Psyllid ID: psy10860

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MKGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPLNGRYANVKS
ccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHccccEEEEccccEEEEEEEccEEEEccccccccccccccccEEEEEEcc
cccccccccEEEEEccEEEEEEcccEEcccccHHHHHHHHHHcccEEEEEcccccEEEEEEccEEEEccccccccccccccccccEEEEcc
mkgtsypekkvvtVGQFRIglchghdiipwgdPEALALLQRQLDVDIlisghthkfeayehenkfyinpgsatgafnpleplngryanvks
mkgtsypekkvvTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSAtgafnpleplngryanvks
MKGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPLNGRYANVKS
*********KVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAF***************
*KGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPLNGRYANVK*
MKGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPLNGRYANVKS
****SYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPLNGRYANVK*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPLNGRYANVKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
B2RZ78182 Vacuolar protein sorting- yes N/A 0.835 0.417 0.828 3e-33
Q5R9Z1182 Vacuolar protein sorting- yes N/A 0.835 0.417 0.828 3e-33
Q9QZ88182 Vacuolar protein sorting- yes N/A 0.835 0.417 0.828 3e-33
Q3T0M0186 Vacuolar protein sorting- yes N/A 0.835 0.408 0.828 4e-33
Q9UBQ0182 Vacuolar protein sorting- yes N/A 0.835 0.417 0.828 5e-33
Q6DEU3182 Vacuolar protein sorting- yes N/A 0.835 0.417 0.828 6e-33
Q6GP62182 Vacuolar protein sorting- N/A N/A 0.835 0.417 0.828 6e-33
Q5ZIL2186 Vacuolar protein sorting- no N/A 0.835 0.408 0.815 2e-32
Q7ZV68182 Vacuolar protein sorting- yes N/A 0.835 0.417 0.815 2e-32
Q54IF7183 Vacuolar protein sorting- yes N/A 0.835 0.415 0.644 1e-26
>sp|B2RZ78|VPS29_RAT Vacuolar protein sorting-associated protein 29 OS=Rattus norvegicus GN=Vps29 PE=1 SV=2 Back     alignment and function desciption
 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 63/76 (82%), Positives = 70/76 (92%)

Query: 5   SYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENK 64
           +YPE+KVVTVGQF+IGL HGH +IPWGD  +LALLQRQ DVDILISGHTHKFEA+EHENK
Sbjct: 68  NYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENK 127

Query: 65  FYINPGSATGAFNPLE 80
           FYINPGSATGA+N LE
Sbjct: 128 FYINPGSATGAYNALE 143
Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro).
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 3
>sp|Q5R9Z1|VPS29_PONAB Vacuolar protein sorting-associated protein 29 OS=Pongo abelii GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZ88|VPS29_MOUSE Vacuolar protein sorting-associated protein 29 OS=Mus musculus GN=Vps29 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0M0|VPS29_BOVIN Vacuolar protein sorting-associated protein 29 OS=Bos taurus GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|Q9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 OS=Homo sapiens GN=VPS29 PE=1 SV=1 Back     alignment and function description
>sp|Q6DEU3|VPS29_XENTR Vacuolar protein sorting-associated protein 29 OS=Xenopus tropicalis GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q6GP62|VPS29_XENLA Vacuolar protein sorting-associated protein 29 OS=Xenopus laevis GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIL2|VPS29_CHICK Vacuolar protein sorting-associated protein 29 OS=Gallus gallus GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZV68|VPS29_DANRE Vacuolar protein sorting-associated protein 29 OS=Danio rerio GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q54IF7|VPS29_DICDI Vacuolar protein sorting-associated protein 29 OS=Dictyostelium discoideum GN=vps29 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
307166976126 Vacuolar protein sorting-associated prot 0.879 0.634 0.825 3e-35
58383585182 AGAP002338-PA [Anopheles gambiae str. PE 0.868 0.434 0.848 4e-35
307212288 562 Vacuolar protein sorting-associated prot 0.835 0.135 0.868 5e-35
312378651184 hypothetical protein AND_09749 [Anophele 0.868 0.429 0.835 5e-35
383861650 197 PREDICTED: vacuolar protein sorting-asso 0.835 0.385 0.868 8e-35
242025158182 vacuolar protein sorting, putative [Pedi 0.835 0.417 0.868 1e-34
350401456186 PREDICTED: vacuolar protein sorting-asso 0.835 0.408 0.868 1e-34
345479785182 PREDICTED: vacuolar protein sorting-asso 0.835 0.417 0.868 1e-34
340729114182 PREDICTED: vacuolar protein sorting-asso 0.835 0.417 0.868 1e-34
332020652 209 Vacuolar protein sorting-associated prot 0.835 0.363 0.868 1e-34
>gi|307166976|gb|EFN60837.1| Vacuolar protein sorting-associated protein 29 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 66/80 (82%), Positives = 76/80 (95%)

Query: 1  MKGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYE 60
          ++  +YPE+KVVTVGQFRIGL HGH ++PWGDPE+LAL+QRQLDVDILISGHTHKFEAYE
Sbjct: 8  LQNLNYPEQKVVTVGQFRIGLSHGHQVVPWGDPESLALIQRQLDVDILISGHTHKFEAYE 67

Query: 61 HENKFYINPGSATGAFNPLE 80
          HENKFYINPGSATGA+NPL+
Sbjct: 68 HENKFYINPGSATGAYNPLD 87

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|58383585|ref|XP_312630.2| AGAP002338-PA [Anopheles gambiae str. PEST] gi|55242454|gb|EAA08218.2| AGAP002338-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307212288|gb|EFN88096.1| Vacuolar protein sorting-associated protein 29 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|312378651|gb|EFR25167.1| hypothetical protein AND_09749 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|383861650|ref|XP_003706298.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242025158|ref|XP_002432993.1| vacuolar protein sorting, putative [Pediculus humanus corporis] gi|212518502|gb|EEB20255.1| vacuolar protein sorting, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350401456|ref|XP_003486158.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345479785|ref|XP_001604061.2| PREDICTED: vacuolar protein sorting-associated protein 29-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340729114|ref|XP_003402853.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Bombus terrestris] gi|380013829|ref|XP_003690948.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Apis florea] Back     alignment and taxonomy information
>gi|332020652|gb|EGI61058.1| Vacuolar protein sorting-associated protein 29 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
FB|FBgn0031310182 CG4764 [Drosophila melanogaste 0.835 0.417 0.855 2e-33
UNIPROTKB|G3X6P5185 VPS29 "Vacuolar protein sortin 0.835 0.410 0.828 6e-32
UNIPROTKB|Q3T0M0186 VPS29 "Vacuolar protein sortin 0.835 0.408 0.828 6e-32
UNIPROTKB|E2R8A2180 VPS29 "Uncharacterized protein 0.835 0.422 0.828 6e-32
UNIPROTKB|F8VXU5214 VPS29 "Vacuolar protein sortin 0.835 0.355 0.828 6e-32
UNIPROTKB|H3BLV8199 VPS29 "Vacuolar protein sortin 0.835 0.381 0.828 6e-32
UNIPROTKB|Q9UBQ0182 VPS29 "Vacuolar protein sortin 0.835 0.417 0.828 6e-32
UNIPROTKB|F1RNN0186 VPS29 "Uncharacterized protein 0.835 0.408 0.828 6e-32
MGI|MGI:1928344182 Vps29 "vacuolar protein sortin 0.835 0.417 0.828 6e-32
RGD|1308332182 Vps29 "vacuolar protein sortin 0.835 0.417 0.828 6e-32
FB|FBgn0031310 CG4764 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
 Identities = 65/76 (85%), Positives = 73/76 (96%)

Query:     5 SYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENK 64
             +YPE+KVVTVGQFRIGLCHGH ++P GDPEALAL+QRQLDVDILI+GHT+KFEAYEH NK
Sbjct:    68 TYPEQKVVTVGQFRIGLCHGHQVVPRGDPEALALIQRQLDVDILITGHTYKFEAYEHGNK 127

Query:    65 FYINPGSATGAFNPLE 80
             FYINPGSATGAFNPL+
Sbjct:   128 FYINPGSATGAFNPLD 143
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA
UNIPROTKB|G3X6P5 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0M0 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8A2 VPS29 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8VXU5 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BLV8 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBQ0 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNN0 VPS29 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1928344 Vps29 "vacuolar protein sorting 29 (S. pombe)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308332 Vps29 "vacuolar protein sorting 29 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7ZV68VPS29_DANRE3, ., 1, ., 3, ., 30.81570.83510.4175yesN/A
Q5R9Z1VPS29_PONAB3, ., 1, ., 3, ., 30.82890.83510.4175yesN/A
Q9QZ88VPS29_MOUSE3, ., 1, ., 3, ., 30.82890.83510.4175yesN/A
B2RZ78VPS29_RAT3, ., 1, ., 3, ., 30.82890.83510.4175yesN/A
Q3T0M0VPS29_BOVIN3, ., 1, ., 3, ., 30.82890.83510.4086yesN/A
Q9UTI5VPS29_SCHPONo assigned EC number0.54540.72520.3529yesN/A
Q9STT2VPS29_ARATHNo assigned EC number0.64860.81310.3894yesN/A
Q54IF7VPS29_DICDI3, ., 1, ., 3, ., 30.64470.83510.4153yesN/A
Q9UBQ0VPS29_HUMAN3, ., 1, ., 3, ., 30.82890.83510.4175yesN/A
Q6DEU3VPS29_XENTR3, ., 1, ., 3, ., 30.82890.83510.4175yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
cd07394178 cd07394, MPP_Vps29, Homo sapiens Vps29 and related 4e-53
COG0622172 COG0622, COG0622, Predicted phosphoesterase [Gener 2e-23
TIGR00040158 TIGR00040, yfcE, phosphoesterase, MJ0936 family 2e-23
pfam12850146 pfam12850, Metallophos_2, Calcineurin-like phospho 1e-19
cd00841155 cd00841, MPP_YfcE, Escherichia coli YfcE and relat 8e-18
PRK09453182 PRK09453, PRK09453, phosphodiesterase; Provisional 5e-08
cd07398217 cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH 4e-06
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 2e-04
COG2908237 COG2908, COG2908, Uncharacterized protein conserve 5e-04
>gnl|CDD|163637 cd07394, MPP_Vps29, Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information 
 Score =  163 bits (414), Expect = 4e-53
 Identities = 61/79 (77%), Positives = 72/79 (91%)

Query: 3   GTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHE 62
             +YPE KV+TVGQF+IGL HGH ++PWGDP++LA LQRQLDVDILISGHTHKFEA+EHE
Sbjct: 65  NLNYPETKVITVGQFKIGLIHGHQVVPWGDPDSLAALQRQLDVDILISGHTHKFEAFEHE 124

Query: 63  NKFYINPGSATGAFNPLEP 81
            KF+INPGSATGAF+PL+P
Sbjct: 125 GKFFINPGSATGAFSPLDP 143

Vps29 (vacuolar sorting protein 29), also known as vacuolar membrane protein Pep11, is a subunit of the retromer complex which is responsible for the retrieval of mannose-6-phosphate receptors (MPRs) from the endosomes for retrograde transport back to the Golgi. Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer complex assembly as well as a phosphatase with specificity for the cytoplasmic tail of the MPR. The retromer includes the following 5 subunits: Vps35, Vps26, Vps29, and a dimer of the sorting nexins Vps5 (Snx1), and Vps17 (Snx2). Vps29 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 178
>gnl|CDD|223695 COG0622, COG0622, Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232794 TIGR00040, yfcE, phosphoesterase, MJ0936 family Back     alignment and domain information
>gnl|CDD|221807 pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain Back     alignment and domain information
>gnl|CDD|163617 cd00841, MPP_YfcE, Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|181869 PRK09453, PRK09453, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|163641 cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|225460 COG2908, COG2908, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
COG0622172 Predicted phosphoesterase [General function predic 99.93
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 99.93
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.86
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.85
KOG3325|consensus183 99.8
PRK09453182 phosphodiesterase; Provisional 99.8
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.69
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.21
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.19
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.13
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.12
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 99.07
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.05
COG2129226 Predicted phosphoesterases, related to the Icc pro 99.03
COG2908237 Uncharacterized protein conserved in bacteria [Fun 98.98
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 98.97
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.94
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.79
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 98.77
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 98.73
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.7
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 98.65
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 98.54
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 98.52
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 98.5
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 98.46
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 98.27
PRK04036504 DNA polymerase II small subunit; Validated 98.26
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.25
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 98.23
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 98.2
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 98.18
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 98.18
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.04
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 98.03
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 97.94
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 97.93
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 97.8
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 97.71
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 97.56
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 97.56
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 97.45
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 97.39
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 97.36
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 97.34
PTZ00422394 glideosome-associated protein 50; Provisional 97.31
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 97.3
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 97.2
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 97.2
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 97.13
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 97.03
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 96.99
COG1768230 Predicted phosphohydrolase [General function predi 96.96
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 96.95
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 96.93
cd07381239 MPP_CapA CapA and related proteins, metallophospha 96.82
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.71
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 96.7
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 96.69
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.58
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 96.57
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 96.54
PLN02533427 probable purple acid phosphatase 96.5
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 96.5
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 96.49
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 96.46
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 96.42
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.41
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 96.41
PRK11340271 phosphodiesterase YaeI; Provisional 96.34
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 96.3
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 96.22
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.93
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 95.9
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 95.58
PHA03008234 hypothetical protein; Provisional 95.5
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 95.05
COG1409301 Icc Predicted phosphohydrolases [General function 95.01
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 94.65
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 94.0
COG1408284 Predicted phosphohydrolases [General function pred 93.95
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 93.79
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 93.29
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 93.07
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 92.72
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 92.09
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 91.23
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 91.14
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 91.1
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 90.01
PRK09982142 universal stress protein UspD; Provisional 89.5
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 89.02
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 88.74
COG1168 388 MalY Bifunctional PLP-dependent enzyme with beta-c 88.08
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 87.74
KOG2310|consensus 646 86.2
KOG1378|consensus452 85.4
PRK15005144 universal stress protein F; Provisional 81.43
PHA02546 340 47 endonuclease subunit; Provisional 80.26
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information 
Probab=99.93  E-value=1.3e-25  Score=148.43  Aligned_cols=88  Identities=35%  Similarity=0.488  Sum_probs=80.9

Q ss_pred             CCCC----CCCceEEEEECCEEEEEecCCCCCCCCCHHHHHHHHhhCCCCEEEEcCccCccEEEECCEEEEccCCcCCCC
Q psy10860          1 MKGT----SYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAF   76 (91)
Q Consensus         1 ~~~~----~lP~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~dvvi~GHtH~~~~~~~~~~~~iNPGS~~~~~   76 (91)
                      ||+.    .+|+...++++|+||+++||+.+.+..+...+..++++.++|++||||||+|..++.+++++|||||++.||
T Consensus        62 ~D~~~~~~~~p~~~~~~~~g~ki~l~HGh~~~~~~~~~~l~~la~~~~~Dvli~GHTH~p~~~~~~~i~~vNPGS~s~pr  141 (172)
T COG0622          62 CDGEVDQEELPEELVLEVGGVKIFLTHGHLYFVKTDLSLLEYLAKELGADVLIFGHTHKPVAEKVGGILLVNPGSVSGPR  141 (172)
T ss_pred             CCCccccccCChhHeEEECCEEEEEECCCccccccCHHHHHHHHHhcCCCEEEECCCCcccEEEECCEEEEcCCCcCCCC
Confidence            6755    799999999999999999999988888888999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCceEEEeeC
Q psy10860         77 NPLEPLNGRYANVKS   91 (91)
Q Consensus        77 ~~~~~~~a~Y~il~~   91 (91)
                      ++ .  .++|++|+.
T Consensus       142 ~~-~--~~sy~il~~  153 (172)
T COG0622         142 GG-N--PASYAILDV  153 (172)
T ss_pred             CC-C--CcEEEEEEc
Confidence            87 3  569999973

>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3325|consensus Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>PHA03008 hypothetical protein; Provisional Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>KOG2310|consensus Back     alignment and domain information
>KOG1378|consensus Back     alignment and domain information
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
1z2w_A192 Crystal Structure Of Mouse Vps29 Complexed With Mn2 3e-34
1w24_A182 Crystal Structure Of Human Vps29 Length = 182 4e-34
2r17_A183 Functional Architecture Of The Retromer Cargo-Recog 5e-34
2a22_A215 Structure Of Vacuolar Protein Sorting 29 From Crypt 8e-22
>pdb|1Z2W|A Chain A, Crystal Structure Of Mouse Vps29 Complexed With Mn2+ Length = 192 Back     alignment and structure 
Iteration: 1

 Score =  139 bits (351), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 63/76 (82%), Positives = 70/76 (92%)
Query: 5   SYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENK 64
           +YPE+KVVTVGQF+IGL HGH +IPWGD  +LALLQRQ DVDILISGHTHKFEA+EHENK
Sbjct: 78  NYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENK 137
Query: 65  FYINPGSATGAFNPLE 80
           FYINPGSATGA+N LE
Sbjct: 138 FYINPGSATGAYNALE 153
>pdb|1W24|A Chain A, Crystal Structure Of Human Vps29 Length = 182 Back     alignment and structure
>pdb|2R17|A Chain A, Functional Architecture Of The Retromer Cargo-Recognition Complex Length = 183 Back     alignment and structure
>pdb|2A22|A Chain A, Structure Of Vacuolar Protein Sorting 29 From Cryptosporidium Parvum Length = 215 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 1e-33
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 3e-30
3ck2_A176 Conserved uncharacterized protein (predicted phosp 3e-25
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 9e-25
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 8e-16
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 8e-15
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 2e-06
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Length = 215 Back     alignment and structure
 Score =  114 bits (286), Expect = 1e-33
 Identities = 40/78 (51%), Positives = 56/78 (71%)

Query: 4   TSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHEN 63
             +PE  VV +G+F+IGL HG+ ++PW DP +L   QR+LD DIL++GHTHK   +E   
Sbjct: 101 GVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNG 160

Query: 64  KFYINPGSATGAFNPLEP 81
           K ++NPG+ATGAF+ L P
Sbjct: 161 KLFLNPGTATGAFSALTP 178
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Length = 192 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Length = 176 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Length = 178 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Length = 190 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Length = 208 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.86
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.85
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.84
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.82
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.78
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.77
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.72
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.68
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.64
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.4
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.36
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 99.35
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.31
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.26
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.25
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.18
1ute_A313 Protein (II purple acid phosphatase); tartrate res 98.88
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 98.83
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 98.81
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 98.71
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 98.71
2q8u_A336 Exonuclease, putative; structural genomics, joint 98.68
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.67
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 98.58
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.41
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 98.28
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 98.25
3qfk_A 527 Uncharacterized protein; structural genomics, cent 97.93
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 97.87
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 97.83
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 97.61
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 97.34
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 97.19
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 97.07
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 97.02
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 97.02
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 96.71
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 96.48
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 96.17
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 96.16
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 96.02
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 95.7
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 95.18
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 95.08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 94.65
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 94.64
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 92.78
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 81.92
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 81.08
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
Probab=99.86  E-value=1.3e-21  Score=135.17  Aligned_cols=87  Identities=22%  Similarity=0.280  Sum_probs=73.6

Q ss_pred             CCCCceEEEEECCEEEEEecCCCCCC-------CCCHHHHHHHHhhCCCCEEEEcCccCccEEEE-CCEEEEccCCcCCC
Q psy10860          4 TSYPEKKVVTVGQFRIGLCHGHDIIP-------WGDPEALALLQRQLDVDILISGHTHKFEAYEH-ENKFYINPGSATGA   75 (91)
Q Consensus         4 ~~lP~~~~~~~~g~~i~~~Hg~~~~~-------~~~~~~l~~~~~~~~~dvvi~GHtH~~~~~~~-~~~~~iNPGS~~~~   75 (91)
                      ..||....+++++.+|+++||++..+       ....+.+.++++..++|+++|||||+|..... +++++|||||+|+|
T Consensus       117 ~~LP~~~~~~~~g~~i~lvHg~p~~~~~~~~~~~~~~~~l~~~~~~~~~d~~i~GHtH~~~~~~~~~~~~~iNpGSvg~p  196 (270)
T 3qfm_A          117 HNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQP  196 (270)
T ss_dssp             HSCCSEEEEEETTEEEEEESSBTTBSSSSTTSTTCCHHHHHHTTTTTTCSEEECCSSCSEEEEECTTSCEEEEECCSSSC
T ss_pred             HhCCCceEEEECCcEEEEEECCCCCCCCceecCCCcHHHHHHHhcccCCCEEEECCcCchHheeccCCEEEEECCCccCC
Confidence            36899999999999999999987543       23456677777778999999999999998874 79999999999999


Q ss_pred             CCCCC----CCCceEEEee
Q psy10860         76 FNPLE----PLNGRYANVK   90 (91)
Q Consensus        76 ~~~~~----~~~a~Y~il~   90 (91)
                      +++.+    +++|+|+||+
T Consensus       197 r~~~~~~~~~~~asyaild  215 (270)
T 3qfm_A          197 FFLDAQLRKDLRAQYMILE  215 (270)
T ss_dssp             CCSSTTGGGCCCEEEEEEE
T ss_pred             CCCCccccCCCCCEEEEEE
Confidence            98754    4689999997
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d2a22a1193 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, V 3e-20
d1z2wa1182 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, V 3e-19
d3ck2a1173 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 1e-13
d1s3la_165 d.159.1.7 (A:) Putative phosphodiesterase MJ0936 { 6e-13
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 1e-07
d3d03a1271 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ 5e-04
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 0.002
d2nxfa1320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo 0.004
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Cryptosporidium parvum [TaxId: 5807]

 Score = 77.8 bits (191), Expect = 3e-20
 Identities = 40/77 (51%), Positives = 56/77 (72%)

Query: 5   SYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENK 64
            +PE  VV +G+F+IGL HG+ ++PW DP +L   QR+LD DIL++GHTHK   +E   K
Sbjct: 80  VFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGK 139

Query: 65  FYINPGSATGAFNPLEP 81
            ++NPG+ATGAF+ L P
Sbjct: 140 LFLNPGTATGAFSALTP 156
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Length = 173 Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Length = 165 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Length = 271 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 99.94
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.94
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 99.93
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.9
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.74
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.74
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.19
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.18
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 98.59
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 98.28
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 98.2
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 98.0
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.8
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 97.69
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 97.55
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 97.36
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 96.92
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 93.44
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 92.42
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 80.5
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.94  E-value=2.3e-26  Score=150.20  Aligned_cols=90  Identities=70%  Similarity=1.172  Sum_probs=82.1

Q ss_pred             CC-CCCCCceEEEEECCEEEEEecCCCCCCCCCHHHHHHHHhhCCCCEEEEcCccCccEEEECCEEEEccCCcCCCCCCC
Q psy10860          1 MK-GTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPL   79 (91)
Q Consensus         1 ~~-~~~lP~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~dvvi~GHtH~~~~~~~~~~~~iNPGS~~~~~~~~   79 (91)
                      +| +..+|++..+++++.+|+++||++..++...+.+.+.++..++|+++|||||+|..++.+++++|||||+++||++.
T Consensus        63 ~D~~~~~p~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~divi~GHTH~p~~~~~~~~~~iNPGSv~~pr~~~  142 (182)
T d1z2wa1          63 FDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNAL  142 (182)
T ss_dssp             TCCCTTSCSEEEEEETTEEEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCCCEEEEETTEEEEECCCTTCCCCSS
T ss_pred             cCcccccceEEEEEEcCcEEEEEeCCCCCCCCCHHHHHHHHhccCCCEEEECCcCcceEEEECCEEEEeCCCCCCCCCCC
Confidence            45 56799999999999999999999998888899999899899999999999999999999999999999999999864


Q ss_pred             C-CCCceEEEee
Q psy10860         80 E-PLNGRYANVK   90 (91)
Q Consensus        80 ~-~~~a~Y~il~   90 (91)
                      + ++.|||+|||
T Consensus       143 ~~~~~~syaild  154 (182)
T d1z2wa1         143 ETNIIPSFVLMD  154 (182)
T ss_dssp             CSCCCCEEEEEE
T ss_pred             CCCCCCEEEEEE
Confidence            3 4689999997
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure