Psyllid ID: psy10867


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MSLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDFTPK
cccEEEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEEccccEEEEEcccccEEEEEcccccccEEcccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEEccccccccccccccccEEEcccccccEEEEEEcccccccEEEEEEccccEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEccccccccEEEEcccccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEEEccccEEEEEcccc
ccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEcccccc
MSLLNEVafsydgsgaisvwepkggtllmsykgasvlsphsmcllgndyvlgvekgkpmiqawpvnsQEKAQLRLicpgrissmqaspdAAYIAVSIETKLHMWQISSGRLLatasshyqpitIVKWSadsnfivtggedgTICVWQLSRLICKqtvafgipgssgkgvtglteplhvksqhslpvthVTLSKLGaksrvasvshdrtckifdlctGEDLLSLILDTRLtcvafdgtedniymgtsegVIKSFclrqvprtrdhhiqdstsnpdfighekqvtslscSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGaflgllppaihdydftpk
MSLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKsrvasvshdrtCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIqdstsnpdfigHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLgllppaihdydftpk
MSLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDFTPK
*****EVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRT*************FIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDF***
MSLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDY*FT**
MSLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDFTPK
*SLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLNEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDFTPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
Q68EI0431 WD repeat-containing prot yes N/A 0.956 0.761 0.352 7e-57
Q9BV38432 WD repeat-containing prot yes N/A 0.956 0.759 0.338 2e-52
Q4VBE8431 WD repeat-containing prot yes N/A 0.903 0.719 0.332 3e-51
Q499N3431 WD repeat-containing prot yes N/A 0.900 0.716 0.331 5e-51
Q3SZD4432 WD repeat-containing prot yes N/A 0.941 0.747 0.334 3e-50
A5DTA8 521 Pre-rRNA-processing prote N/A N/A 0.623 0.410 0.297 2e-21
Q22006 529 Pre-rRNA-processing prote yes N/A 0.810 0.525 0.260 3e-20
Q10272446 Pre-rRNA-processing prote yes N/A 0.842 0.647 0.254 3e-20
A8WSU9 532 Pre-rRNA-processing prote N/A N/A 0.819 0.528 0.268 8e-20
Q6BMP5 515 Pre-rRNA-processing prote yes N/A 0.612 0.407 0.275 2e-17
>sp|Q68EI0|WDR18_DANRE WD repeat-containing protein 18 OS=Danio rerio GN=wdr18 PE=2 SV=1 Back     alignment and function desciption
 Score =  221 bits (563), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 196/346 (56%), Gaps = 18/346 (5%)

Query: 1   MSLLNEVAFSYDGSGAI---SVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGK 57
           MS   EV  S D +G +   +V++P  G+  +SY+G +  S  S+ +L  +Y+LG + GK
Sbjct: 1   MSAPVEVVLSADSAGQLFNCAVYDPHTGSEFLSYRGGNT-SSRSLTILNGEYILGAQLGK 59

Query: 58  PMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASS 117
             I  W +  +++ Q +++CPG ++ + ASPD  Y+   I   +++W++S+G LLA  S 
Sbjct: 60  NYINVWEIQRKDQLQQKIVCPGIVTCLCASPDGLYVLAGIAEAIYLWEVSTGNLLAILSR 119

Query: 118 HYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLH 177
           H+Q ++ +K++ DS+  V+GG+D    +W LS ++  Q  +   P           EP H
Sbjct: 120 HFQDLSCIKFTDDSSHFVSGGKDNLAFIWNLSSVV--QLDSSRTP-----------EPRH 166

Query: 178 VKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGT 237
           + S+HSLP+T +    +G ++RVA+ S D+T K++++ +GE LLS++ D  +  V FD  
Sbjct: 167 ILSRHSLPITDIHCGLMGPQARVATASLDQTVKVWEISSGEMLLSVLFDVGIMSVTFDPC 226

Query: 238 EDNIYMGTSEGVIKSFCLRQVPRTRDHHIQ-DSTSNPDFIGHEKQVTSLSCSITGITLLS 296
           E  ++ G S+G I    L     +RD   Q DS  N  F GH   VT LS S+ G  LLS
Sbjct: 227 EYFLFCGGSDGNIFQVSLCSTSLSRDKTFQSDSEGNQVFKGHRNLVTCLSVSMDGTVLLS 286

Query: 297 SSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDFTP 342
            S DET+++W   S+QC+ TI H+GPV  A +   P  +   D  P
Sbjct: 287 GSNDETVRMWDVQSKQCIWTINHRGPVTNAAIIPAPANMFLSDSHP 332




Involved in left-right determination through controlling the correct clustering and migration of dorsal forerunner cells (DFCs) and Kupffer's vesicle formation.
Danio rerio (taxid: 7955)
>sp|Q9BV38|WDR18_HUMAN WD repeat-containing protein 18 OS=Homo sapiens GN=WDR18 PE=1 SV=2 Back     alignment and function description
>sp|Q4VBE8|WDR18_MOUSE WD repeat-containing protein 18 OS=Mus musculus GN=Wdr18 PE=1 SV=1 Back     alignment and function description
>sp|Q499N3|WDR18_RAT WD repeat-containing protein 18 OS=Rattus norvegicus GN=Wdr18 PE=2 SV=1 Back     alignment and function description
>sp|Q3SZD4|WDR18_BOVIN WD repeat-containing protein 18 OS=Bos taurus GN=WDR18 PE=2 SV=1 Back     alignment and function description
>sp|A5DTA8|IPI3_LODEL Pre-rRNA-processing protein IPI3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IPI3 PE=3 SV=1 Back     alignment and function description
>sp|Q22006|PRO1_CAEEL Pre-rRNA-processing protein pro-1 OS=Caenorhabditis elegans GN=pro-1 PE=2 SV=1 Back     alignment and function description
>sp|Q10272|IPI3_SCHPO Pre-rRNA-processing protein crb3/ipi3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crb3 PE=1 SV=1 Back     alignment and function description
>sp|A8WSU9|PRO1_CAEBR Pre-rRNA-processing protein pro-1 OS=Caenorhabditis briggsae GN=pro-1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BMP5|IPI3_DEBHA Pre-rRNA-processing protein IPI3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPI3 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
193613094 480 PREDICTED: WD repeat-containing protein 0.976 0.697 0.449 2e-79
357614607 1337 hypothetical protein KGM_15711 [Danaus p 0.982 0.252 0.393 1e-68
157138647422 PAF acetylhydrolase 45 kDa subunit, puta 0.941 0.765 0.384 8e-63
170048384 444 WD repeat protein 18 [Culex quinquefasci 0.941 0.727 0.364 3e-60
383856392424 PREDICTED: WD repeat-containing protein 0.897 0.726 0.374 5e-59
405952754 2469 ATP-binding cassette sub-family A member 0.895 0.124 0.376 7e-56
260813306418 hypothetical protein BRAFLDRAFT_82717 [B 0.924 0.758 0.368 9e-56
82524836428 WD repeat domain 18 [Xenopus (Silurana) 0.938 0.752 0.35 9e-56
91084787407 PREDICTED: similar to PAF acetylhydrolas 0.862 0.727 0.387 1e-55
62826031427 LOC733228 protein [Xenopus laevis] 0.909 0.730 0.360 1e-55
>gi|193613094|ref|XP_001944470.1| PREDICTED: WD repeat-containing protein 18-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 216/338 (63%), Gaps = 3/338 (0%)

Query: 6   EVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPV 65
           EVAF  DG+   +VW+   GT+L +Y+  + +  + M LLGNDY++  +KG P+IQAWP+
Sbjct: 8   EVAFVSDGTSGATVWDTTNGTMLKTYRHTASIGQNCMSLLGNDYLIAADKG-PLIQAWPI 66

Query: 66  NSQEKA-QLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASSHYQPITI 124
           NSQE+  Q+R++C G+I+S+ ASPD  YIAV+I  KL +W   SGRLL T S H+QPITI
Sbjct: 67  NSQERTHQVRMLCGGKINSLAASPDGLYIAVAISEKLQVWMACSGRLLTTVSRHFQPITI 126

Query: 125 VKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSL 184
           +KWS+D +++VTGGEDG +CVW L++LI     +      SG  +   + P ++ S HS+
Sbjct: 127 IKWSSDGSYLVTGGEDGLVCVWSLAKLINTSQSSMPQTFISGDQIDQ-SAPTYIFSDHSV 185

Query: 185 PVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMG 244
            +T V +       R+ + S D+TCKI+DL TG  LLS+  D   + +  D  E  +Y+G
Sbjct: 186 RITGVYIGNCTRCIRIFTTSVDKTCKIYDLSTGIMLLSIAFDIIPSSLTVDSIETAVYIG 245

Query: 245 TSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLK 304
           T+ G I+SF L   PRTR+ ++ D  S   F+GH K VT+LS S+ G  L+S S D T++
Sbjct: 246 TTAGPIRSFDLTSPPRTRECYVSDKESGIKFVGHAKAVTALSVSLFGDMLVSGSTDCTIR 305

Query: 305 IWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHDYDFTP 342
            WH  SRQCLRTIQ K PV+  FL L+P  +   +  P
Sbjct: 306 TWHVASRQCLRTIQLKEPVINMFLTLIPRQLTANELEP 343




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357614607|gb|EHJ69171.1| hypothetical protein KGM_15711 [Danaus plexippus] Back     alignment and taxonomy information
>gi|157138647|ref|XP_001657325.1| PAF acetylhydrolase 45 kDa subunit, putative [Aedes aegypti] gi|108869460|gb|EAT33685.1| AAEL014037-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170048384|ref|XP_001852246.1| WD repeat protein 18 [Culex quinquefasciatus] gi|167870527|gb|EDS33910.1| WD repeat protein 18 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383856392|ref|XP_003703693.1| PREDICTED: WD repeat-containing protein 18-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|405952754|gb|EKC20528.1| ATP-binding cassette sub-family A member 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|260813306|ref|XP_002601359.1| hypothetical protein BRAFLDRAFT_82717 [Branchiostoma floridae] gi|229286654|gb|EEN57371.1| hypothetical protein BRAFLDRAFT_82717 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|82524836|ref|NP_001032341.1| WD repeat domain 18 [Xenopus (Silurana) tropicalis] gi|89268641|emb|CAJ82427.1| WD repeat domain 18 [Xenopus (Silurana) tropicalis] gi|166796844|gb|AAI59017.1| WD repeat domain 18 [Xenopus (Silurana) tropicalis] gi|166796986|gb|AAI59060.1| WD repeat domain 18 [Xenopus (Silurana) tropicalis] gi|213624258|gb|AAI70854.1| WD repeat domain 18 [Xenopus (Silurana) tropicalis] gi|213626085|gb|AAI70824.1| WD repeat domain 18 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|91084787|ref|XP_972631.1| PREDICTED: similar to PAF acetylhydrolase 45 kDa subunit, putative [Tribolium castaneum] gi|270008596|gb|EFA05044.1| hypothetical protein TcasGA2_TC015135 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|62826031|gb|AAH94198.1| LOC733228 protein [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
ZFIN|ZDB-GENE-040905-4431 wdr18 "WD repeat domain 18" [D 0.927 0.737 0.359 6.1e-55
UNIPROTKB|Q9BV38432 WDR18 "WD repeat-containing pr 0.938 0.745 0.345 4e-51
MGI|MGI:2158400431 Wdr18 "WD repeat domain 18" [M 0.903 0.719 0.341 7.4e-50
RGD|1310646431 Wdr18 "WD repeat domain 18" [R 0.900 0.716 0.340 7.4e-50
UNIPROTKB|Q3SZD4432 WDR18 "WD repeat-containing pr 0.941 0.747 0.337 4.1e-49
DICTYBASE|DDB_G0288659 560 wdr18 "WD40 repeat-containing 0.664 0.407 0.269 9.4e-31
WB|WBGene00004185 529 pro-1 [Caenorhabditis elegans 0.819 0.531 0.259 1.1e-22
POMBASE|SPAC13G7.08c446 crb3 "WD repeat protein Crb3" 0.787 0.605 0.258 6.3e-18
TAIR|locus:2082891 438 RID3 "AT3G49180" [Arabidopsis 0.641 0.502 0.262 8.2e-15
ASPGD|ASPL0000074691 573 AN4771 [Emericella nidulans (t 0.804 0.481 0.245 1.4e-13
ZFIN|ZDB-GENE-040905-4 wdr18 "WD repeat domain 18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 6.1e-55, P = 6.1e-55
 Identities = 122/339 (35%), Positives = 196/339 (57%)

Query:     1 MSLLNEVAFSYDGSGAI---SVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGK 57
             MS   EV  S D +G +   +V++P  G+  +SY+G +  S  S+ +L  +Y+LG + GK
Sbjct:     1 MSAPVEVVLSADSAGQLFNCAVYDPHTGSEFLSYRGGNT-SSRSLTILNGEYILGAQLGK 59

Query:    58 PMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAVSIETKLHMWQISSGRLLATASS 117
               I  W +  +++ Q +++CPG ++ + ASPD  Y+   I   +++W++S+G LLA  S 
Sbjct:    60 NYINVWEIQRKDQLQQKIVCPGIVTCLCASPDGLYVLAGIAEAIYLWEVSTGNLLAILSR 119

Query:   118 HYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLH 177
             H+Q ++ +K++ DS+  V+GG+D    +W LS ++  Q  +   P           EP H
Sbjct:   120 HFQDLSCIKFTDDSSHFVSGGKDNLAFIWNLSSVV--QLDSSRTP-----------EPRH 166

Query:   178 VKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGT 237
             + S+HSLP+T +    +G ++RVA+ S D+T K++++ +GE LLS++ D  +  V FD  
Sbjct:   167 ILSRHSLPITDIHCGLMGPQARVATASLDQTVKVWEISSGEMLLSVLFDVGIMSVTFDPC 226

Query:   238 EDNIYMGTSEGVIKSFCLRQVPRTRDHHIQ-DSTSNPDFIGHEKQVTSLSCSITGITLLS 296
             E  ++ G S+G I    L     +RD   Q DS  N  F GH   VT LS S+ G  LLS
Sbjct:   227 EYFLFCGGSDGNIFQVSLCSTSLSRDKTFQSDSEGNQVFKGHRNLVTCLSVSMDGTVLLS 286

Query:   297 SSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLP-PA 334
              S DET+++W   S+QC+ TI H+GPV  A   ++P PA
Sbjct:   287 GSNDETVRMWDVQSKQCIWTINHRGPVTNA--AIIPAPA 323




GO:0070121 "Kupffer's vesicle development" evidence=IMP
GO:0007368 "determination of left/right symmetry" evidence=IGI;IMP
GO:0007275 "multicellular organismal development" evidence=IEA
UNIPROTKB|Q9BV38 WDR18 "WD repeat-containing protein 18" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2158400 Wdr18 "WD repeat domain 18" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310646 Wdr18 "WD repeat domain 18" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZD4 WDR18 "WD repeat-containing protein 18" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288659 wdr18 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00004185 pro-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC13G7.08c crb3 "WD repeat protein Crb3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2082891 RID3 "AT3G49180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000074691 AN4771 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q499N3WDR18_RATNo assigned EC number0.33120.90080.7169yesN/A
Q9BV38WDR18_HUMANNo assigned EC number0.33810.95620.7592yesN/A
Q68EI0WDR18_DANRENo assigned EC number0.35260.95620.7610yesN/A
Q4VBE8WDR18_MOUSENo assigned EC number0.33230.90370.7192yesN/A
Q3SZD4WDR18_BOVINNo assigned EC number0.33430.94160.7476yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-22
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-20
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-19
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 3e-15
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-15
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-08
smart0032040 smart00320, WD40, WD40 repeats 3e-07
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-04
smart0032040 smart00320, WD40, WD40 repeats 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 93.2 bits (232), Expect = 8e-22
 Identities = 69/250 (27%), Positives = 111/250 (44%), Gaps = 40/250 (16%)

Query: 78  PGRISSMQASPDAAYIAV-SIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVT 136
            G ++ +  SPD   +A  S +  + +W + +G LL T   H  P+  V  SAD  ++ +
Sbjct: 9   TGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLAS 68

Query: 137 GGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSKLGA 196
           G  D TI +W L    C +T+                        H+  V+ V  S  G 
Sbjct: 69  GSSDKTIRLWDLETGECVRTLT----------------------GHTSYVSSVAFSPDG- 105

Query: 197 KSRVASVSHDRTCKIFDLCTGEDLLSL--ILDTRLTCVAFDGTEDNIYMGTSEGVIKSFC 254
              ++S S D+T K++D+ TG+ L +L    D  +  VAF      +   + +G IK + 
Sbjct: 106 -RILSSSSRDKTIKVWDVETGKCLTTLRGHTDW-VNSVAFSPDGTFVASSSQDGTIKLWD 163

Query: 255 LRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCL 314
           LR                    GH  +V S++ S  G  LLSSS+D T+K+W   + +CL
Sbjct: 164 LRTGKCVA-----------TLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCL 212

Query: 315 RTIQ-HKGPV 323
            T++ H+  V
Sbjct: 213 GTLRGHENGV 222


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
KOG0315|consensus311 100.0
KOG0286|consensus343 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0318|consensus603 100.0
KOG0263|consensus707 100.0
KOG0295|consensus406 100.0
KOG0284|consensus464 100.0
KOG0295|consensus406 100.0
KOG0273|consensus524 100.0
KOG0284|consensus464 100.0
KOG0316|consensus307 100.0
KOG0296|consensus399 100.0
KOG0265|consensus338 100.0
KOG0319|consensus 775 100.0
KOG0291|consensus 893 100.0
KOG0266|consensus456 100.0
KOG0291|consensus 893 100.0
KOG0285|consensus460 100.0
KOG0318|consensus603 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0273|consensus524 100.0
KOG0645|consensus312 100.0
KOG0285|consensus460 100.0
KOG0319|consensus 775 100.0
KOG0281|consensus499 100.0
KOG0276|consensus 794 100.0
KOG0645|consensus312 100.0
KOG0263|consensus707 100.0
KOG0266|consensus456 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0292|consensus 1202 100.0
KOG0292|consensus 1202 100.0
KOG0282|consensus503 100.0
KOG0646|consensus 476 100.0
KOG0276|consensus 794 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0310|consensus 487 100.0
KOG0643|consensus327 100.0
KOG0282|consensus503 100.0
KOG0281|consensus499 100.0
KOG0265|consensus338 100.0
KOG0306|consensus 888 100.0
KOG0293|consensus519 100.0
KOG0278|consensus334 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG1446|consensus311 100.0
KOG0313|consensus423 100.0
KOG0305|consensus484 100.0
KOG1407|consensus313 100.0
KOG0296|consensus399 100.0
KOG0306|consensus 888 100.0
KOG0278|consensus334 100.0
KOG0288|consensus459 100.0
KOG0313|consensus423 100.0
KOG0316|consensus307 100.0
KOG0299|consensus479 100.0
KOG0275|consensus508 100.0
KOG0277|consensus311 100.0
KOG0275|consensus508 100.0
KOG0274|consensus537 100.0
KOG1539|consensus 910 100.0
KOG0310|consensus 487 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0283|consensus 712 100.0
KOG0647|consensus347 100.0
KOG0289|consensus506 100.0
KOG0277|consensus311 100.0
KOG0268|consensus433 100.0
KOG0293|consensus519 100.0
KOG0643|consensus327 100.0
KOG0973|consensus 942 100.0
KOG1036|consensus323 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0772|consensus 641 100.0
KOG0640|consensus430 100.0
KOG0300|consensus481 100.0
KOG0294|consensus362 100.0
KOG2106|consensus 626 100.0
PTZ00421 493 coronin; Provisional 100.0
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 100.0
KOG0283|consensus 712 100.0
KOG0289|consensus506 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0288|consensus459 100.0
KOG0274|consensus537 100.0
KOG0973|consensus 942 100.0
KOG0640|consensus430 100.0
KOG0641|consensus350 100.0
KOG0305|consensus484 100.0
KOG1446|consensus311 100.0
KOG0268|consensus433 100.0
KOG1407|consensus313 100.0
KOG2096|consensus420 100.0
KOG0639|consensus705 100.0
KOG0308|consensus 735 100.0
KOG1408|consensus 1080 100.0
KOG0299|consensus479 100.0
KOG0300|consensus481 100.0
KOG0308|consensus 735 100.0
KOG0641|consensus350 99.98
KOG0772|consensus 641 99.98
KOG0264|consensus422 99.98
KOG1408|consensus 1080 99.98
KOG1274|consensus 933 99.97
KOG0301|consensus 745 99.97
KOG0301|consensus 745 99.97
KOG0264|consensus422 99.97
KOG2048|consensus 691 99.97
KOG1063|consensus764 99.97
KOG0647|consensus347 99.97
KOG0639|consensus705 99.97
KOG1539|consensus 910 99.97
KOG0267|consensus 825 99.97
KOG1332|consensus299 99.97
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.97
KOG2055|consensus514 99.97
KOG1332|consensus299 99.97
KOG1036|consensus323 99.97
KOG2106|consensus626 99.97
KOG2048|consensus 691 99.97
KOG4328|consensus498 99.96
KOG0294|consensus362 99.96
KOG0321|consensus 720 99.96
KOG4378|consensus 673 99.96
KOG1274|consensus 933 99.96
KOG4283|consensus397 99.96
KOG0267|consensus 825 99.96
KOG2055|consensus514 99.96
KOG1273|consensus405 99.96
KOG0646|consensus476 99.96
KOG0269|consensus 839 99.96
KOG4283|consensus397 99.96
KOG0302|consensus440 99.96
KOG2919|consensus406 99.96
KOG2445|consensus361 99.96
KOG0321|consensus 720 99.95
KOG1063|consensus 764 99.95
KOG2096|consensus420 99.95
KOG4378|consensus 673 99.95
KOG0269|consensus 839 99.95
KOG1034|consensus385 99.95
KOG0650|consensus733 99.95
KOG2445|consensus361 99.95
KOG0650|consensus733 99.95
KOG0302|consensus440 99.95
KOG0307|consensus 1049 99.95
KOG1538|consensus 1081 99.94
KOG1445|consensus 1012 99.94
KOG1009|consensus434 99.94
KOG2919|consensus406 99.94
KOG1007|consensus370 99.94
KOG1188|consensus376 99.94
KOG1007|consensus370 99.94
KOG1445|consensus 1012 99.94
KOG1034|consensus385 99.93
KOG0270|consensus463 99.93
KOG4328|consensus498 99.93
KOG0270|consensus463 99.93
KOG1273|consensus 405 99.93
KOG1009|consensus434 99.93
COG2319466 FOG: WD40 repeat [General function prediction only 99.92
KOG1538|consensus 1081 99.91
PRK11028330 6-phosphogluconolactonase; Provisional 99.91
KOG0290|consensus364 99.91
KOG0322|consensus323 99.91
COG2319466 FOG: WD40 repeat [General function prediction only 99.91
KOG0307|consensus 1049 99.91
KOG1524|consensus 737 99.9
KOG0303|consensus 472 99.9
PRK11028330 6-phosphogluconolactonase; Provisional 99.9
KOG1963|consensus 792 99.9
KOG0303|consensus 472 99.89
KOG0644|consensus 1113 99.89
KOG0642|consensus577 99.89
KOG1517|consensus1387 99.89
KOG0649|consensus325 99.89
KOG1587|consensus555 99.89
KOG1523|consensus361 99.88
KOG0322|consensus323 99.88
KOG1963|consensus 792 99.88
PRK01742429 tolB translocation protein TolB; Provisional 99.88
KOG4497|consensus447 99.87
KOG0649|consensus325 99.87
KOG0290|consensus364 99.87
KOG1524|consensus 737 99.87
KOG1188|consensus376 99.87
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.87
PRK01742429 tolB translocation protein TolB; Provisional 99.87
KOG2110|consensus391 99.87
KOG0642|consensus577 99.86
KOG1587|consensus555 99.86
KOG0771|consensus398 99.86
KOG0771|consensus398 99.86
KOG4227|consensus 609 99.86
KOG1334|consensus559 99.85
KOG4497|consensus447 99.85
KOG2110|consensus 391 99.85
KOG1272|consensus 545 99.85
PRK03629429 tolB translocation protein TolB; Provisional 99.84
KOG1523|consensus361 99.84
KOG1517|consensus1387 99.84
PRK04922433 tolB translocation protein TolB; Provisional 99.84
PRK03629429 tolB translocation protein TolB; Provisional 99.83
PRK05137435 tolB translocation protein TolB; Provisional 99.83
KOG0644|consensus 1113 99.82
KOG3881|consensus412 99.82
KOG2315|consensus 566 99.82
KOG1310|consensus 758 99.82
PRK05137435 tolB translocation protein TolB; Provisional 99.81
PRK04922433 tolB translocation protein TolB; Provisional 99.8
PRK02889427 tolB translocation protein TolB; Provisional 99.8
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.8
KOG2111|consensus346 99.8
KOG2321|consensus 703 99.8
KOG2139|consensus445 99.8
KOG1272|consensus 545 99.8
KOG2394|consensus 636 99.79
KOG2394|consensus 636 99.79
KOG2139|consensus445 99.79
KOG1240|consensus1431 99.79
KOG1310|consensus 758 99.79
KOG2111|consensus346 99.79
KOG4227|consensus 609 99.79
PRK02889427 tolB translocation protein TolB; Provisional 99.79
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.78
KOG1240|consensus1431 99.77
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.75
PRK00178430 tolB translocation protein TolB; Provisional 99.75
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.74
KOG1334|consensus559 99.73
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.73
KOG3881|consensus412 99.72
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.72
KOG1409|consensus404 99.72
PRK04792448 tolB translocation protein TolB; Provisional 99.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.71
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.7
PRK00178430 tolB translocation protein TolB; Provisional 99.69
KOG2321|consensus 703 99.69
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.69
PRK01029428 tolB translocation protein TolB; Provisional 99.69
PRK04792448 tolB translocation protein TolB; Provisional 99.69
PRK01029428 tolB translocation protein TolB; Provisional 99.69
KOG2315|consensus 566 99.69
KOG0280|consensus339 99.67
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.67
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.67
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.64
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.64
KOG2314|consensus 698 99.63
KOG1354|consensus433 99.63
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.62
COG4946 668 Uncharacterized protein related to the periplasmic 99.62
KOG0974|consensus 967 99.6
KOG1354|consensus433 99.59
KOG0280|consensus339 99.58
KOG0974|consensus 967 99.57
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.56
KOG4547|consensus 541 99.54
KOG1912|consensus 1062 99.53
KOG4547|consensus 541 99.53
KOG2314|consensus698 99.53
KOG1064|consensus2439 99.51
KOG2041|consensus 1189 99.5
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.49
KOG1064|consensus2439 99.49
KOG4532|consensus344 99.48
COG4946 668 Uncharacterized protein related to the periplasmic 99.47
KOG1912|consensus 1062 99.47
KOG1409|consensus404 99.46
PRK04043419 tolB translocation protein TolB; Provisional 99.46
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.46
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.45
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.45
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.43
KOG3914|consensus 390 99.42
KOG2041|consensus 1189 99.42
KOG0309|consensus 1081 99.42
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.42
PRK04043419 tolB translocation protein TolB; Provisional 99.39
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.38
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.38
KOG4532|consensus344 99.37
KOG4190|consensus1034 99.36
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.33
KOG3914|consensus390 99.32
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.31
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.3
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.28
KOG4190|consensus1034 99.27
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.27
KOG2695|consensus425 99.26
KOG4714|consensus319 99.22
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.21
KOG0309|consensus 1081 99.21
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.2
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 99.2
KOG1832|consensus 1516 99.2
PRK02888 635 nitrous-oxide reductase; Validated 99.19
KOG4714|consensus319 99.17
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.15
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 99.15
KOG0882|consensus 558 99.13
KOG2695|consensus425 99.11
KOG3617|consensus 1416 99.07
KOG0882|consensus 558 99.07
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.03
KOG1275|consensus 1118 99.01
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.99
KOG1832|consensus 1516 98.96
KOG1275|consensus 1118 98.95
KOG2066|consensus 846 98.93
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.89
KOG1645|consensus463 98.89
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.88
KOG4649|consensus354 98.86
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.84
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.84
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.84
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.83
KOG1920|consensus 1265 98.82
KOG1008|consensus 783 98.8
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.77
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.75
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.75
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.73
KOG1920|consensus 1265 98.73
KOG2114|consensus 933 98.71
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.7
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.7
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.69
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.69
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.68
PRK02888 635 nitrous-oxide reductase; Validated 98.67
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.66
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.66
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.65
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.65
COG3391381 Uncharacterized conserved protein [Function unknow 98.65
KOG2066|consensus 846 98.63
KOG2114|consensus 933 98.62
KOG1645|consensus 463 98.61
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.56
KOG4649|consensus354 98.54
KOG1008|consensus 783 98.54
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.53
KOG3621|consensus 726 98.5
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.47
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.45
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.42
KOG3617|consensus 1416 98.36
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.34
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.33
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.3
KOG3621|consensus 726 98.29
COG3391 381 Uncharacterized conserved protein [Function unknow 98.29
KOG4640|consensus 665 98.28
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.21
PRK13616591 lipoprotein LpqB; Provisional 98.2
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.18
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.16
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 98.12
KOG2395|consensus 644 98.12
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.08
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.08
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 98.08
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.04
KOG4640|consensus 665 97.97
PRK13616591 lipoprotein LpqB; Provisional 97.91
KOG1897|consensus1096 97.91
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.9
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.82
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.82
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.81
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.78
KOG2444|consensus238 97.76
KOG2395|consensus644 97.71
KOG2079|consensus 1206 97.7
KOG4499|consensus310 97.7
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.67
PHA02713557 hypothetical protein; Provisional 97.66
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.66
KOG2280|consensus 829 97.65
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.62
KOG4441|consensus571 97.57
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 97.54
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.45
KOG4499|consensus310 97.44
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.42
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.41
KOG2280|consensus 829 97.37
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.35
PHA02713557 hypothetical protein; Provisional 97.33
KOG1897|consensus 1096 97.33
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.26
KOG4441|consensus571 97.21
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 97.21
KOG3630|consensus 1405 97.2
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 97.19
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.06
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.0
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.99
KOG2079|consensus 1206 96.98
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.93
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.93
KOG3630|consensus 1405 96.78
KOG2444|consensus238 96.68
KOG1916|consensus 1283 96.66
PRK13684334 Ycf48-like protein; Provisional 96.59
PRK10115 686 protease 2; Provisional 96.58
COG5167 776 VID27 Protein involved in vacuole import and degra 96.56
PHA03098534 kelch-like protein; Provisional 96.53
PHA03098534 kelch-like protein; Provisional 96.52
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.5
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.48
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.45
KOG2247|consensus 615 96.45
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 96.44
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.43
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.36
COG1520370 FOG: WD40-like repeat [Function unknown] 96.33
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.23
KOG4460|consensus 741 96.09
KOG2377|consensus 657 96.03
PF14727418 PHTB1_N: PTHB1 N-terminus 95.97
KOG1900|consensus 1311 95.89
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.86
KOG1916|consensus 1283 95.84
PLN00033398 photosystem II stability/assembly factor; Provisio 95.79
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.79
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.78
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.77
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 95.7
COG5167776 VID27 Protein involved in vacuole import and degra 95.69
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.69
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.62
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 95.62
PRK10115 686 protease 2; Provisional 95.6
COG4590 733 ABC-type uncharacterized transport system, permeas 95.58
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.44
KOG2377|consensus 657 95.26
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.07
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.05
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.04
PF13449326 Phytase-like: Esterase-like activity of phytase 94.9
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 94.88
PHA02790480 Kelch-like protein; Provisional 94.7
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 94.41
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 94.38
COG3292 671 Predicted periplasmic ligand-binding sensor domain 94.32
KOG1900|consensus 1311 94.23
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 94.14
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.13
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.08
KOG2247|consensus 615 93.9
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 93.9
PHA02790480 Kelch-like protein; Provisional 93.81
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 93.77
PF12768281 Rax2: Cortical protein marker for cell polarity 93.66
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 93.59
PRK13684334 Ycf48-like protein; Provisional 93.55
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.52
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 93.49
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.36
PF12768281 Rax2: Cortical protein marker for cell polarity 93.15
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 93.02
PF13449326 Phytase-like: Esterase-like activity of phytase 92.95
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 92.92
COG4590 733 ABC-type uncharacterized transport system, permeas 92.76
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 92.07
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.0
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 91.98
TIGR01063800 gyrA DNA gyrase, A subunit. This model describes t 91.85
COG3823262 Glutamine cyclotransferase [Posttranslational modi 91.68
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 91.65
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 91.55
PF08801 422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 91.4
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 91.38
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 91.14
COG5276370 Uncharacterized conserved protein [Function unknow 91.1
COG1520370 FOG: WD40-like repeat [Function unknown] 91.08
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 91.07
PF08801422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 91.0
COG5276370 Uncharacterized conserved protein [Function unknow 90.94
KOG4460|consensus 741 90.82
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 90.76
COG5308 1263 NUP170 Nuclear pore complex subunit [Intracellular 90.61
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 90.51
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 90.33
KOG1983|consensus 993 90.08
KOG1898|consensus1205 89.69
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 89.67
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 89.35
>KOG0271|consensus Back     alignment and domain information
Probab=100.00  E-value=7e-57  Score=341.21  Aligned_cols=301  Identities=19%  Similarity=0.252  Sum_probs=266.9

Q ss_pred             ceEEEecCCCCeEEEEecCCceEEEEEecCCCCcceEEEEeCCceEEEEEcCCCeEEEEeCCCcccc-eecccCCcceEE
Q psy10867          5 NEVAFSYDGSGAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKA-QLRLICPGRISS   83 (343)
Q Consensus         5 ~~~~~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~i~iw~~~~~~~~-~~~~~~~~~v~~   83 (343)
                      ...++|++||.++++||+.+..++.+.++|.. .|.|++|+|||+.+|+|+.||.|++||.++++.+ ..+.+|...|++
T Consensus       127 g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~-WVlcvawsPDgk~iASG~~dg~I~lwdpktg~~~g~~l~gH~K~It~  205 (480)
T KOG0271|consen  127 GSRLVTGSGDTTVRLWDLDTETPLFTCKGHKN-WVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQQIGRALRGHKKWITA  205 (480)
T ss_pred             CceEEecCCCceEEeeccCCCCcceeecCCcc-EEEEEEECCCcchhhccccCCeEEEecCCCCCcccccccCcccceeE
Confidence            34455667799999999999999999999999 9999999999999999999999999999999887 778899999999


Q ss_pred             EEECC-----CCCEEEE-ecCCeEEEEEccCCceEEEecccCCCeEEEEEecCCCEEEEecCCCeEEEeecCccceeeee
Q psy10867         84 MQASP-----DAAYIAV-SIETKLHMWQISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTV  157 (343)
Q Consensus        84 ~~~s~-----~~~~l~~-~~d~~i~v~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~  157 (343)
                      ++|.|     ..++||+ +.||.++|||+..++++..+.+|+.+|+|++|-.+ .+|++|+.|++|++|+...+.     
T Consensus       206 Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~-gliySgS~DrtIkvw~a~dG~-----  279 (480)
T KOG0271|consen  206 LAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGE-GLIYSGSQDRTIKVWRALDGK-----  279 (480)
T ss_pred             EeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCC-ceEEecCCCceEEEEEccchh-----
Confidence            99976     5678887 68999999999999999999999999999999644 489999999999999998875     


Q ss_pred             ecCCCCCCCCccccccceeeeecccccceEEEEeec-----------CCC-----------------------ceEEEEe
Q psy10867        158 AFGIPGSSGKGVTGLTEPLHVKSQHSLPVTHVTLSK-----------LGA-----------------------KSRVASV  203 (343)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~-----------~~~-----------------------~~~l~~~  203 (343)
                                       ..+.+.+|...|+.++.+.           .+.                       +..+++|
T Consensus       280 -----------------~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSg  342 (480)
T KOG0271|consen  280 -----------------LCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSG  342 (480)
T ss_pred             -----------------HHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEe
Confidence                             4556678999998888762           121                       1469999


Q ss_pred             eCCCeEEEEecCCCc-eEEEee-cCCcEEEEEEcCCCCEEEEEcCCCcEEEEEeecccccccccccCCCCCCccccccCc
Q psy10867        204 SHDRTCKIFDLCTGE-DLLSLI-LDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQ  281 (343)
Q Consensus       204 ~~d~~i~~wd~~~~~-~~~~~~-~~~~i~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~~~~~~~~~~~  281 (343)
                      +.|.++.+|+....+ ++.... |..-|+.+.|+||++++++++-|..|++||.++++.           +..+++|-+.
T Consensus       343 sDd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~-----------lasfRGHv~~  411 (480)
T KOG0271|consen  343 SDDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKF-----------LASFRGHVAA  411 (480)
T ss_pred             cCCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcch-----------hhhhhhccce
Confidence            999999999876443 444443 788899999999999999999999999999998554           7789999999


Q ss_pred             EEEEEEccCCCEEEEEeCCCcEEEEecccceeeeecc-cCCceEEEEEccCCCeeeeccc
Q psy10867        282 VTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQ-HKGPVLGAFLGLLPPAIHDYDF  340 (343)
Q Consensus       282 v~~~~~s~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~-~~~~v~~~~~sp~~~~l~~~~~  340 (343)
                      |+.++|+.|.++|++||.|.++++|++++.+....+. |.++|.++.|+|||+.+++++-
T Consensus       412 VYqvawsaDsRLlVS~SkDsTLKvw~V~tkKl~~DLpGh~DEVf~vDwspDG~rV~sggk  471 (480)
T KOG0271|consen  412 VYQVAWSADSRLLVSGSKDSTLKVWDVRTKKLKQDLPGHADEVFAVDWSPDGQRVASGGK  471 (480)
T ss_pred             eEEEEeccCccEEEEcCCCceEEEEEeeeeeecccCCCCCceEEEEEecCCCceeecCCC
Confidence            9999999999999999999999999999999999998 9999999999999999998863



>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>TIGR01063 gyrA DNA gyrase, A subunit Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG5308 NUP170 Nuclear pore complex subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 3e-13
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 4e-12
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 4e-12
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-12
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 7e-12
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-11
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-11
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-11
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-11
2h9l_A329 Wdr5delta23 Length = 329 1e-11
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-11
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-11
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-11
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-11
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-11
2gnq_A336 Structure Of Wdr5 Length = 336 1e-11
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-11
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 7e-07
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 8e-07
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 8e-07
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-06
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-06
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 1e-06
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-06
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-06
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 2e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 3e-06
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 4e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 9e-06
2ovp_B 445 Structure Of The Skp1-Fbw7 Complex Length = 445 8e-05
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-04
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 4e-04
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 5e-04
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure

Iteration: 1

Score = 72.4 bits (176), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 75/298 (25%), Positives = 128/298 (42%), Gaps = 54/298 (18%) Query: 56 GKPMIQAWPVNSQEKAQLRLICPGR---ISSMQASPDAAYIAVSIETKL-HMWQISSGRL 111 G P Q+ P + L+ G +SS++ SP+ ++A S KL +W G+ Sbjct: 4 GSPEFQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKF 63 Query: 112 LATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVA------------- 158 T S H I+ V WS+DSN +V+ +D T+ +W +S C +T+ Sbjct: 64 EKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNP 123 Query: 159 ---FGIPGSSGKGV----TGLTEPLHVKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKI 211 + GS + V + L HS PV+ V ++ G S + S S+D C+I Sbjct: 124 QSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG--SLIVSSSYDGLCRI 181 Query: 212 FDLCTGEDLLSLILDTR--LTCVAFDGTEDNIYMGTSEGVIKSF------CLRQVPRTRD 263 +D +G+ L +LI D ++ V F I T + +K + CL+ Sbjct: 182 WDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKT------ 235 Query: 264 HHIQDSTSNPDFIGH--EKQVTSLSCSITGIT-LLSSSADETLKIWHTISRQCLRTIQ 318 + GH EK + S+TG ++S S D + IW+ +++ ++ +Q Sbjct: 236 -----------YTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 282
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 100.0
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 100.0
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.98
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.97
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.97
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.97
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.97
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.97
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.97
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.97
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.97
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.97
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.96
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.96
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.96
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.96
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.96
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.96
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.96
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.95
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.95
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.95
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.95
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.95
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.95
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.94
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.94
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.94
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.94
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.93
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.93
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.93
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.92
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.92
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.92
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.91
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.9
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.9
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.9
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.9
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.89
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.88
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.88
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.88
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.88
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.88
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.87
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.86
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.86
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.86
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.86
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.85
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.85
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.84
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.84
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.84
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.83
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.83
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.83
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.83
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.82
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.82
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.82
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.82
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.81
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.79
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.79
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.78
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.78
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.78
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.77
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.76
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.75
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.74
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.74
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.73
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.72
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.72
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.71
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.71
2qe8_A343 Uncharacterized protein; structural genomics, join 99.71
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.7
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.7
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.69
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.68
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.68
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.67
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.67
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.66
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.65
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.63
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.62
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.61
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.6
2ece_A462 462AA long hypothetical selenium-binding protein; 99.6
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.59
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.59
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.55
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.53
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.52
2ece_A462 462AA long hypothetical selenium-binding protein; 99.52
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.5
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.48
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.48
2qe8_A343 Uncharacterized protein; structural genomics, join 99.47
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.47
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.46
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.45
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.43
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.43
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.4
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.4
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.39
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.39
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.38
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.37
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.36
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.36
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.36
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.32
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.28
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.28
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.26
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.25
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.25
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.22
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.22
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.21
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.2
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.18
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.17
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.14
3v65_B386 Low-density lipoprotein receptor-related protein; 99.13
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.07
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.05
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.01
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.99
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.98
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.9
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.9
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.88
3v65_B386 Low-density lipoprotein receptor-related protein; 98.87
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.87
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.86
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.84
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.83
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.82
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.79
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.79
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.77
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.72
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.71
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.71
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.71
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.69
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.67
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.62
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.61
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.6
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.6
3kya_A496 Putative phosphatase; structural genomics, joint c 98.59
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.57
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 98.56
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.56
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.55
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.52
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.52
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.48
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.46
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.45
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.45
3kya_A496 Putative phosphatase; structural genomics, joint c 98.42
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.42
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.38
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 98.33
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.28
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.25
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 98.15
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.07
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.03
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 98.03
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 98.0
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.98
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.97
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.95
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.92
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.87
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.85
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.83
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.79
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.69
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.69
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.65
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.65
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.64
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.63
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.6
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.56
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.54
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.47
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.37
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.22
3ott_A 758 Two-component system sensor histidine kinase; beta 97.18
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.99
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.97
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.95
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.91
3ott_A 758 Two-component system sensor histidine kinase; beta 96.83
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.83
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.81
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.55
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.54
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.93
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 95.92
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.82
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 95.7
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 95.47
3no0_A276 DNA gyrase subunit A; DNA topology, topoisomerase, 95.43
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.81
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 92.2
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 91.86
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 91.06
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 90.69
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 90.34
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 90.05
1wp5_A 323 Topoisomerase IV; broken beta-propeller, hairpin-i 89.32
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 88.06
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 87.75
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 87.58
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.22
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 87.04
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-i 84.83
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 84.19
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 83.28
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 83.27
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 83.25
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 82.78
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 82.01
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 81.81
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 80.57
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=100.00  E-value=8e-52  Score=335.13  Aligned_cols=279  Identities=15%  Similarity=0.161  Sum_probs=250.1

Q ss_pred             eEEEEEecCCCCcceEEEEeCCceEEEEEcCCCeEEEEeCCCcccceecccCCcceEEEEECCCCCEEEE-ecCCeEEEE
Q psy10867         26 TLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAV-SIETKLHMW  104 (343)
Q Consensus        26 ~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~i~iw~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~-~~d~~i~v~  104 (343)
                      +..+++++|.+ .|.+++|+|++.++++++.||.|++||+.+++.+..+..|..+|.+++|+|++++|++ +.|+.|++|
T Consensus         4 ~~~~~~~~h~~-~V~~~~fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~vw   82 (304)
T 2ynn_A            4 DIKKTFSNRSD-RVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVF   82 (304)
T ss_dssp             CCEEEEEEECS-CEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEE
T ss_pred             eeEEeecCCCC-ceEEEEECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEEE
Confidence            45678999999 9999999999999999999999999999999888888899999999999999999987 689999999


Q ss_pred             EccCCceEEEecccCCCeEEEEEecCCCEEEEecCCCeEEEeecCccceeeeeecCCCCCCCCccccccceeeeeccccc
Q psy10867        105 QISSGRLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLHVKSQHSL  184 (343)
Q Consensus       105 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (343)
                      |+.+++.+..+.+|.+.|.+++|+|++++|++|+.|+.|++||++++..                     ....+.+|..
T Consensus        83 d~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~---------------------~~~~~~~h~~  141 (304)
T 2ynn_A           83 NYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWA---------------------LEQTFEGHEH  141 (304)
T ss_dssp             ETTTCCEEEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGTTE---------------------EEEEECCCCS
T ss_pred             ECCCCcEEEEEeCCCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCCcc---------------------hhhhhcccCC
Confidence            9999999999999999999999999999999999999999999987532                     4456678999


Q ss_pred             ceEEEEeecCCCceEEEEeeCCCeEEEEecCCCceEEEee--cCCcEEEEEEcC--CCCEEEEEcCCCcEEEEEeecccc
Q psy10867        185 PVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLI--LDTRLTCVAFDG--TEDNIYMGTSEGVIKSFCLRQVPR  260 (343)
Q Consensus       185 ~v~~~~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~--~~~~i~~~~~~~--~~~~l~~~~~d~~i~i~d~~~~~~  260 (343)
                      .|.+++|+|.+. .+|++++.|++|++||+++++....+.  +...+..+.|+|  ++++|++|+.|+.|++||+++...
T Consensus       142 ~v~~v~~~p~~~-~~l~sgs~D~~v~iwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~s~s~D~~i~iWd~~~~~~  220 (304)
T 2ynn_A          142 FVMCVAFNPKDP-STFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSC  220 (304)
T ss_dssp             CEEEEEECTTCT-TEEEEEETTSEEEEEETTCSSCSEEEECCCTTCEEEEEECCSTTCCEEEEEETTSEEEEEETTTTEE
T ss_pred             cEEEEEECCCCC-CEEEEEeCCCeEEEEECCCCCccceeccCCcCcEEEEEEEEcCCCCEEEEEcCCCeEEEEeCCCCcc
Confidence            999999999432 799999999999999998887766654  456799999987  678999999999999999987543


Q ss_pred             cccccccCCCCCCccccccCcEEEEEEccCCCEEEEEeCCCcEEEEecccceeeeecc-cCCceEEEEEccCCC--eeee
Q psy10867        261 TRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQ-HKGPVLGAFLGLLPP--AIHD  337 (343)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~-~~~~v~~~~~sp~~~--~l~~  337 (343)
                                 +..+.+|...|.+++|+|++++|++|+.||.|++||+.+++++.++. +...+.+++|+|++.  ++++
T Consensus       221 -----------~~~~~~h~~~v~~~~~~p~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~as  289 (304)
T 2ynn_A          221 -----------VATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIAS  289 (304)
T ss_dssp             -----------EEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEETTTCCEEEEECCSSSSEEEEEECTTCGGGCEEE
T ss_pred             -----------ceeeCCCCCCEEEEEECCCCCEEEEEcCCCeEEEEECCCCceeeeccCCCccEEEEEECCCCCceEEEE
Confidence                       55678999999999999999999999999999999999999999998 888999999999986  3555


Q ss_pred             c
Q psy10867        338 Y  338 (343)
Q Consensus       338 ~  338 (343)
                      +
T Consensus       290 g  290 (304)
T 2ynn_A          290 G  290 (304)
T ss_dssp             E
T ss_pred             e
Confidence            4



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-17
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-10
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-05
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-09
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-04
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-07
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-07
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-06
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 9e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-04
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.001
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-06
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.003
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 4e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.002
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 80.2 bits (196), Expect = 1e-17
 Identities = 63/310 (20%), Positives = 114/310 (36%), Gaps = 26/310 (8%)

Query: 7   VAFSYDGS--------GAISVWEPKGGTLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKP 58
           V F    S          I VW+ + G    + KG +  S   +    +  +L       
Sbjct: 23  VIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT-DSVQDISFDHSGKLLASCSADM 81

Query: 59  MIQAWPVNSQEKAQLRLICPGRISSMQASPDAAYIAV-SIETKLHMWQISSGRLLATASS 117
            I+ W     E  +        +SS+   P+  +I   S +  + MW++ +G  + T + 
Sbjct: 82  TIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTG 141

Query: 118 HYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLH 177
           H + + +V+ + D   I +   D T+ VW ++   CK      +             P  
Sbjct: 142 HREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAE----LREHRHVVECISWAPES 197

Query: 178 VKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLI-LDTRLTCVAFDG 236
             S  S      T         + S S D+T K++D+ TG  L++L+  D  +  V F  
Sbjct: 198 SYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHS 257

Query: 237 TEDNIYMGTSEGVIKSFCLRQVPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLS 296
               I     +  ++ +             ++         HE  VTSL    T   +++
Sbjct: 258 GGKFILSCADDKTLRVW-----------DYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVT 306

Query: 297 SSADETLKIW 306
            S D+T+K+W
Sbjct: 307 GSVDQTVKVW 316


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.96
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.95
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.94
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.94
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.93
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.91
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.9
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.88
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.86
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.86
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.84
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.8
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.71
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.68
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.6
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.59
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.59
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.58
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.56
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.53
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.52
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.5
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.5
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.46
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.46
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.46
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.41
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.4
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.39
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.38
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.19
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.18
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.14
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.01
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.9
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.77
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.74
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 98.69
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.65
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.59
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 98.41
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 98.41
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 98.37
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.32
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 98.29
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.2
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.12
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.07
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.03
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.96
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.96
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.85
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.83
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.33
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.26
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.14
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.01
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.97
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.33
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.86
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 95.42
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 95.03
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 94.76
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 93.48
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 92.43
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.24
d1suua_304 DNA gyrase A C-terminal domain {Lyme disease spiro 87.79
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 82.86
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 80.67
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 80.15
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.3e-47  Score=309.77  Aligned_cols=277  Identities=17%  Similarity=0.210  Sum_probs=244.7

Q ss_pred             eEEEEEecCCCCcceEEEEeCCceEEEEEcCCCeEEEEeCCCcccc-----eecccCCcceEEEEECCCCCEEEE-ecCC
Q psy10867         26 TLLMSYKGASVLSPHSMCLLGNDYVLGVEKGKPMIQAWPVNSQEKA-----QLRLICPGRISSMQASPDAAYIAV-SIET   99 (343)
Q Consensus        26 ~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~i~iw~~~~~~~~-----~~~~~~~~~v~~~~~s~~~~~l~~-~~d~   99 (343)
                      +.+.++ .|.. .|.+++|+|++++|++|++ |.|+|||+.+....     .....|.+.|.+++|+|++++|++ +.|+
T Consensus        43 ~~~~~~-~H~~-~V~~v~fs~~g~~latg~d-g~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg  119 (337)
T d1gxra_          43 RQINTL-NHGE-VVCAVTISNPTRHVYTGGK-GCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEAS  119 (337)
T ss_dssp             EEEEEE-CCSS-CCCEEEECSSSSEEEEECB-SEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSS
T ss_pred             eEEEEC-CCCC-cEEEEEECCCCCEEEEEEC-CEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeeccc
Confidence            344555 6777 9999999999999999985 99999999875433     123478889999999999999987 6899


Q ss_pred             eEEEEEccCC--ceEEEecccCCCeEEEEEecCCCEEEEecCCCeEEEeecCccceeeeeecCCCCCCCCccccccceee
Q psy10867        100 KLHMWQISSG--RLLATASSHYQPITIVKWSADSNFIVTGGEDGTICVWQLSRLICKQTVAFGIPGSSGKGVTGLTEPLH  177 (343)
Q Consensus       100 ~i~v~~~~~~--~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (343)
                      .|++||+...  +....+..|...+.+++|+|++.++++++.|+.|++|++.+.+                      ...
T Consensus       120 ~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~----------------------~~~  177 (337)
T d1gxra_         120 TLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQT----------------------LVR  177 (337)
T ss_dssp             EEEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTE----------------------EEE
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccc----------------------ccc
Confidence            9999998754  4566778899999999999999999999999999999998864                      444


Q ss_pred             eecccccceEEEEeecCCCceEEEEeeCCCeEEEEecCCCceEEEeecCCcEEEEEEcCCCCEEEEEcCCCcEEEEEeec
Q psy10867        178 VKSQHSLPVTHVTLSKLGAKSRVASVSHDRTCKIFDLCTGEDLLSLILDTRLTCVAFDGTEDNIYMGTSEGVIKSFCLRQ  257 (343)
Q Consensus       178 ~~~~~~~~v~~~~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~d~~i~i~d~~~  257 (343)
                      ....|...|.+++|++++  ..+++++.|+.+++||+++++.+..+.+...|.+++|+|++++|++++.|+.+++||++.
T Consensus       178 ~~~~~~~~v~~l~~s~~~--~~~~~~~~d~~v~i~d~~~~~~~~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~  255 (337)
T d1gxra_         178 QFQGHTDGASCIDISNDG--TKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNK  255 (337)
T ss_dssp             EECCCSSCEEEEEECTTS--SEEEEEETTSEEEEEETTTTEEEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTS
T ss_pred             cccccccccccccccccc--cccccccccccccccccccceeecccccccceEEEEEcccccccceeccccccccccccc
Confidence            556789999999999998  799999999999999999999999999999999999999999999999999999999986


Q ss_pred             ccccccccccCCCCCCccccccCcEEEEEEccCCCEEEEEeCCCcEEEEecccceeeeecccCCceEEEEEccCCCeeee
Q psy10867        258 VPRTRDHHIQDSTSNPDFIGHEKQVTSLSCSITGITLLSSSADETLKIWHTISRQCLRTIQHKGPVLGAFLGLLPPAIHD  337 (343)
Q Consensus       258 ~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~v~~~~~sp~~~~l~~  337 (343)
                      ...            .....|...|++++|+|++++|++++.||.|++||+.+++.+..+.|.+.|.+++|+|++++|++
T Consensus       256 ~~~------------~~~~~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t  323 (337)
T d1gxra_         256 PDK------------YQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVT  323 (337)
T ss_dssp             SCE------------EEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEE
T ss_pred             ccc------------ccccccccccceEEECCCCCEEEEEeCCCeEEEEECCCCCEEEEccCCCCEEEEEEeCCCCEEEE
Confidence            543            23457889999999999999999999999999999999999999889999999999999999999


Q ss_pred             cccC
Q psy10867        338 YDFT  341 (343)
Q Consensus       338 ~~~~  341 (343)
                      ++..
T Consensus       324 ~s~D  327 (337)
T d1gxra_         324 GSGD  327 (337)
T ss_dssp             EETT
T ss_pred             EeCC
Confidence            8754



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure