Psyllid ID: psy10797
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 517 | ||||||
| 193678945 | 953 | PREDICTED: e3 ubiquitin-protein ligase B | 0.520 | 0.282 | 0.527 | 7e-78 | |
| 345483701 | 955 | PREDICTED: E3 ubiquitin-protein ligase B | 0.471 | 0.255 | 0.554 | 3e-77 | |
| 350402387 | 957 | PREDICTED: E3 ubiquitin-protein ligase B | 0.471 | 0.254 | 0.551 | 2e-76 | |
| 383857052 | 957 | PREDICTED: E3 ubiquitin-protein ligase B | 0.471 | 0.254 | 0.551 | 2e-76 | |
| 328778821 | 930 | PREDICTED: e3 ubiquitin-protein ligase B | 0.471 | 0.262 | 0.551 | 2e-76 | |
| 340711825 | 957 | PREDICTED: e3 ubiquitin-protein ligase B | 0.471 | 0.254 | 0.551 | 2e-76 | |
| 307199111 | 957 | E3 ubiquitin-protein ligase Bre1 [Harpeg | 0.471 | 0.254 | 0.548 | 7e-76 | |
| 332020263 | 676 | E3 ubiquitin-protein ligase Bre1 [Acromy | 0.471 | 0.360 | 0.548 | 1e-75 | |
| 321469893 | 958 | hypothetical protein DAPPUDRAFT_188104 [ | 0.450 | 0.243 | 0.555 | 1e-74 | |
| 307180966 | 964 | E3 ubiquitin-protein ligase Bre1 [Campon | 0.471 | 0.253 | 0.534 | 1e-73 |
| >gi|193678945|ref|XP_001949533.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 297 bits (761), Expect = 7e-78, Method: Compositional matrix adjust.
Identities = 174/330 (52%), Positives = 204/330 (61%), Gaps = 61/330 (18%)
Query: 249 MSFYKSRWFDFRS---LSDSASNIYGSLEFRKFACV-VRDSKRDERKKLADEEAMRKIKQ 304
+ YK D R L + + LE K A +++ KR+ERKKLADE+A+RKIKQ
Sbjct: 624 LDMYKGVSKDQRDKVQLMAAEKKLRAELEEAKQALKKIQEGKREERKKLADEDALRKIKQ 683
Query: 305 LEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTE 364
LE+ QLQKQVATHKQEEEA+L+EMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLMTE
Sbjct: 684 LEEHIVQLQKQVATHKQEEEAMLSEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMTE 743
Query: 365 RIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLTNAEKELHLR 424
RIKSNQLHK+AREE DTL+E ++ L+ Q+E +T +RKLEEKER LQ L EKE +R
Sbjct: 744 RIKSNQLHKMAREETDTLKELIKTLTNQVEMTNTVVRKLEEKERILQNSLATVEKECSIR 803
Query: 425 NQAMDLNKRKAIESAQSAADLKLHL------------VIIYTNGPARLEFGKDREFSAKF 472
QAM+++KRKAIESAQSAADLKLHL V+ E K + +
Sbjct: 804 QQAMEMHKRKAIESAQSAADLKLHLDKYHAQMKEAQQVVTEKTSALEAEAYKTKRLQEEI 863
Query: 473 VNFRRKS-------------YFFVEFL------------------------------DCL 489
V RRK+ VE + DCL
Sbjct: 864 VQLRRKTERMKKIEQAGTLDEVMVEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCL 923
Query: 490 RTRYETRQRKCPKCNA--KANDYHRLYLGS 517
RTRYETRQRKCPKCNA ANDYHRLYLGS
Sbjct: 924 RTRYETRQRKCPKCNATFGANDYHRLYLGS 953
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345483701|ref|XP_001601663.2| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350402387|ref|XP_003486466.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383857052|ref|XP_003704020.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328778821|ref|XP_625025.3| PREDICTED: e3 ubiquitin-protein ligase Bre1, partial [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340711825|ref|XP_003394469.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307199111|gb|EFN79821.1| E3 ubiquitin-protein ligase Bre1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332020263|gb|EGI60697.1| E3 ubiquitin-protein ligase Bre1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|321469893|gb|EFX80871.1| hypothetical protein DAPPUDRAFT_188104 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|307180966|gb|EFN68754.1| E3 ubiquitin-protein ligase Bre1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 517 | ||||||
| UNIPROTKB|F8W8Z4 | 693 | RNF40 "E3 ubiquitin-protein li | 0.423 | 0.316 | 0.543 | 4.4e-52 | |
| ZFIN|ZDB-GENE-030131-6607 | 1004 | rnf40 "ring finger protein 40" | 0.340 | 0.175 | 0.607 | 9.2e-52 | |
| RGD|628638 | 1002 | Rnf40 "ring finger protein 40, | 0.408 | 0.210 | 0.56 | 2.2e-51 | |
| UNIPROTKB|H3BP71 | 961 | RNF40 "E3 ubiquitin-protein li | 0.423 | 0.227 | 0.543 | 3e-51 | |
| UNIPROTKB|O75150 | 1001 | RNF40 "E3 ubiquitin-protein li | 0.423 | 0.218 | 0.543 | 3.6e-51 | |
| UNIPROTKB|Q5RAU7 | 1001 | RNF40 "E3 ubiquitin-protein li | 0.423 | 0.218 | 0.543 | 3.6e-51 | |
| UNIPROTKB|E2R1L5 | 1001 | RNF40 "Uncharacterized protein | 0.423 | 0.218 | 0.543 | 3.6e-51 | |
| MGI|MGI:2142048 | 1001 | Rnf40 "ring finger protein 40" | 0.423 | 0.218 | 0.543 | 3.6e-51 | |
| UNIPROTKB|E1BCI2 | 1001 | RNF40 "Uncharacterized protein | 0.408 | 0.210 | 0.554 | 4.6e-51 | |
| RGD|1311936 | 973 | Rnf20 "ring finger protein 20, | 0.423 | 0.225 | 0.519 | 5.2e-51 |
| UNIPROTKB|F8W8Z4 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 540 (195.1 bits), Expect = 4.4e-52, P = 4.4e-52
Identities = 125/230 (54%), Positives = 156/230 (67%)
Query: 274 EFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVT 333
E R + + R E KK+ADE+A+R+I+Q E+Q LQ+++ KQEEEALL+EM+VT
Sbjct: 394 ELRSRIRELEERDRRESKKIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVT 453
Query: 334 GQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQI 393
GQAFEDMQEQN RLLQQLREKDDANFKLM+ERIK+NQ+HKL REEKD L EQV L Q+
Sbjct: 454 GQAFEDMQEQNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQV 513
Query: 394 EAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVIIY 453
+A ++KLEEKER LQ L EKEL LR+QA++LNKRKA+E+AQ A DLK+ L +
Sbjct: 514 DAQLLTVQKLEEKERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQ 573
Query: 454 TN----GPARLEFGKDREFSAKFVNFRRKSYFFVEFLDCLRTRYETRQRK 499
T P E RE F N +R E + LR + E +QRK
Sbjct: 574 TRLREIQPCLAESRAARE-KESF-NLKRAQ----EDISRLRRKLE-KQRK 616
|
|
| ZFIN|ZDB-GENE-030131-6607 rnf40 "ring finger protein 40" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|628638 Rnf40 "ring finger protein 40, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BP71 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75150 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RAU7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R1L5 RNF40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2142048 Rnf40 "ring finger protein 40" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BCI2 RNF40 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1311936 Rnf20 "ring finger protein 20, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 517 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-07 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 1e-05 | |
| COG1322 | 448 | COG1322, COG1322, Predicted nuclease of restrictio | 4e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 1e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 2e-04 | |
| TIGR03321 | 246 | TIGR03321, alt_F1F0_F0_B, alternate F1F0 ATPase, F | 2e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-04 | |
| pfam08647 | 96 | pfam08647, BRE1, BRE1 E3 ubiquitin ligase | 2e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 6e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02338 | 110 | TIGR02338, gimC_beta, prefoldin, beta subunit, arc | 0.001 | |
| pfam10168 | 717 | pfam10168, Nup88, Nuclear pore component | 0.001 | |
| pfam00430 | 132 | pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) | 0.001 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| pfam06008 | 263 | pfam06008, Laminin_I, Laminin Domain I | 0.002 | |
| pfam11180 | 192 | pfam11180, DUF2968, Protein of unknown function (D | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| pfam00038 | 312 | pfam00038, Filament, Intermediate filament protein | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| MTH00059 | 289 | MTH00059, ND2, NADH dehydrogenase subunit 2; Provi | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 55.9 bits (135), Expect = 3e-08
Identities = 32/151 (21%), Positives = 76/151 (50%)
Query: 296 EEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKD 355
EE R++++LE Q +L++++A ++E E L + +E + E+++E+ L ++L E +
Sbjct: 705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELE 764
Query: 356 DANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLEEKERFLQTVLT 415
+ L K + + E++ L+E+++ L ++E + LE + L+
Sbjct: 765 EELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRE 824
Query: 416 NAEKELHLRNQAMDLNKRKAIESAQSAADLK 446
E+E+ + ++ + K E + +L+
Sbjct: 825 RLEQEIEELEEEIEELEEKLDELEEELEELE 855
|
Length = 1163 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|132364 TIGR03321, alt_F1F0_F0_B, alternate F1F0 ATPase, F0 subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|192111 pfam08647, BRE1, BRE1 E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|131391 TIGR02338, gimC_beta, prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|118696 pfam10168, Nup88, Nuclear pore component | Back alignment and domain information |
|---|
| >gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|218852 pfam06008, Laminin_I, Laminin Domain I | Back alignment and domain information |
|---|
| >gnl|CDD|221016 pfam11180, DUF2968, Protein of unknown function (DUF2968) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|177131 MTH00059, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 517 | |||
| KOG0978|consensus | 698 | 100.0 | ||
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 99.72 | |
| KOG0320|consensus | 187 | 99.05 | ||
| KOG0978|consensus | 698 | 98.47 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.46 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.42 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.41 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.39 | |
| KOG0823|consensus | 230 | 98.37 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.37 | |
| KOG0317|consensus | 293 | 98.35 | ||
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.29 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.28 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.22 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.21 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.2 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.16 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.13 | |
| KOG0971|consensus | 1243 | 98.07 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.06 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.03 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.01 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 98.01 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.0 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.0 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.99 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.95 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.91 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.9 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.87 | |
| KOG0161|consensus | 1930 | 97.87 | ||
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.82 | |
| KOG2164|consensus | 513 | 97.82 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.8 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.77 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.72 | |
| KOG0161|consensus | 1930 | 97.71 | ||
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.71 | |
| KOG0963|consensus | 629 | 97.7 | ||
| KOG0250|consensus | 1074 | 97.7 | ||
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.69 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.69 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.66 | |
| KOG0250|consensus | 1074 | 97.64 | ||
| KOG0996|consensus | 1293 | 97.59 | ||
| KOG1029|consensus | 1118 | 97.57 | ||
| PRK09039 | 343 | hypothetical protein; Validated | 97.55 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.55 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.51 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.48 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.48 | |
| KOG4673|consensus | 961 | 97.48 | ||
| KOG1029|consensus | 1118 | 97.45 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.42 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.4 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.39 | |
| KOG0971|consensus | 1243 | 97.39 | ||
| KOG0976|consensus | 1265 | 97.38 | ||
| KOG0996|consensus | 1293 | 97.37 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.36 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.34 | |
| KOG0933|consensus | 1174 | 97.28 | ||
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.28 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.28 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.27 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.26 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.21 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.18 | |
| KOG0612|consensus | 1317 | 97.18 | ||
| KOG0977|consensus | 546 | 97.17 | ||
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.16 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.15 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.15 | |
| KOG4674|consensus | 1822 | 97.14 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.13 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.13 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.12 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.11 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.1 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.09 | |
| KOG0933|consensus | 1174 | 97.09 | ||
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.07 | |
| KOG0999|consensus | 772 | 97.06 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.01 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.01 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.99 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 96.99 | |
| KOG0994|consensus | 1758 | 96.99 | ||
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.97 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.97 | |
| KOG0982|consensus | 502 | 96.96 | ||
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.95 | |
| KOG0980|consensus | 980 | 96.93 | ||
| KOG4360|consensus | 596 | 96.92 | ||
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.92 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.89 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.88 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.87 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.84 | |
| KOG0980|consensus | 980 | 96.81 | ||
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.81 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.81 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.8 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.8 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.79 | |
| KOG0964|consensus | 1200 | 96.78 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.76 | |
| KOG4674|consensus | 1822 | 96.73 | ||
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.7 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.7 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.66 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.66 | |
| KOG4673|consensus | 961 | 96.65 | ||
| KOG0976|consensus | 1265 | 96.63 | ||
| KOG2177|consensus | 386 | 96.61 | ||
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.6 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 96.59 | |
| KOG0018|consensus | 1141 | 96.56 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.55 | |
| KOG0311|consensus | 381 | 96.54 | ||
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.53 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.52 | |
| KOG0999|consensus | 772 | 96.48 | ||
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.44 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 96.43 | |
| KOG0963|consensus | 629 | 96.42 | ||
| KOG0995|consensus | 581 | 96.36 | ||
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.32 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 96.32 | |
| KOG0977|consensus | 546 | 96.3 | ||
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.3 | |
| KOG0612|consensus | 1317 | 96.3 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.29 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.21 | |
| KOG0979|consensus | 1072 | 96.18 | ||
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.17 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.16 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.14 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.11 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.1 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.09 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.07 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.07 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 96.07 | |
| KOG0287|consensus | 442 | 96.01 | ||
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.98 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.92 | |
| KOG0964|consensus | 1200 | 95.92 | ||
| KOG4643|consensus | 1195 | 95.88 | ||
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.86 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.86 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 95.85 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.82 | |
| KOG0979|consensus | 1072 | 95.82 | ||
| KOG4807|consensus | 593 | 95.8 | ||
| KOG1103|consensus | 561 | 95.79 | ||
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 95.79 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.74 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.73 | |
| KOG0802|consensus | 543 | 95.65 | ||
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.55 | |
| KOG2879|consensus | 298 | 95.51 | ||
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.5 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 95.5 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 95.49 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 95.37 | |
| KOG0995|consensus | 581 | 95.32 | ||
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.26 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.24 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.23 | |
| KOG4172|consensus | 62 | 95.22 | ||
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.15 | |
| KOG4807|consensus | 593 | 95.07 | ||
| PF13514 | 1111 | AAA_27: AAA domain | 95.06 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 95.06 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 95.03 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 95.02 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.02 | |
| KOG0804|consensus | 493 | 95.01 | ||
| KOG0804|consensus | 493 | 94.93 | ||
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.92 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 94.91 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.86 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 94.84 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.83 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.83 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 94.81 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 94.8 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 94.8 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.8 | |
| KOG0249|consensus | 916 | 94.79 | ||
| KOG1853|consensus | 333 | 94.77 | ||
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 94.76 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.71 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.69 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 94.68 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 94.66 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 94.63 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 94.6 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.6 | |
| KOG1937|consensus | 521 | 94.56 | ||
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.55 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 94.53 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 94.53 | |
| KOG2660|consensus | 331 | 94.48 | ||
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 94.45 | |
| KOG0946|consensus | 970 | 94.43 | ||
| KOG4643|consensus | 1195 | 94.41 | ||
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 94.37 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.34 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.34 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 94.23 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 94.21 | |
| KOG0163|consensus | 1259 | 94.2 | ||
| KOG4628|consensus | 348 | 94.13 | ||
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.1 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 94.0 | |
| KOG0946|consensus | 970 | 93.99 | ||
| KOG0962|consensus | 1294 | 93.99 | ||
| KOG0962|consensus | 1294 | 93.99 | ||
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 93.89 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 93.82 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.73 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 93.67 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 93.66 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 93.6 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.55 | |
| KOG0288|consensus | 459 | 93.53 | ||
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 93.53 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 93.51 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.5 | |
| KOG0018|consensus | 1141 | 93.5 | ||
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 93.47 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 93.45 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 93.41 | |
| KOG1003|consensus | 205 | 93.4 | ||
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.36 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.35 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 93.34 | |
| KOG0249|consensus | 916 | 93.31 | ||
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 93.26 | |
| KOG1853|consensus | 333 | 93.21 | ||
| PF13166 | 712 | AAA_13: AAA domain | 93.19 | |
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 93.15 | |
| PF00901 | 508 | Orbi_VP5: Orbivirus outer capsid protein VP5; Inte | 93.15 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 93.13 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 93.12 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 93.09 | |
| KOG4593|consensus | 716 | 93.05 | ||
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.05 | |
| KOG0825|consensus | 1134 | 93.03 | ||
| KOG0243|consensus | 1041 | 93.0 | ||
| KOG3039|consensus | 303 | 92.92 | ||
| KOG0243|consensus | 1041 | 92.92 | ||
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 92.81 | |
| KOG0288|consensus | 459 | 92.78 | ||
| PF15294 | 278 | Leu_zip: Leucine zipper | 92.77 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.64 | |
| KOG1265|consensus | 1189 | 92.63 | ||
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 92.51 | |
| KOG1937|consensus | 521 | 92.38 | ||
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 92.32 | |
| KOG1813|consensus | 313 | 92.3 | ||
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 92.26 | |
| KOG4360|consensus | 596 | 92.23 | ||
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 92.09 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 92.02 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.91 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 91.56 | |
| KOG0993|consensus | 542 | 91.52 | ||
| KOG0297|consensus | 391 | 91.46 | ||
| KOG3564|consensus | 604 | 91.35 | ||
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 91.28 | |
| KOG1571|consensus | 355 | 91.26 | ||
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 91.26 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 91.24 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 91.18 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 91.13 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 91.12 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 90.95 | |
| COG3524 | 372 | KpsE Capsule polysaccharide export protein [Cell e | 90.82 | |
| cd07623 | 224 | BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of | 90.75 | |
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 90.75 | |
| KOG1002|consensus | 791 | 90.74 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 90.66 | |
| KOG1785|consensus | 563 | 90.63 | ||
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 90.59 | |
| KOG4159|consensus | 398 | 90.57 | ||
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 90.56 | |
| KOG0298|consensus | 1394 | 90.5 | ||
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 90.44 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 90.43 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 90.4 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 90.39 | |
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 90.35 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 90.27 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 90.25 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 90.16 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 90.11 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 90.08 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 89.91 | |
| KOG4265|consensus | 349 | 89.68 | ||
| KOG2129|consensus | 552 | 89.67 | ||
| KOG1039|consensus | 344 | 89.58 | ||
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 89.48 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 89.41 | |
| KOG1850|consensus | 391 | 89.4 | ||
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 89.34 | |
| KOG0824|consensus | 324 | 89.33 | ||
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 89.21 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 89.0 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 88.97 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 88.83 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 88.8 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 88.77 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 88.68 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 88.67 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 88.67 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 88.66 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 88.55 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 88.55 | |
| KOG4677|consensus | 554 | 88.51 | ||
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 88.16 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 88.02 | |
| KOG1003|consensus | 205 | 87.83 | ||
| PF13166 | 712 | AAA_13: AAA domain | 87.79 | |
| KOG0982|consensus | 502 | 87.76 | ||
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 87.44 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 87.34 | |
| COG5283 | 1213 | Phage-related tail protein [Function unknown] | 87.32 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 87.28 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 87.21 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 87.08 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 87.03 | |
| KOG2930|consensus | 114 | 86.89 | ||
| PRK11519 | 719 | tyrosine kinase; Provisional | 86.88 | |
| KOG4593|consensus | 716 | 86.83 | ||
| cd07664 | 234 | BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S | 86.8 | |
| KOG2751|consensus | 447 | 86.8 | ||
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 86.72 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 86.62 | |
| KOG2129|consensus | 552 | 86.58 | ||
| KOG1962|consensus | 216 | 86.49 | ||
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 86.46 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 86.34 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 86.24 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 86.22 | |
| KOG1941|consensus | 518 | 85.9 | ||
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 85.85 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 85.64 | |
| PF05300 | 187 | DUF737: Protein of unknown function (DUF737); Inte | 85.49 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 85.46 | |
| KOG4275|consensus | 350 | 85.38 | ||
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 85.27 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 85.11 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 85.05 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 84.99 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 84.83 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 84.73 | |
| KOG4460|consensus | 741 | 84.72 | ||
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 84.58 | |
| KOG3091|consensus | 508 | 84.44 | ||
| KOG0826|consensus | 357 | 84.29 | ||
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 84.22 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 84.2 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 84.16 | |
| KOG3970|consensus | 299 | 84.07 | ||
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 84.01 | |
| KOG4302|consensus | 660 | 84.01 | ||
| KOG4572|consensus | 1424 | 84.0 | ||
| PRK15374 | 593 | pathogenicity island 1 effector protein SipB; Prov | 83.98 | |
| KOG4438|consensus | 446 | 83.92 | ||
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 83.89 | |
| KOG1814|consensus | 445 | 83.83 | ||
| PRK10698 | 222 | phage shock protein PspA; Provisional | 83.74 | |
| KOG1899|consensus | 861 | 83.67 | ||
| KOG4787|consensus | 852 | 83.62 | ||
| KOG2114|consensus | 933 | 82.95 | ||
| PF06248 | 593 | Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 | 82.86 | |
| KOG4809|consensus | 654 | 82.85 | ||
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 82.71 | |
| cd08915 | 342 | V_Alix_like Protein-interacting V-domain of mammal | 82.68 | |
| KOG2264|consensus | 907 | 82.63 | ||
| KOG1962|consensus | 216 | 82.6 | ||
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 82.58 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 82.56 | |
| KOG4302|consensus | 660 | 82.37 | ||
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 82.18 | |
| KOG0742|consensus | 630 | 82.09 | ||
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 82.0 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 81.99 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 81.96 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 81.86 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 81.82 | |
| KOG2817|consensus | 394 | 81.71 | ||
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 81.55 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 81.52 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 81.36 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 81.01 | |
| KOG1001|consensus | 674 | 80.84 | ||
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 80.83 | |
| TIGR03545 | 555 | conserved hypothetical protein TIGR03545. This mod | 80.76 | |
| KOG4552|consensus | 272 | 80.53 | ||
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 80.46 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 80.36 | |
| KOG4403|consensus | 575 | 80.06 |
| >KOG0978|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-44 Score=394.36 Aligned_cols=271 Identities=42% Similarity=0.529 Sum_probs=243.2
Q ss_pred eecchhhhHHH-HHHhHhhhhcCCccccc-----ccccH-HHHHHHHHHHhhhHHHHhhcCcHHHHHHHHHHHHHHHHHH
Q psy10797 241 SICTSAFQMSF-YKSRWFDFRSLSDSASN-----IYGSL-EFRKFACVVRDSKRDERKKLADEEAMRKIKQLEDQTHQLQ 313 (517)
Q Consensus 241 ~~~~a~~~~~a-l~~~l~~~~~~~d~~~~-----i~~e~-elr~rlk~l~e~~~k~rqklad~Eal~rL~~lE~EieeLr 313 (517)
.+..+.+++.. ++..++++.+.|+.+.+ ...|. .++++++.+.+.++.+.++++++|+.++|+..+++++.|+
T Consensus 364 di~~~k~el~~~~~~~le~~k~~~ke~~~~~~~ka~~E~e~l~q~l~~~~k~e~~e~~k~~~d~~~r~~~~~~~~~e~Lq 443 (698)
T KOG0978|consen 364 DILVAKSELLKTNELRLEMLKSLLKEQRDKLQVKARAETESLLQRLKALDKEERSEIRKQALDDAERQIRQVEELSEELQ 443 (698)
T ss_pred hHHHHHHHHHHHHHHHHHHHhCCCHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHHHHHHHHH
Confidence 34556667766 88999999999999888 55555 8999999999999999999999999999999999999998
Q ss_pred HHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHH
Q psy10797 314 KQVATHKQEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQI 393 (517)
Q Consensus 314 ~kL~s~eqe~eALlsEIEsIgqAyEdmQeQNqrklqqL~EkED~n~KL~aEK~KAdQKyfaamreKdaLe~Evk~Lk~Ql 393 (517)
...+..+ +|.+|+++||+||++||+||++++++++++||+|+|||.|++++.|+|+.++++++.++.++.+++.++
T Consensus 444 k~~~~~k----~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~ 519 (698)
T KOG0978|consen 444 KKEKNFK----CLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASV 519 (698)
T ss_pred HHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 8776655 999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------------------H
Q psy10797 394 EAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHLVI---------------------I 452 (517)
Q Consensus 394 ekQ~e~I~kLeE~Er~L~~kLs~lEKEL~~lkqale~~kkk~~E~sq~~~dLk~qLee---------------------l 452 (517)
++....|.+|+|+++.++.....+.+++..++++++.+++++.++.+...+|+.+++. +
T Consensus 520 ~~~~~~i~~leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~ele~~ 599 (698)
T KOG0978|consen 520 DKLELKIGKLEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELELEIE 599 (698)
T ss_pred HHHHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999987761 0
Q ss_pred Hhc---chhh-------hhcccc-------------------cccccccccccccc-----cccccchhhHHHHHhhhcc
Q psy10797 453 YTN---GPAR-------LEFGKD-------------------REFSAKFVNFRRKS-----YFFVEFLDCLRTRYETRQR 498 (517)
Q Consensus 453 ~Ek---~~a~-------LEKLKk-------------------~e~kC~iC~~r~K~-----CgHvFC~~CIq~rl~tR~R 498 (517)
..+ .+.+ ++++++ ..++|++|++|||| |||+||.+||++||++|+|
T Consensus 600 ~~k~~rleEE~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqR 679 (698)
T KOG0978|consen 600 KFKRKRLEEELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQR 679 (698)
T ss_pred HHHHHHHHHHHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcC
Confidence 011 1111 333322 34689999999999 9999999999999999999
Q ss_pred CCCCCCC--CCCCceEeec
Q psy10797 499 KCPKCNA--KANDYHRLYL 515 (517)
Q Consensus 499 KCP~C~~--~~~Dv~rIyl 515 (517)
|||+||+ |+|||++|||
T Consensus 680 KCP~Cn~aFganDv~~I~l 698 (698)
T KOG0978|consen 680 KCPKCNAAFGANDVHRIHL 698 (698)
T ss_pred CCCCCCCCCCcccccccCC
Confidence 9999999 9999999997
|
|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >KOG1103|consensus | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >PF00901 Orbi_VP5: Orbivirus outer capsid protein VP5; InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1265|consensus | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0993|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG3564|consensus | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >COG3524 KpsE Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >KOG1850|consensus | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >KOG4677|consensus | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >COG5283 Phage-related tail protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >KOG2751|consensus | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF05300 DUF737: Protein of unknown function (DUF737); InterPro: IPR007964 This family consists of several uncharacterised mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG4460|consensus | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >KOG3091|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG4302|consensus | Back alignment and domain information |
|---|
| >KOG4572|consensus | Back alignment and domain information |
|---|
| >PRK15374 pathogenicity island 1 effector protein SipB; Provisional | Back alignment and domain information |
|---|
| >KOG4438|consensus | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >KOG4787|consensus | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains | Back alignment and domain information |
|---|
| >KOG2264|consensus | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG4302|consensus | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >TIGR03545 conserved hypothetical protein TIGR03545 | Back alignment and domain information |
|---|
| >KOG4552|consensus | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG4403|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 517 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 2e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 6e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 8e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-04 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 2e-07 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2l7b_A | 307 | Apolipoprotein E, APO-E; lipid transport, atherosc | 4e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 2e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 6e-04 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 1e-05 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 3e-04 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 2e-05 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 6e-05 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 5e-04 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 5e-04 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Score = 56.3 bits (136), Expect = 2e-08
Identities = 32/176 (18%), Positives = 70/176 (39%), Gaps = 14/176 (7%)
Query: 279 ACVVRDSKRDERKKLADE----EAMRKIK-QLEDQTHQLQKQVATHKQEEEALLNEMEVT 333
C R + E KKL E E +K+ LE++ QLQ+++ E+ +
Sbjct: 895 CCYRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKI----DEQNKEYKSLL-- 948
Query: 334 GQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQI 393
+ +++ S ++LR + E + +EE LR+++ +
Sbjct: 949 -EKMNNLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKELHQTQTEK 1007
Query: 394 EAMHTAIRKLEEKERFLQTVLTNAEKELHLRNQAMDLNKRKAIESAQSAADLKLHL 449
+ + K + + L + L E+ L+ + +LN+R ++ + ++ L
Sbjct: 1008 KTIEEWADKYKHETEQLVSELK--EQNTLLKTEKEELNRRIHDQAKEITETMEKKL 1061
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Length = 107 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 517 | |||
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.82 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.78 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.75 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.75 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.68 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.6 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.59 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.59 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.56 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.54 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.54 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.52 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.49 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.48 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.47 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.47 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.45 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.43 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.43 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.42 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.42 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.4 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.39 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.37 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.37 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.35 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.34 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.34 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.34 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.33 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.32 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.32 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.32 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.31 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.31 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.29 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.26 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.26 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.24 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.23 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.22 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.2 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.2 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.18 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.17 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.16 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.15 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.12 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.12 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.11 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.1 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.09 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.09 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.05 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.05 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.03 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.02 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.99 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.97 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 97.96 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.94 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.9 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.89 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.85 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.77 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.65 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.61 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.54 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.47 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.45 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.44 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.38 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.37 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.33 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.21 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.03 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.95 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.92 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 96.89 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 96.83 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 96.66 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.59 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.24 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 96.04 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 95.98 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.97 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 95.9 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 95.68 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.53 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 95.38 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.3 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.19 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.01 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 94.63 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.54 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 94.49 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 94.45 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.31 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 94.19 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 94.17 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.1 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 93.2 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 93.09 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 92.85 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 92.4 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 92.33 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 92.27 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 92.08 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 92.08 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 92.01 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 91.61 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 91.53 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 91.52 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 91.49 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.27 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 90.92 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 90.9 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.42 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 90.34 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 90.2 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 89.95 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 89.83 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 89.65 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 89.13 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 88.81 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 88.72 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 88.43 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 88.28 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 87.81 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 87.65 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 87.09 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 86.98 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 86.91 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 86.59 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 86.05 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 85.83 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 85.81 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 85.23 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 84.43 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 84.31 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 84.1 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 83.94 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 83.34 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 82.97 | |
| 4fla_A | 152 | Regulation of nuclear PRE-mRNA domain-containing 1 | 82.93 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 82.56 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 82.41 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 82.37 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 82.19 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 82.14 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 81.59 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 81.36 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 81.25 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 81.19 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 81.19 |
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=98.82 E-value=1.8e-09 Score=82.18 Aligned_cols=48 Identities=23% Similarity=0.438 Sum_probs=42.2
Q ss_pred ccccccccccccc------------cccccchhhHHHHHhhhccCCCCCCC--CCCCceEeec
Q psy10797 467 EFSAKFVNFRRKS------------YFFVEFLDCLRTRYETRQRKCPKCNA--KANDYHRLYL 515 (517)
Q Consensus 467 e~kC~iC~~r~K~------------CgHvFC~~CIq~rl~tR~RKCP~C~~--~~~Dv~rIyl 515 (517)
.+.|+||.+.+++ |||+||..||++|++. ..+||.|++ ...|++++||
T Consensus 3 ~~~C~IC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~-~~~CP~Cr~~~~~~~~~~~~l 64 (64)
T 2xeu_A 3 MVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKN-ANTCPTCRKKINHKRYHPIYI 64 (64)
T ss_dssp CCBCTTTCCBHHHHHHTTCCEEEETTSCEEEHHHHHHHHHH-CSBCTTTCCBCTTTCEEECCC
T ss_pred CCCCCccChhhhCccccCCCEEeCCCCCchhHHHHHHHHHc-CCCCCCCCccCCccceeeeeC
Confidence 5789999985431 9999999999999976 779999999 8899999997
|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 517 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 0.001 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 39.0 bits (90), Expect = 0.001
Identities = 22/122 (18%), Positives = 46/122 (37%), Gaps = 4/122 (3%)
Query: 285 SKRDERKKLADEEAMRKIKQLEDQTHQLQKQVATHKQEEEALLNEMEVTGQAFEDMQEQN 344
K E A + + + + E + + + + + + L Q E +
Sbjct: 182 LKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSY 241
Query: 345 SRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDTLREQVQALSLQIEAMHTAIRKLE 404
L+QL EK + + + + + KL +E++ L+E Q + M I+ L+
Sbjct: 242 QEHLKQLTEKMENDRVQLLKEQERTLALKL-QEQEQLLKEGFQK---ESRIMKNEIQDLQ 297
Query: 405 EK 406
K
Sbjct: 298 TK 299
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 517 | |||
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.84 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.72 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.62 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.53 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.46 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.44 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.37 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.32 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.27 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.08 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.08 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.86 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.75 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.56 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.48 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.26 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 94.54 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 93.84 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 91.42 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 88.44 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 83.98 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.84 E-value=4.2e-10 Score=92.68 Aligned_cols=46 Identities=13% Similarity=0.218 Sum_probs=41.9
Q ss_pred cccccccccccccc-----cccccchhhHHHHHhhhccCCCCCCC--CCCCce
Q psy10797 466 REFSAKFVNFRRKS-----YFFVEFLDCLRTRYETRQRKCPKCNA--KANDYH 511 (517)
Q Consensus 466 ~e~kC~iC~~r~K~-----CgHvFC~~CIq~rl~tR~RKCP~C~~--~~~Dv~ 511 (517)
.++.|+||.+.+++ |||+||..||++|++.+.++||.|+. +..|+.
T Consensus 22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~ 74 (86)
T d1rmda2 22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLE 74 (86)
T ss_dssp HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCB
T ss_pred cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhcc
Confidence 56899999999988 99999999999999999999999999 667764
|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|