174 97.09
PRK10929 1109 putative mechanosensitive channel protein; Provisi 97.07
KOG0999|consensus 772 97.06
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 97.01
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.01
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.99
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 96.99
KOG0994|consensus1758 96.99
PRK04778 569 septation ring formation regulator EzrA; Provision 96.97
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 96.97
KOG0982|consensus502 96.96
COG4372 499 Uncharacterized protein conserved in bacteria with 96.95
KOG0980|consensus 980 96.93
KOG4360|consensus 596 96.92
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 96.92
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.89
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 96.88
COG4942 420 Membrane-bound metallopeptidase [Cell division and 96.87
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 96.84
KOG0980|consensus 980 96.81
PRK11281 1113 hypothetical protein; Provisional 96.81
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 96.81
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.8
PF00038312 Filament: Intermediate filament protein; InterPro: 96.8
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 96.79
KOG0964|consensus 1200 96.78
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.76
KOG4674|consensus 1822 96.73
PF00038312 Filament: Intermediate filament protein; InterPro: 96.7
PRK11281 1113 hypothetical protein; Provisional 96.7
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.66
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.66
KOG4673|consensus 961 96.65
KOG0976|consensus 1265 96.63
KOG2177|consensus 386 96.61
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.6
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 96.59
KOG0018|consensus 1141 96.56
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.55
KOG0311|consensus 381 96.54
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 96.53
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.52
KOG0999|consensus 772 96.48
PRK01156 895 chromosome segregation protein; Provisional 96.44
PRK10361 475 DNA recombination protein RmuC; Provisional 96.43
KOG0963|consensus 629 96.42
KOG0995|consensus581 96.36
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 96.32
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.32
KOG0977|consensus 546 96.3
PRK10929 1109 putative mechanosensitive channel protein; Provisi 96.3
KOG0612|consensus 1317 96.3
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.29
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.21
KOG0979|consensus 1072 96.18
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 96.17
COG4477570 EzrA Negative regulator of septation ring formatio 96.16
COG5222427 Uncharacterized conserved protein, contains RING Z 96.14
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.11
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 96.1
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.09
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.07
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 96.07
PF05010207 TACC: Transforming acidic coiled-coil-containing p 96.07
KOG0287|consensus 442 96.01
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.98
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.92
KOG0964|consensus 1200 95.92
KOG4643|consensus 1195 95.88
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 95.86
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.86
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.85
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.82
KOG0979|consensus 1072 95.82
KOG4807|consensus593 95.8
KOG1103|consensus 561 95.79
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 95.79
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 95.74
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 95.73
KOG0802|consensus 543 95.65
COG5185622 HEC1 Protein involved in chromosome segregation, i 95.55
KOG2879|consensus298 95.51
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 95.5
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 95.5
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 95.49
PF13863126 DUF4200: Domain of unknown function (DUF4200) 95.37
KOG0995|consensus 581 95.32
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 95.26
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.24
COG5152259 Uncharacterized conserved protein, contains RING a 95.23
KOG4172|consensus62 95.22
PF05911769 DUF869: Plant protein of unknown function (DUF869) 95.15
KOG4807|consensus593 95.07
PF13514 1111 AAA_27: AAA domain 95.06
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 95.06
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 95.03
COG4477 570 EzrA Negative regulator of septation ring formatio 95.02
PF13870177 DUF4201: Domain of unknown function (DUF4201) 95.02
KOG0804|consensus493 95.01
KOG0804|consensus493 94.93
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 94.92
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 94.91
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.86
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.84
PF04641260 Rtf2: Rtf2 RING-finger 94.83
PF13851201 GAS: Growth-arrest specific micro-tubule binding 94.83
PRK11519 719 tyrosine kinase; Provisional 94.81
PF10186302 Atg14: UV radiation resistance protein and autopha 94.8
PF10186302 Atg14: UV radiation resistance protein and autopha 94.8
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.8
KOG0249|consensus 916 94.79
KOG1853|consensus333 94.77
PF15066527 CAGE1: Cancer-associated gene protein 1 family 94.76
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 94.71
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 94.69
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 94.68
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.66
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 94.63
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 94.6
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.6
KOG1937|consensus521 94.56
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.55
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.53
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 94.53
KOG2660|consensus 331 94.48
COG3883265 Uncharacterized protein conserved in bacteria [Fun 94.45
KOG0946|consensus970 94.43
KOG4643|consensus 1195 94.41
PRK10246 1047 exonuclease subunit SbcC; Provisional 94.37
PRK10884206 SH3 domain-containing protein; Provisional 94.34
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 94.34
PF05010207 TACC: Transforming acidic coiled-coil-containing p 94.23
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 94.21
KOG0163|consensus 1259 94.2
KOG4628|consensus348 94.13
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 94.1
COG3206458 GumC Uncharacterized protein involved in exopolysa 94.0
KOG0946|consensus970 93.99
KOG0962|consensus 1294 93.99
KOG0962|consensus 1294 93.99
PRK10476346 multidrug resistance protein MdtN; Provisional 93.89
PRK10698222 phage shock protein PspA; Provisional 93.82
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.73
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.67
PF04912388 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit 93.66
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.6
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.55
KOG0288|consensus 459 93.53
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 93.53
COG3206458 GumC Uncharacterized protein involved in exopolysa 93.51
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 93.5
KOG0018|consensus 1141 93.5
PRK15178434 Vi polysaccharide export inner membrane protein Ve 93.47
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 93.45
TIGR00634563 recN DNA repair protein RecN. All proteins in this 93.41
KOG1003|consensus205 93.4
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 93.36
PF13514 1111 AAA_27: AAA domain 93.35
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 93.34
KOG0249|consensus 916 93.31
TIGR02977219 phageshock_pspA phage shock protein A. Members of 93.26
KOG1853|consensus 333 93.21
PF13166 712 AAA_13: AAA domain 93.19
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 93.15
PF00901 508 Orbi_VP5: Orbivirus outer capsid protein VP5; Inte 93.15
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 93.13
PRK10869 553 recombination and repair protein; Provisional 93.12
PF15397258 DUF4618: Domain of unknown function (DUF4618) 93.09
KOG4593|consensus 716 93.05
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 93.05
KOG0825|consensus 1134 93.03
KOG0243|consensus 1041 93.0
KOG3039|consensus303 92.92
KOG0243|consensus 1041 92.92
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 92.81
KOG0288|consensus 459 92.78
PF15294278 Leu_zip: Leucine zipper 92.77
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.64
KOG1265|consensus1189 92.63
PRK1542279 septal ring assembly protein ZapB; Provisional 92.51
KOG1937|consensus521 92.38
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.32
KOG1813|consensus313 92.3
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 92.26
KOG4360|consensus 596 92.23
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 92.09
TIGR00618 1042 sbcc exonuclease SbcC. This family is based on the 92.02
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 91.91
COG5185 622 HEC1 Protein involved in chromosome segregation, i 91.56
KOG0993|consensus542 91.52
KOG0297|consensus 391 91.46
KOG3564|consensus 604 91.35
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 91.28
KOG1571|consensus355 91.26
PF13949296 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI 91.26
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 91.24
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 91.18
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.13
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 91.12
PF15066527 CAGE1: Cancer-associated gene protein 1 family 90.95
COG3524372 KpsE Capsule polysaccharide export protein [Cell e 90.82
cd07623224 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of 90.75
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 90.75
KOG1002|consensus 791 90.74
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 90.66
KOG1785|consensus 563 90.63
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 90.59
KOG4159|consensus 398 90.57
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 90.56
KOG0298|consensus 1394 90.5
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.44
PRK12704 520 phosphodiesterase; Provisional 90.43
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 90.4
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 90.39
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 90.35
PF09486158 HrpB7: Bacterial type III secretion protein (HrpB7 90.27
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 90.25
PRK10361 475 DNA recombination protein RmuC; Provisional 90.16
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 90.11
PRK10884206 SH3 domain-containing protein; Provisional 90.08
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 89.91
KOG4265|consensus349 89.68
KOG2129|consensus 552 89.67
KOG1039|consensus 344 89.58
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 89.48
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 89.41
KOG1850|consensus391 89.4
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 89.34
KOG0824|consensus 324 89.33
PRK03598331 putative efflux pump membrane fusion protein; Prov 89.21
PF14362301 DUF4407: Domain of unknown function (DUF4407) 89.0
PF04912388 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit 88.97
PLN031881320 kinesin-12 family protein; Provisional 88.83
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 88.8
COG2433652 Uncharacterized conserved protein [Function unknow 88.77
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 88.68
COG3883265 Uncharacterized protein conserved in bacteria [Fun 88.67
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 88.67
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 88.66
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 88.55
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 88.55
KOG4677|consensus 554 88.51
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 88.16
PF13870177 DUF4201: Domain of unknown function (DUF4201) 88.02
KOG1003|consensus205 87.83
PF13166 712 AAA_13: AAA domain 87.79
KOG0982|consensus502 87.76
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 87.44
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 87.34
COG5283 1213 Phage-related tail protein [Function unknown] 87.32
COG4717 984 Uncharacterized conserved protein [Function unknow 87.28
PF12252 1439 SidE: Dot/Icm substrate protein; InterPro: IPR0210 87.21
COG307479 Uncharacterized protein conserved in bacteria [Fun 87.08
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 87.03
KOG2930|consensus114 86.89
PRK11519 719 tyrosine kinase; Provisional 86.88
KOG4593|consensus 716 86.83
cd07664234 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S 86.8
KOG2751|consensus447 86.8
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 86.72
PRK00409782 recombination and DNA strand exchange inhibitor pr 86.62
KOG2129|consensus 552 86.58
KOG1962|consensus216 86.49
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 86.46
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 86.34
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 86.24
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.22
KOG1941|consensus518 85.9
COG2433652 Uncharacterized conserved protein [Function unknow 85.85
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 85.64
PF05300187 DUF737: Protein of unknown function (DUF737); Inte 85.49
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 85.46
KOG4275|consensus350 85.38
TIGR02231 525 conserved hypothetical protein. This family consis 85.27
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 85.11
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 85.05
PRK10869 553 recombination and repair protein; Provisional 84.99
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 84.83
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 84.73
KOG4460|consensus741 84.72
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 84.58
KOG3091|consensus508 84.44
KOG0826|consensus357 84.29
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 84.22
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 84.2
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 84.16
KOG3970|consensus 299 84.07
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 84.01
KOG4302|consensus 660 84.01
KOG4572|consensus 1424 84.0
PRK15374 593 pathogenicity island 1 effector protein SipB; Prov 83.98
KOG4438|consensus446 83.92
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 83.89
KOG1814|consensus 445 83.83
PRK10698222 phage shock protein PspA; Provisional 83.74
KOG1899|consensus 861 83.67
KOG4787|consensus 852 83.62
KOG2114|consensus933 82.95
PF06248 593 Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 82.86
KOG4809|consensus654 82.85
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.71
cd08915342 V_Alix_like Protein-interacting V-domain of mammal 82.68
KOG2264|consensus 907 82.63
KOG1962|consensus216 82.6
PRK15136390 multidrug efflux system protein EmrA; Provisional 82.58
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 82.56
KOG4302|consensus 660 82.37
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 82.18
KOG0742|consensus 630 82.09
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 82.0
TIGR00618 1042 sbcc exonuclease SbcC. This family is based on the 81.99
PRK09343121 prefoldin subunit beta; Provisional 81.96
PLN02939 977 transferase, transferring glycosyl groups 81.86
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 81.82
KOG2817|consensus394 81.71
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 81.55
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 81.52
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 81.36
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 81.01
KOG1001|consensus 674 80.84
PF05529192 Bap31: B-cell receptor-associated protein 31-like 80.83
TIGR03545 555 conserved hypothetical protein TIGR03545. This mod 80.76
KOG4552|consensus272 80.53
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 80.46
PRK00409782 recombination and DNA strand exchange inhibitor pr 80.36
KOG4403|consensus575 80.06
>KOG0978|consensus Back     alignment and domain information
Probab=100.00  E-value=1.3e-44  Score=394.36  Aligned_cols=271  Identities=42%  Similarity=0.529  Sum_probs=243.2

Q ss_pred             eecchhhhHHH-HHHhHhhhhcCCccccc-----ccccH-HHHHHHHHHHhhhHHHHhhcCcHHHHHHHHHHHHHHHHHH
Q psy10797        241 SICTSAFQMSF-YKSRWFDFRSLSDSASN-----IYGSL-EFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQ  313 (517)
Q Consensus       241 ~~~~a~~~~~a-l~~~l~~~~~~~d~~~~-----i~~e~-elr~rlk~l~e~~~k~rqklad~Eal~rL~~lE~EieeLr  313 (517)
                      .+..+.+++.. ++..++++.+.|+.+.+     ...|. .++++++.+.+.++.+.++++++|+.++|+..+++++.|+
T Consensus       364 di~~~k~el~~~~~~~le~~k~~~ke~~~~~~~ka~~E~e~l~q~l~~~~k~e~~e~~k~~~d~~~r~~~~~~~~~e~Lq  443 (698)
T KOG0978|consen  364 DILVAKSELLKTNELRLEMLKSLLKEQRDKLQVKARAETESLLQRLKALDKEERSEIRKQALDDAERQIRQVEELSEELQ  443 (698)
T ss_pred             hHHHHHHHHHHHHHHHHHHHhCCCHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHHHHHHHHH
Confidence            34556667766 88999999999999888     55555 8999999999999999999999999999999999999998


Q ss_pred             HHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHH
Q psy10797        314 KQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQI  393 (517)
Q Consensus       314 ~kL~s~eqe~eALlsEIEsIgqAyEdmQeQNqrklqqL~EkED~n~KL~aEK~KAdQKyfaamreKdaLe~Evk~Lk~Ql  393 (517)
                      ...+..+    +|.+|+++||+||++||+||++++++++++||+|+|||.|++++.|+|+.++++++.++.++.+++.++
T Consensus       444 k~~~~~k----~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~  519 (698)
T KOG0978|consen  444 KKEKNFK----CLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASV  519 (698)
T ss_pred             HHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            8776655    999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------------------H
Q psy10797        394 EAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVI---------------------I  452 (517)
Q Consensus       394 ekQ~e~I~kLeE~Er~L~~kLs~lEKEL~~lkqale~~kkk~~E~sq~~~dLk~qLee---------------------l  452 (517)
                      ++....|.+|+|+++.++.....+.+++..++++++.+++++.++.+...+|+.+++.                     +
T Consensus       520 ~~~~~~i~~leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~ele~~  599 (698)
T KOG0978|consen  520 DKLELKIGKLEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELELEIE  599 (698)
T ss_pred             HHHHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999987761                     0


Q ss_pred             Hhc---chhh-------hhcccc-------------------cccccccccccccc-----cccccchhhHHHHHhhhcc
Q psy10797        453 YTN---GPAR-------LEFGKD-------------------REFSAKFVNFRRKS-----YFFVEFLDCLRTRYETRQR  498 (517)
Q Consensus       453 ~Ek---~~a~-------LEKLKk-------------------~e~kC~iC~~r~K~-----CgHvFC~~CIq~rl~tR~R  498 (517)
                      ..+   .+.+       ++++++                   ..++|++|++||||     |||+||.+||++||++|+|
T Consensus       600 ~~k~~rleEE~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqR  679 (698)
T KOG0978|consen  600 KFKRKRLEEELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQR  679 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcC
Confidence            011   1111       333322                   34689999999999     9999999999999999999


Q ss_pred             CCCCCCC--CCCCceEeec
Q psy10797        499 KCPKCNA--KANDYHRLYL  515 (517)
Q Consensus       499 KCP~C~~--~~~Dv~rIyl  515 (517)
                      |||+||+  |+|||++|||
T Consensus       680 KCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  680 KCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             CCCCCCCCCCcccccccCC
Confidence            9999999  9999999997



>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0982|consensus Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>KOG4360|consensus Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>KOG1103|consensus Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0249|consensus Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1937|consensus Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG0962|consensus Back     alignment and domain information
>KOG0962|consensus Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG1003|consensus Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0249|consensus Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>PF00901 Orbi_VP5: Orbivirus outer capsid protein VP5; InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>KOG4593|consensus Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG1937|consensus Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>KOG4360|consensus Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0993|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG3564|consensus Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>COG3524 KpsE Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG2129|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>KOG1850|consensus Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PF14362 DUF4407: Domain of unknown function (DUF4407) Back     alignment and domain information
>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG4677|consensus Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG1003|consensus Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>KOG0982|consensus Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>COG5283 Phage-related tail protein [Function unknown] Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>KOG4593|consensus Back     alignment and domain information
>cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 Back     alignment and domain information
>KOG2751|consensus Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG2129|consensus Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF05300 DUF737: Protein of unknown function (DUF737); InterPro: IPR007964 This family consists of several uncharacterised mammalian proteins of unknown function Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>KOG3091|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>KOG4302|consensus Back     alignment and domain information
>KOG4572|consensus Back     alignment and domain information
>PRK15374 pathogenicity island 1 effector protein SipB; Provisional Back     alignment and domain information
>KOG4438|consensus Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>KOG1899|consensus Back     alignment and domain information
>KOG4787|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells Back     alignment and domain information
>KOG4809|consensus Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains Back     alignment and domain information
>KOG2264|consensus Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4302|consensus Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>TIGR03545 conserved hypothetical protein TIGR03545 Back     alignment and domain information
>KOG4552|consensus Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG4403|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 2e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 8e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 2e-07
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2l7b_A307 Apolipoprotein E, APO-E; lipid transport, atherosc 4e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-04
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 1e-05
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 3e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-05
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 6e-05
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 5e-04
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 5e-04
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
 Score = 56.3 bits (136), Expect = 2e-08
 Identities = 32/176 (18%), Positives = 70/176 (39%), Gaps = 14/176 (7%)

Query: 279  ACVVRDSKRDERKKLADE----EAMRKIK-QLEDQTHQLQKQVATHKQEEEALLNEMEVT 333
             C  R   + E KKL  E    E  +K+   LE++  QLQ+++     E+      +   
Sbjct: 895  CCYRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKI----DEQNKEYKSLL-- 948

Query: 334  GQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQI 393
             +   +++   S   ++LR   +       E   +       +EE   LR+++     + 
Sbjct: 949  -EKMNNLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKELHQTQTEK 1007

Query: 394  EAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHL 449
            + +     K + +   L + L   E+   L+ +  +LN+R   ++ +    ++  L
Sbjct: 1008 KTIEEWADKYKHETEQLVSELK--EQNTLLKTEKEELNRRIHDQAKEITETMEKKL 1061


>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} Length = 307 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Length = 107 Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.82
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.78
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.75
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.75
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.68
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.6
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.59
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.59
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.56
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.54
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.54
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.52
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.49
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.48
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.47
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.47
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.45
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.43
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.43
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.42
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.42
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.4
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.39
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.37
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.37
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.35
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.34
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.34
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.34
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.33
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.32
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.32
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.32
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.31
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.31
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.29
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.26
2ect_A78 Ring finger protein 126; metal binding protein, st 98.26
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.24
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.23
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.22
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.2
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.2
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.17
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.16
2ea5_A68 Cell growth regulator with ring finger domain prot 98.15
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.12
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.12
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.09
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.09
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.05
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.03
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.02
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.0
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.99
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.97
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.96
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.94
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.9
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.89
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.85
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.77
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.65
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 97.61
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.54
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 97.47
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.45
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.44
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.38
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.37
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 97.21
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 97.03
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.95
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.92
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.89
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.83
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 96.66
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.59
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.24
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.04
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 95.98
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.97
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 95.9
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 95.68
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.53
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 95.38
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.3
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 95.19
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 95.01
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 94.63
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.54
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 94.49
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 94.45
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.31
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 94.19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 94.17
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 94.1
3iyk_A 526 VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu 93.2
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 93.09
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 92.85
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 92.4
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 92.33
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 92.27
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 92.08
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 92.08
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 92.01
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 91.61
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 91.53
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 91.52
3cve_A72 Homer protein homolog 1; coiled coil, alternative 91.49
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 91.27
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 90.92
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.9
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 90.42
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.34
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 90.2
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 89.95
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 89.83
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 89.65
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 89.13
2v4h_A110 NF-kappa-B essential modulator; transcription, met 88.81
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 88.72
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 88.43
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 88.28
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.81
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 87.65
3haj_A 486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 87.09
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 86.98
3r6n_A 450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 86.91
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 86.59
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 86.05
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 85.83
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 85.81
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 85.23
2xs1_A704 Programmed cell death 6-interacting protein; prote 84.43
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 84.31
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 84.1
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 83.94
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 83.34
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 82.97
4fla_A152 Regulation of nuclear PRE-mRNA domain-containing 1 82.93
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 82.56
1x8y_A86 Lamin A/C; structural protein, intermediate filame 82.41
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 82.37
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 82.19
2efl_A305 Formin-binding protein 1; EFC domain, structural g 82.14
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 81.59
3nw0_A238 Non-structural maintenance of chromosomes element 81.36
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 81.25
3qwe_A279 GMIP, GEM-interacting protein; structural genomics 81.19
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 81.19
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
Probab=98.82  E-value=1.8e-09  Score=82.18  Aligned_cols=48  Identities=23%  Similarity=0.438  Sum_probs=42.2

Q ss_pred             ccccccccccccc------------cccccchhhHHHHHhhhccCCCCCCC--CCCCceEeec
Q psy10797        467 EFSAKFVNFRRKS------------YFFVEFLDCLRTRYETRQRKCPKCNA--KANDYHRLYL  515 (517)
Q Consensus       467 e~kC~iC~~r~K~------------CgHvFC~~CIq~rl~tR~RKCP~C~~--~~~Dv~rIyl  515 (517)
                      .+.|+||.+.+++            |||+||..||++|++. ..+||.|++  ...|++++||
T Consensus         3 ~~~C~IC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~-~~~CP~Cr~~~~~~~~~~~~l   64 (64)
T 2xeu_A            3 MVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKN-ANTCPTCRKKINHKRYHPIYI   64 (64)
T ss_dssp             CCBCTTTCCBHHHHHHTTCCEEEETTSCEEEHHHHHHHHHH-CSBCTTTCCBCTTTCEEECCC
T ss_pred             CCCCCccChhhhCccccCCCEEeCCCCCchhHHHHHHHHHc-CCCCCCCCccCCccceeeeeC
Confidence            5789999985431            9999999999999976 779999999  8899999997



>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 517
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.0 bits (90), Expect = 0.001
 Identities = 22/122 (18%), Positives = 46/122 (37%), Gaps = 4/122 (3%)

Query: 285 SKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQN 344
            K  E    A  +  + + + E +    + +  + +   + L        Q  E  +   
Sbjct: 182 LKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSY 241

Query: 345 SRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLE 404
              L+QL EK + +   + +  +     KL +E++  L+E  Q    +   M   I+ L+
Sbjct: 242 QEHLKQLTEKMENDRVQLLKEQERTLALKL-QEQEQLLKEGFQK---ESRIMKNEIQDLQ 297

Query: 405 EK 406
            K
Sbjct: 298 TK 299


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.84
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.72
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.62
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.53
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.46
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.44
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.37
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.32
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.27
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.08
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.08
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.86
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.75
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.56
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.48
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.26
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 94.54
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 93.84
d1f5na1300 Interferon-induced guanylate-binding protein 1 (GB 91.42
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 88.44
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 83.98
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.84  E-value=4.2e-10  Score=92.68  Aligned_cols=46  Identities=13%  Similarity=0.218  Sum_probs=41.9

Q ss_pred             cccccccccccccc-----cccccchhhHHHHHhhhccCCCCCCC--CCCCce
Q psy10797        466 REFSAKFVNFRRKS-----YFFVEFLDCLRTRYETRQRKCPKCNA--KANDYH  511 (517)
Q Consensus       466 ~e~kC~iC~~r~K~-----CgHvFC~~CIq~rl~tR~RKCP~C~~--~~~Dv~  511 (517)
                      .++.|+||.+.+++     |||+||..||++|++.+.++||.|+.  +..|+.
T Consensus        22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~   74 (86)
T d1rmda2          22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLE   74 (86)
T ss_dssp             HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCB
T ss_pred             cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhcc
Confidence            56899999999988     99999999999999999999999999  667764



>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure