Psyllid ID: psy10849


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
STSHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMYLMQQSSPSDDMMLDENCRPRDGRRGPKRPRTILTSAQRRQFKSSFEVSPKPCRKVSTMNSKRAKNILTPNQRRQFKSSFEISSMPCRKVGVHGHYLSLGMSLQDSSDSIFASSTKPLNPNHPYSPDDSYAMHSNDSFCSSDISLDESTNLDEGGSDSLSLDLGPPSNHDTMLSSLGQINPIDKQRC
ccccccccccHHHHHHHcccccccccccccccccEEEccccEEEcccccccccccccccccEEEEEccEEEEcccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccEEEHHHHHHHHcccHHHccccccHHHHHHHHHccEEEEHHHHHHHHHcccccccEEEEEcccEEEcccHHHHHHHcccccccccccccccccccccccccccccEEEcHHHHHHHHHHHHccccccHHHcccccHHHHEEHHHHHHHHHHHHHHHHHcccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
stshnshvschprgfrlygvkcarcgdrllphEMVMRAQshvyhlpcfvcviccqplqkgeQFILRSGQLFCRQDFEKEMYLmqqsspsddmmldencrprdgrrgpkrprtiLTSAQRRQFkssfevspkpcrkvstmnskrakniltpnqrrqfkssfeissmpcrkvgvhgHYLSLGmslqdssdsifasstkplnpnhpyspddsyamhsndsfcssdisldestnldeggsdslsldlgppsnhdtmlsslgqinpidkqrc
stshnshvschprgfrlygvKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMYLMQqsspsddmmldencrprdgrrgpkrprtiltsaqrrqfkssfevspkpcrkvstmnskrakniltpnqrrqfkSSFEISSMPCRKVGVHGHYLSLGMSLQDSSDSIFASSTKPLNPNHPYSPDDSYAMHSNDSFCSSDISLDESTNLDEGGSDSLSLDLGPPSNHDTmlsslgqinpidkqrc
STSHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMYLMQQSSPSDDMMLDENCrprdgrrgpkrprTILTSAQRRQFKSSFEVSPKPCRKVSTMNSKRAKNILTPNQRRQFKSSFEISSMPCRKVGVHGHYLSLGMSLQDSSDSIFASSTKPLNPNHPYSPDDSYAMHSNDSFCSSDISLDESTNldeggsdslsldlgPPSNHDTMLSSLGQINPIDKQRC
*********CHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMY************************************************************************************PCRKVGVHGHYLSLG***************************************************************************************
**SHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEK**********************************************************************TPN********************************************************************************************************************
**********HPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMYLMQQSSPSDDMMLDENCRPRDGRRGPKRPRTILTSAQRRQFKSSFEVSPKPCRKVSTMNSKRAKNILTPNQRRQFKSSFEISSMPCRKVGVHGHYLSLGMSLQDSSDSIFASSTKPLNPNHPYSPDDSYAMHSNDSFCSSDISLDE**********SLSLDLGPPSNHDTMLSSLGQINPIDKQRC
*****SHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMYLM************************KRPRTILTSAQRRQFKSSFEVSPKPCRKVSTMNSKRAKNILTPNQRRQFKSSF*****************************************H****D*SYA*H*N**F*SSD*********************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
STSHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDFEKEMYLMQQSSPSDDMMLDENCRPRDGRRGPKRPRTILTSAQRRQFKSSFEVSPKPCRKVSTMNSKRAKNILTPNQRRQFKSSFEISSMPCRKVGVHGHYLSLGMSLQDSSDSIFASSTKPLNPNHPYSPDDSYAMHSNDSFCSSDISLDESTNLDEGGSDSLSLDLGPPSNHDTMLSSLGQINPIDKQRC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query267 2.2.26 [Sep-21-2011]
Q04650382 LIM homeobox transcriptio N/A N/A 0.531 0.371 0.457 3e-30
Q9JKU8382 LIM homeobox transcriptio yes N/A 0.531 0.371 0.457 3e-30
Q8TE12382 LIM homeobox transcriptio yes N/A 0.531 0.371 0.451 4e-30
O88609372 LIM homeobox transcriptio no N/A 0.531 0.381 0.419 5e-28
O60663379 LIM homeobox transcriptio no N/A 0.531 0.374 0.419 6e-28
Q60564369 LIM homeobox transcriptio N/A N/A 0.531 0.384 0.425 2e-27
Q8UVR3400 LIM homeobox transcriptio N/A N/A 0.531 0.355 0.427 9e-27
P53413377 LIM/homeobox protein LMX- no N/A 0.531 0.376 0.421 4e-26
Q25132 692 LIM/homeobox protein Lhx3 N/A N/A 0.419 0.161 0.353 7e-17
Q969G2390 LIM/homeobox protein Lhx4 no N/A 0.434 0.297 0.340 1e-16
>sp|Q04650|LMX1A_MESAU LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus GN=LMX1A PE=2 SV=1 Back     alignment and function desciption
 Score =  132 bits (331), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 97/164 (59%), Gaps = 22/164 (13%)

Query: 16  RLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQD 75
           +L+ VKC  C + + P+E VMRAQ  VYHL CF C +C + LQKG++F+L+ GQL C+ D
Sbjct: 88  KLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGD 147

Query: 76  FEKEMYLMQQSSP--SDDMMLDEN---CR---------PRDGR--RGPKRPRTILTSAQR 119
           +EKE  L+   SP  SD    D+    C+           DG+  + PKRPRTILT+ QR
Sbjct: 148 YEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTSEDGKDHKRPKRPRTILTTQQR 207

Query: 120 RQFKSSFEVSPKPCRKV------STMNSKRAKNILTPNQRRQFK 157
           R FK+SFEVS KPCRKV       T  S R   +   NQR + K
Sbjct: 208 RAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251




Acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.
Mesocricetus auratus (taxid: 10036)
>sp|Q9JKU8|LMX1A_MOUSE LIM homeobox transcription factor 1-alpha OS=Mus musculus GN=Lmx1a PE=2 SV=1 Back     alignment and function description
>sp|Q8TE12|LMX1A_HUMAN LIM homeobox transcription factor 1-alpha OS=Homo sapiens GN=LMX1A PE=2 SV=1 Back     alignment and function description
>sp|O88609|LMX1B_MOUSE LIM homeobox transcription factor 1-beta OS=Mus musculus GN=Lmx1b PE=2 SV=2 Back     alignment and function description
>sp|O60663|LMX1B_HUMAN LIM homeobox transcription factor 1-beta OS=Homo sapiens GN=LMX1B PE=1 SV=2 Back     alignment and function description
>sp|Q60564|LMX1B_MESAU LIM homeobox transcription factor 1-beta (Fragment) OS=Mesocricetus auratus GN=LMX1B PE=2 SV=1 Back     alignment and function description
>sp|Q8UVR3|LMX1B_XENLA LIM homeobox transcription factor 1-beta.1 OS=Xenopus laevis GN=lmx1b.1 PE=2 SV=1 Back     alignment and function description
>sp|P53413|LMX1B_CHICK LIM/homeobox protein LMX-1.2 OS=Gallus gallus GN=LMX1B PE=2 SV=1 Back     alignment and function description
>sp|Q25132|LHX3_HALRO LIM/homeobox protein Lhx3 OS=Halocynthia roretzi GN=LHX3 PE=2 SV=2 Back     alignment and function description
>sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
91077954 472 PREDICTED: similar to CG32105 CG32105-PB 0.966 0.546 0.587 3e-82
270002859 388 LIM homeobox transcription factor 1, bet 0.966 0.664 0.587 1e-81
357612982327 hypothetical protein KGM_10626 [Danaus p 0.940 0.767 0.526 5e-72
242007294 389 Homeobox protein ceh-14, putative [Pedic 0.827 0.568 0.539 2e-64
328715997 407 PREDICTED: LIM homeobox transcription fa 0.850 0.557 0.539 4e-63
307204532 402 LIM homeobox transcription factor 1 beta 0.831 0.552 0.506 2e-55
350402518 402 PREDICTED: LIM homeobox transcription fa 0.771 0.512 0.521 5e-54
340711972 402 PREDICTED: LIM homeobox transcription fa 0.771 0.512 0.521 7e-54
383861320 402 PREDICTED: LIM homeobox transcription fa 0.771 0.512 0.517 2e-53
307189897 402 LIM homeobox transcription factor 1 beta 0.831 0.552 0.5 3e-53
>gi|91077954|ref|XP_967240.1| PREDICTED: similar to CG32105 CG32105-PB [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 174/296 (58%), Positives = 202/296 (68%), Gaps = 38/296 (12%)

Query: 3   SHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQ 62
           + N+ + C     R++GVKC+RCGDRLLPHEMVMRAQ HV+HLPCFVCV+CCQPLQKGEQ
Sbjct: 168 TRNTKLYCKADYDRIFGVKCSRCGDRLLPHEMVMRAQQHVFHLPCFVCVVCCQPLQKGEQ 227

Query: 63  FILRSGQLFCRQDFEKEMYLMQQSSPSDDMMLDENCRPRDGRRGPKRPRTILTSAQRRQF 122
           F+LR+GQLFCRQDFEKEMYLMQQ+S  DD MLDEN RPRDGRRGPKRPRTILTSAQRRQF
Sbjct: 228 FVLRAGQLFCRQDFEKEMYLMQQASSGDDDMLDENSRPRDGRRGPKRPRTILTSAQRRQF 287

Query: 123 KSSFEVSPKPCRKV------STMNSKRAKNILTPNQRR-----QFKSSFEISSMPCRKVG 171
           K+SFEVSPKPCRKV       T  S R   +   NQR      Q K+  +    P  K  
Sbjct: 288 KASFEVSPKPCRKVREALAKETGLSVRVVQVWFQNQRAKMKKIQRKAKQDDGKSPGDKDK 347

Query: 172 V---------------HGHYLSLGMSLQDSSDSIFASSTKPLNPNHPYSPDDSYAMHSND 216
                           HGH++ +G    + SDS F SS++PLNPN PYSPDD+Y  HS +
Sbjct: 348 GDKDDKIIKQESPSSDHGHFMGMG----NLSDSHFPSSSQPLNPNIPYSPDDAYPAHSGE 403

Query: 217 SFCSSDISLDESTN---LDEGGSDSLSL-DLGPPSN----HDTMLSSLGQINPIDK 264
           SFCSSDISLD+STN   LDE  SD+LSL +L   S+    HD +  S    NPIDK
Sbjct: 404 SFCSSDISLDDSTNFDHLDEATSDTLSLQNLELQSSHSHQHDNVPPSGSIANPIDK 459




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270002859|gb|EEZ99306.1| LIM homeobox transcription factor 1, beta [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357612982|gb|EHJ68260.1| hypothetical protein KGM_10626 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242007294|ref|XP_002424476.1| Homeobox protein ceh-14, putative [Pediculus humanus corporis] gi|212507894|gb|EEB11738.1| Homeobox protein ceh-14, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328715997|ref|XP_001946565.2| PREDICTED: LIM homeobox transcription factor 1-beta-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307204532|gb|EFN83212.1| LIM homeobox transcription factor 1 beta [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350402518|ref|XP_003486514.1| PREDICTED: LIM homeobox transcription factor 1-beta-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711972|ref|XP_003394539.1| PREDICTED: LIM homeobox transcription factor 1-beta-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383861320|ref|XP_003706134.1| PREDICTED: LIM homeobox transcription factor 1-beta-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307189897|gb|EFN74141.1| LIM homeobox transcription factor 1 beta [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
FB|FBgn0052105640 CG32105 [Drosophila melanogast 0.573 0.239 0.469 7.3e-40
UNIPROTKB|Q8UVR3400 lmx1b.1 "LIM homeobox transcri 0.280 0.187 0.466 1e-25
ZFIN|ZDB-GENE-050114-2375 lmx1bb "LIM homeobox transcrip 0.280 0.2 0.453 5.5e-25
UNIPROTKB|F1S229295 LMX1A "Uncharacterized protein 0.453 0.410 0.452 2e-24
UNIPROTKB|I3L863296 LMX1A "Uncharacterized protein 0.453 0.408 0.452 2e-24
UNIPROTKB|F1MC25382 LMX1A "Uncharacterized protein 0.453 0.316 0.445 2.6e-24
UNIPROTKB|F1PDJ1382 LMX1A "Uncharacterized protein 0.453 0.316 0.445 2.6e-24
UNIPROTKB|Q8TE12382 LMX1A "LIM homeobox transcript 0.453 0.316 0.445 2.6e-24
MGI|MGI:1888519382 Lmx1a "LIM homeobox transcript 0.453 0.316 0.445 2.6e-24
RGD|1304784382 Lmx1a "LIM homeobox transcript 0.453 0.316 0.445 2.6e-24
FB|FBgn0052105 CG32105 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 319 (117.4 bits), Expect = 7.3e-40, Sum P(2) = 7.3e-40
 Identities = 77/164 (46%), Positives = 94/164 (57%)

Query:     5 NSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRA-QSHVYHLPCFVCVICCQPLQKGEQF 63
             NS + C     RL+GVKC+ C   +LP E+VMR   + V+HLPCFVC  C  PLQKGEQF
Sbjct:   317 NSKLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQF 376

Query:    64 ILRSGQLFC-RQDFEKEMYLMQQSSPSDDMM-LDEN--CXXXXXXXXXXXXXTILTSAQR 119
             +LR GQLFC R D EKEM+L   ++     + LDE                 TILTS QR
Sbjct:   377 MLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQR 436

Query:   120 RQFKSSFEVSPKPCRKV------STMNSKRAKNILTPNQRRQFK 157
             +QFK+SF+ SPKPCRKV       T  S R   +   NQR + K
Sbjct:   437 KQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMK 480


GO:0005634 "nucleus" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
UNIPROTKB|Q8UVR3 lmx1b.1 "LIM homeobox transcription factor 1-beta.1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050114-2 lmx1bb "LIM homeobox transcription factor 1, beta b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S229 LMX1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3L863 LMX1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MC25 LMX1A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDJ1 LMX1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TE12 LMX1A "LIM homeobox transcription factor 1-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1888519 Lmx1a "LIM homeobox transcription factor 1 alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304784 Lmx1a "LIM homeobox transcription factor 1 alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 1e-18
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 3e-17
cd0937455 cd09374, LIM2_Isl, The second LIM domain of Isl, a 2e-13
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 2e-13
pfam0041258 pfam00412, LIM, LIM domain 2e-12
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 5e-12
cd0937556 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of 2e-11
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 1e-10
cd0947155 cd09471, LIM2_Isl2, The second LIM domain of Isl2 2e-10
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-10
cd0937955 cd09379, LIM2_AWH, The second LIM domain of Arrowh 3e-10
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 3e-10
cd0938955 cd09389, LIM2_LMO1_LMO3, The second LIM domain of 4e-10
cd0947356 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 4e-10
cd0947257 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 1e-09
cd0947459 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 2e-09
cd0938355 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of 4e-09
cd0938255 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 5e-09
cd0938556 cd09385, LIM2_LMO2, The second LIM domain of LMO2 8e-09
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 3e-08
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 3e-08
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 2e-07
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 8e-07
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 7e-06
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 8e-06
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 9e-06
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 3e-05
cd0945752 cd09457, LIM2_ENH, The second LIM domain of the En 4e-05
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 1e-04
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 5e-04
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 6e-04
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 7e-04
cd0946154 cd09461, LIM3_Enigma_like_1, The third LIM domain 8e-04
cd0932856 cd09328, LIM2_abLIM, The second LIM domain on acti 0.001
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 0.001
cd0937153 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b 0.001
cd0935653 cd09356, LIM2_TRIP6, The second LIM domain of Thyr 0.001
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 0.002
cd0935360 cd09353, LIM2_Zyxin, The second LIM domain of Zyxi 0.002
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 0.002
cd0936655 cd09366, LIM1_Isl, The first LIM domain of Isl, a 0.003
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 0.003
cd0935460 cd09354, LIM2_LPP, The second LIM domain of lipoma 0.003
cd0942657 cd09426, LIM2_FHL2, The second LIM domain of Four 0.004
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
 Score = 76.9 bits (190), Expect = 1e-18
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 21 KCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILRSGQLFCRQDF 76
          +CARC   +   E+VMRA+  V+HL CF C  C +PL KG+ F +R G ++CR  +
Sbjct: 4  RCARCHLGISASELVMRARDLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCRLHY 59


The second LIM domain of Lhx2 and Lhx9 family: Lhx2 and Lhx9 are highly homologous LHX regulatory proteins. They belong to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. Although Lhx2 and Lhx9 are highly homologous, they seems to play regulatory roles in different organs. In animals, Lhx2 plays important roles in eye, cerebral cortex, limb, the olfactory organs, and erythrocyte development. Lhx2 gene knockout mice exhibit impaired patterning of the cortical hem and the telencephalon of the developing brain, and a lack of development in olfactory structures. Lhx9 is expressed in several regions of the developing mouse brain, the spinal cord, the pancreas, in limb mesenchyme, and in the urogenital region. Lhx9 plays critical roles in gonad development. Homozygous mice lacking functional Lhx9 alleles exhibit numerous urogenital defects, such as gonadal agenesis, infertility, and undetectable levels of testosterone and estradiol coupled with high FSH levels. Lhx9 null mice are phenotypically female, even those that are genotypically male. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 59

>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b Back     alignment and domain information
>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
KOG4577|consensus383 100.0
KOG0484|consensus125 99.82
KOG0489|consensus261 99.75
KOG0850|consensus245 99.69
KOG2251|consensus228 99.69
KOG0494|consensus332 99.68
KOG0490|consensus235 99.66
KOG0488|consensus309 99.65
KOG0843|consensus197 99.65
KOG0487|consensus308 99.64
KOG0492|consensus246 99.63
KOG0485|consensus268 99.61
KOG0842|consensus307 99.6
KOG0848|consensus317 99.55
KOG0844|consensus408 99.53
KOG0493|consensus342 99.5
KOG0486|consensus351 99.5
KOG0490|consensus235 99.48
KOG1701|consensus468 99.48
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.46
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.41
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.38
COG5576156 Homeodomain-containing transcription factor [Trans 99.38
KOG4577|consensus383 99.36
KOG0491|consensus194 99.36
KOG1701|consensus468 99.29
KOG0847|consensus288 99.23
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.2
KOG0483|consensus198 99.13
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.13
KOG1703|consensus479 99.09
KOG0849|consensus354 99.09
KOG2272|consensus332 99.0
KOG3802|consensus398 98.99
KOG2272|consensus332 98.98
KOG1044|consensus 670 98.97
KOG1703|consensus479 98.67
KOG1168|consensus385 98.59
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.52
KOG1044|consensus 670 98.41
KOG1700|consensus200 98.0
KOG0775|consensus304 97.58
KOG1146|consensus 1406 97.54
KOG1702|consensus264 97.18
KOG0774|consensus334 97.15
KOG2252|consensus558 97.07
KOG1700|consensus200 97.05
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 95.93
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 92.5
KOG3623|consensus 1007 91.73
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 82.1
>KOG4577|consensus Back     alignment and domain information
Probab=100.00  E-value=5.2e-35  Score=253.35  Aligned_cols=149  Identities=32%  Similarity=0.597  Sum_probs=132.1

Q ss_pred             CcccCCcccCccccccccCCCCCCCCCcccCCCcEEEecCceeecCCcccccccccCCCCCceEee-CCeecchhhHHHH
Q psy10849          1 STSHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFILR-SGQLFCRQDFEKE   79 (267)
Q Consensus         1 ~~~~dg~~yC~~cy~~~f~~~C~~C~~~I~~~e~~~~a~~~~wH~~CF~C~~C~~~L~~g~~f~~~-~~~lyC~~cy~k~   79 (267)
                      ||.|+|.+||+++|.++|+.+|..|...|.+...|-+|.+.+||..||.|.+|++.|.+|++|++. +.++.|+.+|+..
T Consensus        74 CFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~A  153 (383)
T KOG4577|consen   74 CFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETA  153 (383)
T ss_pred             HhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHH
Confidence            899999999999999999999999999999886666789999999999999999999999999987 6899999999874


Q ss_pred             HhhhcCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHhhhcCCCCChhhhhh------cCCCceeeecchhh
Q psy10849         80 MYLMQQSSPSDDMMLDENCRPRDGRRGPKRPRTILTSAQRRQFKSSFEVSPKPCRKVSTM------NSKRAKNILTPNQR  153 (267)
Q Consensus        80 f~~~~~~~~~~~~~~~~~~~~~~~~~~~kr~Rt~ft~~Ql~~L~~~f~~~~~p~~~~r~~------l~~~~v~vWFQNrR  153 (267)
                      -..       ....       -++....||+||.+|..||+.|+.+|...+.|.+.+||+      |..|+|||||||||
T Consensus       154 k~k-------~~~~-------l~gd~~nKRPRTTItAKqLETLK~AYn~SpKPARHVREQLsseTGLDMRVVQVWFQNRR  219 (383)
T KOG4577|consen  154 KQK-------HCNE-------LEGDASNKRPRTTITAKQLETLKQAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRR  219 (383)
T ss_pred             Hhc-------cccc-------cccccccCCCcceeeHHHHHHHHHHhcCCCchhHHHHHHhhhccCcceeehhhhhhhhh
Confidence            321       1111       133455799999999999999999999999999999999      89999999999999


Q ss_pred             hhhhhhhhhc
Q psy10849        154 RQFKSSFEIS  163 (267)
Q Consensus       154 ak~k~~~~~~  163 (267)
                      ||.||.++.+
T Consensus       220 AKEKRLKKDA  229 (383)
T KOG4577|consen  220 AKEKRLKKDA  229 (383)
T ss_pred             HHHHhhhhhc
Confidence            9999988776



>KOG0484|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 2e-10
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 3e-10
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 6e-10
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 6e-09
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 7e-09
2lxd_A125 Backbone 1h, 13c, And 15n Chemical Shift Assignment 9e-08
2l6y_B96 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 4e-07
2xjy_A131 Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 4e-06
1g47_A77 1st Lim Domain Of Pinch Protein Length = 77 5e-04
3ixe_B72 Structural Basis Of Competition Between Pinch1 And 5e-04
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Query: 3 SHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQ 62 S V C F+ +G KC C + P ++V +AQ VYHL CF C+IC + L G++ Sbjct: 49 SRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDE 108 Query: 63 F-ILRSGQLFCRQDFE 77 F ++ G+L C++D+E Sbjct: 109 FYLMEDGRLVCKEDYE 124
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|2LXD|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For Lmo2(Lim2)- Ldb1(Lid) Length = 125 Back     alignment and structure
>pdb|2L6Y|B Chain B, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 96 Back     alignment and structure
>pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 Back     alignment and structure
>pdb|1G47|A Chain A, 1st Lim Domain Of Pinch Protein Length = 77 Back     alignment and structure
>pdb|3IXE|B Chain B, Structural Basis Of Competition Between Pinch1 And Pinch2 For Binding To The Ankyrin Repeat Domain Of Integrin-Linked Kinase Length = 72 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 4e-29
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 3e-22
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 9e-07
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-21
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-08
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-20
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-08
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-19
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 5e-07
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-15
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 1e-09
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 7e-14
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 7e-14
3f6q_B72 LIM and senescent cell antigen-like-containing dom 8e-14
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-13
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 4e-13
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-12
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 5e-12
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-12
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-11
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 5e-11
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 8e-10
2cuq_A80 Four and A half LIM domains 3; structural genomics 1e-10
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-10
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 5e-10
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-09
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-09
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 8e-09
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 1e-08
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 1e-08
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 2e-08
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-08
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-08
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 3e-08
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-08
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 9e-06
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 5e-08
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 6e-08
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 7e-08
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 1e-07
2co8_A82 NEDD9 interacting protein with calponin homology a 2e-07
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-07
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-07
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 4e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 4e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-06
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 1e-06
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-06
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 5e-06
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-05
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 6e-05
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-04
2cor_A79 Pinch protein; LIM domain, particularly interestin 2e-04
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.86
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.78
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.78
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.76
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.76
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.75
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.75
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.74
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.73
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.73
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.72
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.71
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.71
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.71
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.7
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.7
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.7
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.7
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.7
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.69
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.69
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.69
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.69
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.68
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.68
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.68
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.68
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.68
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.68
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.68
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.68
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.67
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.67
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.67
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.66
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.66
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.66
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.66
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.66
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.66
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.66
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.65
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.65
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.65
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.65
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.65
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.64
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.64
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.63
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.63
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.63
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.63
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.63
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.63
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.63
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.63
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.62
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.61
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.61
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.6
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.6
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.59
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.59
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.59
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.57
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.57
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.56
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.56
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.56
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.56
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.55
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.55
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.55
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.54
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.54
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.54
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.54
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.53
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.53
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.53
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.52
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.51
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.51
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.51
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.51
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.51
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.51
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.5
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.5
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.49
2e19_A64 Transcription factor 8; homeobox domain, structura 99.49
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.48
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.47
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.47
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.47
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.46
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.45
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.45
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.45
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.44
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.4
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.38
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.38
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.38
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.37
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.36
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.36
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.35
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.35
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.33
2co8_A82 NEDD9 interacting protein with calponin homology a 99.33
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.32
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.3
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.29
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.29
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.25
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.22
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.19
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.14
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.14
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 99.13
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.08
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.08
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.0
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.9
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.74
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 98.42
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.55
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 96.64
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 96.41
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 96.05
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 95.11
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 95.07
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 95.01
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 94.91
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 94.51
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 91.84
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 90.74
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 89.89
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
Probab=99.86  E-value=2.5e-23  Score=172.51  Aligned_cols=116  Identities=30%  Similarity=0.600  Sum_probs=96.6

Q ss_pred             cccCCcccCccccccccCCCCCCCCCcccCCCcEEEecCceeecCCcccccccccCCCCCceEe-eCCeecchhhHHHHH
Q psy10849          2 TSHNSHVSCHPRGFRLYGVKCARCGDRLLPHEMVMRAQSHVYHLPCFVCVICCQPLQKGEQFIL-RSGQLFCRQDFEKEM   80 (267)
Q Consensus         2 ~~~dg~~yC~~cy~~~f~~~C~~C~~~I~~~e~~~~a~~~~wH~~CF~C~~C~~~L~~g~~f~~-~~~~lyC~~cy~k~f   80 (267)
                      |.+||++||+.||.++|+++|.+|+++|.+.+.++.+.++.||++||+|..|++.|..|..|+. .++++||..||.+++
T Consensus        48 f~~~g~~yC~~~y~~~f~~~C~~C~~~I~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~g~~~C~~c~~~~~  127 (169)
T 2rgt_A           48 FSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK  127 (169)
T ss_dssp             EESSSCEECHHHHHHHHSCBCTTTCCBCCTTSEEEEETTEEEEGGGCBCTTTCCBCCTTCEEEECTTSCEEEHHHHHHHH
T ss_pred             cccCCeeeecccccccccccccccccccCCCcEEEEcCCceEeeCCCcCCCCCCCCCCCCceEEccCCeEECHHHHHHHh
Confidence            6799999999999999999999999999988888899999999999999999999976777765 589999999999987


Q ss_pred             hhhcCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHhhhcCCCCChh
Q psy10849         81 YLMQQSSPSDDMMLDENCRPRDGRRGPKRPRTILTSAQRRQFKSSFEVSPKPCRK  135 (267)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~kr~Rt~ft~~Ql~~L~~~f~~~~~p~~~  135 (267)
                      ..-.                 + ..+.||.||.|+.+||++|++.|+.+++|+..
T Consensus       128 ~~~~-----------------~-~~~~~rprt~~~~~q~~~l~~~f~~~~~~~~~  164 (169)
T 2rgt_A          128 QGGS-----------------G-GSGGSGGGTPMVAASPERHDGGLQANPVEVQS  164 (169)
T ss_dssp             HCC----------------------------EEEECCCCEECCSSCCCCCCCCCC
T ss_pred             hccC-----------------C-CCCCcCCCCcccHHHHHHHHHHHhCCCCcccc
Confidence            6310                 1 13468999999999999999999999999754



>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 267
d1rutx331 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus 5e-09
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: LIM only 4 (Lmo4)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 48.6 bits (116), Expect = 5e-09
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 22 CARCGDRLLPHEMVMRAQSHVYHLPCF 48
          C+ CG  +   E+VMRAQ +VYHL CF
Sbjct: 5  CSACGQSIPASELVMRAQGNVYHLKCF 31


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.76
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.75
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.75
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.74
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.74
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.73
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.73
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.71
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.71
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.71
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.71
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.7
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.7
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.7
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.7
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.66
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.65
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.65
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.63
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.6
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.6
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.58
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.57
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.52
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.5
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.48
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.44
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.38
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.29
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.27
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.19
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.87
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.78
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.47
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.37
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.33
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.26
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.23
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.07
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.06
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.06
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.89
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.79
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.73
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.73
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.72
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.72
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.71
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.68
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.67
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.65
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.62
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.58
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.56
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.56
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.55
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.55
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.46
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.44
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.41
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.4
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.38
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.34
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.34
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.28
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.27
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.25
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.24
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.2
d2co8a236 Nedd9 interacting protein with calponin homology, 97.19
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.12
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.1
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.07
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.04
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.03
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.86
d1g47a235 Pinch (particularly interesting new Cys-His) prote 96.77
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 96.75
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 96.66
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.55
d1g47a135 Pinch (particularly interesting new Cys-His) prote 96.54
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 96.45
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.35
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.14
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.11
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.83
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.52
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 95.26
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 95.2
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 94.89
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.85
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 94.41
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.4
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 93.98
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 93.86
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 93.43
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 93.41
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 92.33
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 91.76
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 91.41
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 91.31
d2cora131 Pinch (particularly interesting new Cys-His) prote 91.24
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 90.72
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 90.0
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 89.85
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 87.97
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 85.94
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=4.8e-20  Score=124.19  Aligned_cols=51  Identities=18%  Similarity=0.201  Sum_probs=48.7

Q ss_pred             CCCCCCCCHHHHHHHHHhhhcCCCCChhhhhh------cCCCceeeecchhhhhhhh
Q psy10849        108 KRPRTILTSAQRRQFKSSFEVSPKPCRKVSTM------NSKRAKNILTPNQRRQFKS  158 (267)
Q Consensus       108 kr~Rt~ft~~Ql~~L~~~f~~~~~p~~~~r~~------l~~~~v~vWFQNrRak~k~  158 (267)
                      ||.||.||.+|+.+||+.|+.++||+...+++      |++++|+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            67899999999999999999999999999888      9999999999999999986



>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure