Psyllid ID: psy1086

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650----
MLKEARGETVSPNMEALGAEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELVKKLKSSLREHQGEMII
ccccccccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEEcccccccccccccccccccEEEEEEcccccccccccccccEEEcccccccccccccccccccEEEEccccEEEEcccccEEEEccccccEEEEEccccccccccccccccccEEEEEEEEHHHHcccccccccccHHHHHHHHHccccccccccccccccccEEEEEcccccEEEEEccccHHHccccccccHHHHHHHHHccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHcHHHccccEEEEEEccccccHHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccEEEEEEEcHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccEEEEEEEEEEcccccccccccccHHHHHHHHcccccccccccccccccccEEEEEcccccEEEEEccccHHHccccccccHHHHHHHHHccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHcHHHccccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEc
ccHHHccccccHcHHHHHHHEHEHHHHccccccHHcHcccEEEEEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccEEEEcccccEEEEEcccccEEEEEEcccccccccccccccccHHEEEEHHHHHHHHcccccccccHHHHHHHHHHcccccccccccEEcccccEEEEccccEEEEEccccHHHcHHccccHHHHHHHHHHHcEEEEEEEEccccccccccccccHHHHHHHHHHHHHHccHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccccccHHHcccccccccccEEEEHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccHEEEEEccccccccEEEccccccHHEEEEHHHHHHHccccccccccHHHHHHHHHHcccHHccccccEEccccEEEEEccccEEEEEccccHHccccccccHHHHHHHHHHHcEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHcHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccccccHHHcccccccccccEEEEEcccccccHHHHHHHHHHHHHHcccccccccHHHccEEEEEEEEEccccccEEc
mlkeargetvspnMEALGAEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLyvkggsggngqpkygglggrggnvVCKVKAGASLESVKKQFKGVRITAASGDNSLVHRLagrngedkilelpvgitayadggtklgelnteeDSIIIahggaggnaqngwlgrkGEELAVRLELKLIADiglvgfpnagkSTFLKAISRarpkiasypfttikpnvgvitfddfrkmsvadlpgliegahrnlgmgHQFLRHVERTKLIAMIVDVngfqlglkhpkrscVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIhkypeefqpekvikfqsilpisaktnstdvndakLKIRSILDLLAEEEQEMVDRELELDSIIIAhggaggnaqngwlgrkGEELAVRLELKLIADiglvgfpnagkSTFLKAISRarpkiasypfttikpnvgvitfddfrkmsvadlpgliegahrnlgmgHQFLRHVERTKLIAMIVDVngfqlglkhpkrscVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIhkypeefqpekvikfqsilpisaktnstdvndakLKIRSILDLLAEEEQEMVDRELELVKKLKSSLREHQGEMII
mlkeargetvspnmeALGAEVAMLCVKSKQTlseksiftksrfLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRitaasgdnslvhRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIglvgfpnaGKSTFLKAISRarpkiasypfttikpnvGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFqlglkhpkrSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPisaktnstdvndakLKIRSILDLLAEEEQEMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIglvgfpnaGKSTFLKAISRarpkiasypfttikpnvGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFqlglkhpkrSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPisaktnstdvndakLKIRSILDLLAEEEQEMVDRELELVKKLKsslrehqgemii
MLKEARGETVSPNMEALGAEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLYVKGGSGGNGQPKYgglggrggNVVCKVKAGASLESVKKQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSiiiahggaggnaqngWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELDSiiiahggaggnaqngWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDrelelvkklksslreHQGEMII
******************AEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLYVKGGSG****PKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLA******************************
***********PNMEALGAEVAMLC*****************FLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKG***********************KILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDL****************KKL*SSLRE**GEMII
**********SPNMEALGAEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELVKKLKSS**********
********TVSPNMEALGAEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITAASGD*SLVHRL***NGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRELELVKKLKSSLREHQGEMII
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKEARGETVSPNMEALGAEVAMLCVKSKQTLSEKSIFTKSRFLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDxxxxxxxxxxxxxxxxxxxxxMVDRELELDSIIIAHGGAGGNAQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query654 2.2.26 [Sep-21-2011]
Q9I7M2383 GTP-binding protein 10 ho yes N/A 0.518 0.885 0.517 1e-89
Q29K06383 GTP-binding protein 10 ho yes N/A 0.518 0.885 0.514 2e-88
A4D1E9387 GTP-binding protein 10 OS yes N/A 0.524 0.886 0.459 4e-79
Q3MHG6387 GTP-binding protein 10 OS yes N/A 0.524 0.886 0.465 2e-78
Q6DHF7380 GTP-binding protein 10 OS yes N/A 0.529 0.910 0.497 5e-78
Q5U528383 GTP-binding protein 10 OS N/A N/A 0.527 0.900 0.466 5e-76
Q8K013366 GTP-binding protein 10 OS yes N/A 0.504 0.901 0.471 5e-76
Q5M8V6383 GTP-binding protein 10 OS yes N/A 0.519 0.887 0.475 1e-71
B8CXZ0426 GTPase obg OS=Halothermot yes N/A 0.435 0.669 0.383 1e-50
O67849343 GTPase obg OS=Aquifex aeo yes N/A 0.400 0.763 0.409 1e-49
>sp|Q9I7M2|GTPBA_DROME GTP-binding protein 10 homolog OS=Drosophila melanogaster GN=CG10628 PE=2 SV=2 Back     alignment and function desciption
 Score =  331 bits (848), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/340 (51%), Positives = 237/340 (69%), Gaps = 1/340 (0%)

Query: 40  KSRFLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITAAS 99
           +  FLD+L L V+GG GGNG PKYGG+GG+GG V    K G +L  V +  K  R+ A+S
Sbjct: 21  RPTFLDTLRLAVRGGHGGNGLPKYGGVGGQGGCVYLVAKEGLTLRKVVQGLKDKRVAASS 80

Query: 100 GDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQNGW 159
           G++S    + GR G D+ +E+PVG+  Y D    + +L+  E + I+A GG GG     +
Sbjct: 81  GEDSSKASIFGRRGADQRIEVPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTATNF 140

Query: 160 LGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVIT 219
           LGR GE   V L+LKLIAD+GLVGFPNAGKST LKA+S A+PKIA+YPFTTI+P +G I 
Sbjct: 141 LGRPGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIE 200

Query: 220 FDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCV 279
           + D R ++VADLPGLIEGAH N GMGH+FL+H+ERT+L+  +VD+ GFQL  KHP R C+
Sbjct: 201 YRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKHPHRDCL 260

Query: 280 ETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQ 339
             V  LNKELELY  +LLEKP +LL+NKMD EGA EI+  ++  + +L   + + PEE +
Sbjct: 261 ANVYALNKELELYDPSLLEKPSVLLLNKMDKEGAHEIFTKVKPLVSDLASGLEQCPEELR 320

Query: 340 PEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEE 379
           P++V+ F SI+PISA  NS+ +   K ++R  L  LAE++
Sbjct: 321 PKQVLNFDSIVPISA-MNSSKITQVKSQLRRTLVRLAEKQ 359
May be involved in the ribosome maturation process.
Drosophila melanogaster (taxid: 7227)
>sp|Q29K06|GTPBA_DROPS GTP-binding protein 10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA10450 PE=3 SV=1 Back     alignment and function description
>sp|A4D1E9|GTPBA_HUMAN GTP-binding protein 10 OS=Homo sapiens GN=GTPBP10 PE=1 SV=1 Back     alignment and function description
>sp|Q3MHG6|GTPBA_BOVIN GTP-binding protein 10 OS=Bos taurus GN=GTPBP10 PE=2 SV=1 Back     alignment and function description
>sp|Q6DHF7|GTPBA_DANRE GTP-binding protein 10 OS=Danio rerio GN=gtpbp10 PE=2 SV=1 Back     alignment and function description
>sp|Q5U528|GTPBA_XENLA GTP-binding protein 10 OS=Xenopus laevis GN=gtpbp10 PE=2 SV=1 Back     alignment and function description
>sp|Q8K013|GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus GN=Gtpbp10 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8V6|GTPBA_XENTR GTP-binding protein 10 OS=Xenopus tropicalis GN=gtpbp10 PE=2 SV=1 Back     alignment and function description
>sp|B8CXZ0|OBG_HALOH GTPase obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 Back     alignment and function description
>sp|O67849|OBG_AQUAE GTPase obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query654
91083037385 PREDICTED: similar to AGAP008337-PA [Tri 0.524 0.890 0.534 5e-97
332373810384 unknown [Dendroctonus ponderosae] 0.519 0.885 0.535 1e-96
307173627389 GTP-binding protein 10-like protein [Cam 0.524 0.881 0.508 1e-94
357622575386 hypothetical protein KGM_13534 [Danaus p 0.538 0.911 0.528 6e-94
328718050407 PREDICTED: GTP-binding protein 10 homolo 0.509 0.818 0.569 2e-90
195384999383 GJ14682 [Drosophila virilis] gi|19414765 0.533 0.911 0.511 2e-90
332024489388 GTP-binding protein 10-like protein [Acr 0.533 0.899 0.504 7e-90
195433974384 GK15220 [Drosophila willistoni] gi|19416 0.535 0.911 0.5 2e-89
195345191383 GM16989 [Drosophila sechellia] gi|194134 0.535 0.913 0.507 2e-89
195118884384 GI18192 [Drosophila mojavensis] gi|19391 0.535 0.911 0.508 7e-89
>gi|91083037|ref|XP_974807.1| PREDICTED: similar to AGAP008337-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  361 bits (927), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 251/344 (72%)

Query: 38  FTKSRFLDSLSLYVKGGSGGNGQPKYGGLGGRGGNVVCKVKAGASLESVKKQFKGVRITA 97
           + K  F DSL ++V GG+GGNG PK+GG+GG+GG+V+       SL+ V K+ +    TA
Sbjct: 19  YLKQGFRDSLKVFVSGGTGGNGLPKFGGVGGQGGDVIAVGSDNISLQDVFKRNQSKSYTA 78

Query: 98  ASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSIIIAHGGAGGNAQN 157
            +G +S  + + G  GE    E+PVG+T   + G K+GE+N + + +++A GG GGN +N
Sbjct: 79  KAGRHSSHNFILGPPGESLKFEVPVGVTVITELGKKIGEINNKGEELLLAKGGTGGNPKN 138

Query: 158 GWLGRKGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGV 217
           G+LG KG+   V  +LKLIAD+GLVGFPNAGKST LKAIS A+PKIASYPFTT++PNVG+
Sbjct: 139 GYLGTKGQAYPVIFDLKLIADVGLVGFPNAGKSTLLKAISHAKPKIASYPFTTVRPNVGI 198

Query: 218 ITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRS 277
           I + D R++S+ADLPGLIEGA+ N GMGH+FL+HVERTKL+ ++VD+NGFQL  ++P RS
Sbjct: 199 IQYKDLREISMADLPGLIEGAYANKGMGHKFLKHVERTKLLLLVVDINGFQLSPQYPHRS 258

Query: 278 CVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEE 337
           C+ETVLLLNKELELY  +LLEKP +L++NKMD E + + Y  I+D L NL D   + PEE
Sbjct: 259 CLETVLLLNKELELYNKDLLEKPSMLVINKMDTENSHQKYSEIKDLLKNLTDAARQCPEE 318

Query: 338 FQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQE 381
            +PE  +KF  ++ ISAK  S DV   K ++R +LD+LA+ E +
Sbjct: 319 MRPENFLKFSDVVAISAKEKSDDVELVKQRLRRMLDVLAQLEND 362

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332373810|gb|AEE62046.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|307173627|gb|EFN64478.1| GTP-binding protein 10-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357622575|gb|EHJ74002.1| hypothetical protein KGM_13534 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328718050|ref|XP_001950342.2| PREDICTED: GTP-binding protein 10 homolog isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195384999|ref|XP_002051196.1| GJ14682 [Drosophila virilis] gi|194147653|gb|EDW63351.1| GJ14682 [Drosophila virilis] Back     alignment and taxonomy information
>gi|332024489|gb|EGI64687.1| GTP-binding protein 10-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195433974|ref|XP_002064981.1| GK15220 [Drosophila willistoni] gi|194161066|gb|EDW75967.1| GK15220 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195345191|ref|XP_002039156.1| GM16989 [Drosophila sechellia] gi|194134286|gb|EDW55802.1| GM16989 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195118884|ref|XP_002003962.1| GI18192 [Drosophila mojavensis] gi|193914537|gb|EDW13404.1| GI18192 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query654
FB|FBgn0032818383 CG10628 [Drosophila melanogast 0.522 0.892 0.482 3.6e-82
UNIPROTKB|Q29K06383 GA10450 "GTP-binding protein 1 0.545 0.932 0.461 2.2e-80
ZFIN|ZDB-GENE-040718-153380 gtpbp10 "GTP-binding protein 1 0.527 0.907 0.463 5.1e-74
UNIPROTKB|E1BTU3372 GTPBP10 "Uncharacterized prote 0.516 0.908 0.448 2e-72
UNIPROTKB|A4D1E9387 GTPBP10 "GTP-binding protein 1 0.533 0.901 0.421 1.8e-71
UNIPROTKB|E2RH21383 GTPBP10 "Uncharacterized prote 0.532 0.908 0.425 2.3e-71
UNIPROTKB|F1S322388 GTPBP10 "Uncharacterized prote 0.525 0.886 0.435 2.9e-71
UNIPROTKB|Q3MHG6387 GTPBP10 "GTP-binding protein 1 0.525 0.888 0.436 4.8e-71
RGD|1305878369 Gtpbp10 "GTP-binding protein 1 0.516 0.915 0.430 2.4e-69
MGI|MGI:2385599366 Gtpbp10 "GTP-binding protein 1 0.504 0.901 0.435 2.7e-68
FB|FBgn0032818 CG10628 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 824 (295.1 bits), Expect = 3.6e-82, P = 3.6e-82
 Identities = 166/344 (48%), Positives = 224/344 (65%)

Query:    43 FLDSLSLYVKGGSGGNGQPKYXXXXXXXXNVVCKVKAGASLESVKKQFKGVRITAASGDN 102
             FLD+L L V+GG GGNG PKY         V    K G +L  V +  K  R+ A+SG++
Sbjct:    24 FLDTLRLAVRGGHGGNGLPKYGGVGGQGGCVYLVAKEGLTLRKVVQGLKDKRVAASSGED 83

Query:   103 SLVHRLAGRNGEDKILELPVGITAYADGGTKLGELNTEEDSXXXXXXXXXXXXXXXWLGR 162
             S    + GR G D+ +E+PVG+  Y D    + +L+  E +               +LGR
Sbjct:    84 SSKASIFGRRGADQRIEVPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTATNFLGR 143

Query:   163 KGEELAVRLELKLIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDD 222
              GE   V L+LKLIAD+GLVGFPNAGKST LKA+S A+PKIA+YPFTTI+P +G I + D
Sbjct:   144 PGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIEYRD 203

Query:   223 FRKMSVADLPGLIEGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETV 282
              R ++VADLPGLIEGAH N GMGH+FL+H+ERT+L+  +VD+ GFQL  KHP R C+  V
Sbjct:   204 LRSITVADLPGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKHPHRDCLANV 263

Query:   283 LLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEK 342
               LNKELELY  +LLEKP +LL+NKMD EGA EI+  ++  + +L   + + PEE +P++
Sbjct:   264 YALNKELELYDPSLLEKPSVLLLNKMDKEGAHEIFTKVKPLVSDLASGLEQCPEELRPKQ 323

Query:   343 VIKFQSILPISAKTNSTDVNDAKLKIRSILDLLAEEEQEMVDRE 386
             V+ F SI+PISA  NS+ +   K ++R  L  LAE+ Q + D +
Sbjct:   324 VLNFDSIVPISAM-NSSKITQVKSQLRRTLVRLAEK-QFLADED 365
GO:0005525 "GTP binding" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
UNIPROTKB|Q29K06 GA10450 "GTP-binding protein 10 homolog" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-153 gtpbp10 "GTP-binding protein 10 (putative)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTU3 GTPBP10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4D1E9 GTPBP10 "GTP-binding protein 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RH21 GTPBP10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S322 GTPBP10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHG6 GTPBP10 "GTP-binding protein 10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1305878 Gtpbp10 "GTP-binding protein 10 (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2385599 Gtpbp10 "GTP-binding protein 10 (putative)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9I7M2GTPBA_DROMENo assigned EC number0.51760.51830.8851yesN/A
Q29K06GTPBA_DROPSNo assigned EC number0.51470.51830.8851yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 8e-94
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 1e-89
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 1e-88
COG0536369 COG0536, Obg, Predicted GTPase [General function p 3e-88
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 7e-73
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 2e-71
cd01898170 cd01898, Obg, Obg GTPase 6e-69
cd01898170 cd01898, Obg, Obg GTPase 6e-69
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 3e-68
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 4e-68
COG0536369 COG0536, Obg, Predicted GTPase [General function p 4e-66
PRK12296500 PRK12296, obgE, GTPase CgtA; Reviewed 2e-65
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 1e-52
PRK12296 500 PRK12296, obgE, GTPase CgtA; Reviewed 1e-49
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 2e-40
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 2e-40
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 1e-22
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 1e-22
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 1e-20
COG0012 372 COG0012, COG0012, Predicted GTPase, probable trans 1e-20
cd01899318 cd01899, Ygr210, Ygr210 GTPase 1e-20
cd01899318 cd01899, Ygr210, Ygr210 GTPase 1e-20
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; 1e-19
PRK09602 396 PRK09602, PRK09602, translation-associated GTPase; 1e-19
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 5e-18
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 5e-18
COG1163365 COG1163, DRG, Predicted GTPase [General function p 3e-17
COG1163365 COG1163, DRG, Predicted GTPase [General function p 3e-17
pfam01018156 pfam01018, GTP1_OBG, GTP1/OBG 6e-16
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 1e-15
PRK09601 364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 1e-15
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 1e-15
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 1e-15
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 5e-15
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 5e-15
cd00880161 cd00880, Era_like, E 6e-15
cd00880161 cd00880, Era_like, E 6e-15
cd01900274 cd01900, YchF, YchF GTPase 1e-14
cd01900274 cd01900, YchF, YchF GTPase 1e-14
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 2e-13
PTZ00258 390 PTZ00258, PTZ00258, GTP-binding protein; Provision 2e-13
cd04163168 cd04163, Era, E 6e-10
cd04163168 cd04163, Era, E 6e-10
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-09
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-09
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 7e-08
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-06
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-06
COG1159298 COG1159, Era, GTPase [General function prediction 5e-06
COG1159298 COG1159, Era, GTPase [General function prediction 5e-06
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 7e-06
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 7e-06
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 1e-05
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 1e-05
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 1e-05
TIGR00092368 TIGR00092, TIGR00092, GTP-binding protein YchF 2e-05
TIGR00092 368 TIGR00092, TIGR00092, GTP-binding protein YchF 2e-05
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-05
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-05
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 3e-05
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 3e-05
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 4e-05
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 4e-05
PRK00089292 PRK00089, era, GTPase Era; Reviewed 5e-05
PRK00089292 PRK00089, era, GTPase Era; Reviewed 5e-05
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-04
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 3e-04
COG2262411 COG2262, HflX, GTPases [General function predictio 4e-04
COG2262411 COG2262, HflX, GTPases [General function predictio 4e-04
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 5e-04
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 5e-04
cd01878204 cd01878, HflX, HflX GTPase family 7e-04
cd01878204 cd01878, HflX, HflX GTPase family 7e-04
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.002
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.002
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 0.002
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 0.002
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 0.003
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information 
 Score =  295 bits (759), Expect = 8e-94
 Identities = 143/383 (37%), Positives = 207/383 (54%), Gaps = 70/383 (18%)

Query: 43  FLDSLSLYVKGGSGGNG-----QPKY-------GGLGGRGGNVVCKVKAG-ASLESV--K 87
           F+D   +YVK G GG+G     + KY       GG GG+GG+V+     G  +L     K
Sbjct: 2   FIDQAKIYVKAGDGGDGMVSFRREKYVPKGGPDGGDGGKGGSVIFVADEGLRTLLDFRYK 61

Query: 88  KQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAY-ADGGTKLGELNTEEDSIII 146
           + FK     A +G+N +   + GRNGED I+++PVG     A+ G  + +L      +++
Sbjct: 62  RHFK-----AENGENGMGKNMHGRNGEDLIIKVPVGTVVKDAETGEVIADLVEPGQEVVV 116

Query: 147 AHGGAGG--N-------------AQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGKST 191
           A GG GG  N             A+NG     GEE  +RLELKL+AD+GLVGFPN GKST
Sbjct: 117 AKGGRGGRGNAHFATSTNQAPRIAENG---EPGEERELRLELKLLADVGLVGFPNVGKST 173

Query: 192 FLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRH 251
            L  +S A+PKIA+Y FTT+ PN+GV+  DD R   +AD+PGLIEGA   +G+GHQFLRH
Sbjct: 174 LLSVVSNAKPKIANYHFTTLVPNLGVVETDDGRSFVMADIPGLIEGASEGVGLGHQFLRH 233

Query: 252 VERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVE 311
           +ERT++I  ++D++G +       R  +E    +NKEL+LY   LLE+P I++ NKMD+ 
Sbjct: 234 IERTRVIVHVIDMSGSEG------RDPIEDYEKINKELKLYNPRLLERPQIVVANKMDLP 287

Query: 312 GAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSI 371
            A+E          NL++   K   +           + PISA T        +L    +
Sbjct: 288 EAEE----------NLEEFKEKLGPK-----------VFPISALTGQ---GLDELLYA-V 322

Query: 372 LDLLAEEEQEMVDRELELDSIII 394
            +LL E  +  ++ E   + +  
Sbjct: 323 AELLEETPEFPLEEEEVEEEVYY 345

Length = 424
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237045 PRK12296, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237045 PRK12296, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206686 cd01899, Ygr210, Ygr210 GTPase Back     alignment and domain information
>gnl|CDD|206686 cd01899, Ygr210, Ygr210 GTPase Back     alignment and domain information
>gnl|CDD|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|110047 pfam01018, GTP1_OBG, GTP1/OBG Back     alignment and domain information
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF Back     alignment and domain information
>gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 654
COG0536369 Obg Predicted GTPase [General function prediction 100.0
PRK12299335 obgE GTPase CgtA; Reviewed 100.0
PRK12297424 obgE GTPase CgtA; Reviewed 100.0
PRK12296500 obgE GTPase CgtA; Reviewed 100.0
KOG1489|consensus366 100.0
PRK12298390 obgE GTPase CgtA; Reviewed 100.0
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 100.0
COG1160444 Predicted GTPases [General function prediction onl 100.0
PRK03003472 GTP-binding protein Der; Reviewed 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 100.0
PF01018156 GTP1_OBG: GTP1/OBG; InterPro: IPR006169 Several pr 100.0
PRK00093435 GTP-binding protein Der; Reviewed 100.0
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 100.0
KOG0084|consensus205 99.94
KOG0092|consensus200 99.94
KOG0078|consensus207 99.93
PRK12299335 obgE GTPase CgtA; Reviewed 99.93
KOG0094|consensus221 99.93
KOG0098|consensus216 99.92
KOG0394|consensus210 99.91
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.91
PRK12298390 obgE GTPase CgtA; Reviewed 99.9
PRK12297424 obgE GTPase CgtA; Reviewed 99.9
PRK12296 500 obgE GTPase CgtA; Reviewed 99.9
KOG0087|consensus222 99.9
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.9
KOG0080|consensus209 99.89
KOG1489|consensus366 99.89
COG0536369 Obg Predicted GTPase [General function prediction 99.89
KOG0086|consensus214 99.89
KOG0091|consensus213 99.89
KOG0093|consensus193 99.89
KOG0095|consensus213 99.89
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.88
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.88
KOG0079|consensus198 99.88
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.87
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.87
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.87
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.87
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.87
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.86
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.86
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.86
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.86
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.86
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.86
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.86
KOG0088|consensus218 99.86
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.85
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.85
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.85
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.85
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.85
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.85
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.85
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.85
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.85
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.85
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.85
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.85
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.84
PTZ00369189 Ras-like protein; Provisional 99.84
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.84
PLN03110216 Rab GTPase; Provisional 99.84
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.84
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.84
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.84
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.84
KOG0083|consensus192 99.84
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.84
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.84
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.84
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.84
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.84
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.84
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.84
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.84
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.84
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.83
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.83
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.83
COG1163365 DRG Predicted GTPase [General function prediction 99.83
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.83
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.83
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.83
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.83
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.83
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.83
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.83
KOG0097|consensus215 99.83
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.83
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.83
PLN03108210 Rab family protein; Provisional 99.83
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.82
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.82
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.82
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.82
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.82
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.82
KOG0081|consensus219 99.82
COG1159298 Era GTPase [General function prediction only] 99.82
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.82
COG0488530 Uup ATPase components of ABC transporters with dup 99.82
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.81
PLN03118211 Rab family protein; Provisional 99.81
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.81
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.81
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.81
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.81
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.81
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.81
PRK15494339 era GTPase Era; Provisional 99.81
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.8
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.8
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.8
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.8
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.8
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.8
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.8
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.8
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.8
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.8
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.8
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.8
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.79
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.79
PRK11058426 GTPase HflX; Provisional 99.79
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.79
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.79
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.78
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.78
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.78
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.78
KOG0395|consensus196 99.78
COG0486454 ThdF Predicted GTPase [General function prediction 99.78
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.78
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.78
PTZ00133182 ADP-ribosylation factor; Provisional 99.78
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.78
PLN00223181 ADP-ribosylation factor; Provisional 99.78
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.77
COG1160 444 Predicted GTPases [General function prediction onl 99.77
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.77
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.77
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.77
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.77
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.76
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.76
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.76
COG2262411 HflX GTPases [General function prediction only] 99.76
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.76
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.76
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.76
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.76
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.76
COG0012372 Predicted GTPase, probable translation factor [Tra 99.75
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.75
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.75
COG1159298 Era GTPase [General function prediction only] 99.75
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.74
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.74
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.74
cd01896233 DRG The developmentally regulated GTP-binding prot 99.74
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.74
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.74
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.74
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.74
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.73
KOG4252|consensus246 99.73
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.73
PRK03003 472 GTP-binding protein Der; Reviewed 99.73
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.73
PTZ00258390 GTP-binding protein; Provisional 99.72
PRK00089292 era GTPase Era; Reviewed 99.72
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.72
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.71
PRK09602396 translation-associated GTPase; Reviewed 99.71
PRK09601364 GTP-binding protein YchF; Reviewed 99.71
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.71
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.7
COG1163365 DRG Predicted GTPase [General function prediction 99.7
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.7
KOG1191|consensus531 99.7
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.7
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.69
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.68
KOG1423|consensus379 99.68
cd00881189 GTP_translation_factor GTP translation factor fami 99.68
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.68
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.68
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.68
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.68
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.68
PRK00093 435 GTP-binding protein Der; Reviewed 99.67
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.67
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.67
cd01896233 DRG The developmentally regulated GTP-binding prot 99.67
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.67
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.67
PRK05306 787 infB translation initiation factor IF-2; Validated 99.66
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.66
CHL00189 742 infB translation initiation factor 2; Provisional 99.66
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.66
PRK04213201 GTP-binding protein; Provisional 99.65
PLN00023334 GTP-binding protein; Provisional 99.65
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.65
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.65
COG1084346 Predicted GTPase [General function prediction only 99.65
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.65
KOG1486|consensus364 99.64
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.64
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.64
PTZ00099176 rab6; Provisional 99.63
PRK11147 635 ABC transporter ATPase component; Reviewed 99.63
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.63
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.63
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.63
COG2262411 HflX GTPases [General function prediction only] 99.63
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.63
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.62
COG1084346 Predicted GTPase [General function prediction only 99.62
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.62
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.62
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.62
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.61
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.61
PRK15494339 era GTPase Era; Provisional 99.61
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.61
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.61
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.61
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.6
KOG0073|consensus185 99.6
PRK11058426 GTPase HflX; Provisional 99.59
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.59
PTZ00258 390 GTP-binding protein; Provisional 99.59
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.59
KOG1491|consensus391 99.58
COG1100219 GTPase SAR1 and related small G proteins [General 99.58
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.58
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.58
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.57
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.57
PRK09602 396 translation-associated GTPase; Reviewed 99.57
COG0486454 ThdF Predicted GTPase [General function prediction 99.57
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.57
KOG0927|consensus614 99.56
PRK12317 425 elongation factor 1-alpha; Reviewed 99.55
PRK04004 586 translation initiation factor IF-2; Validated 99.55
PRK05433 600 GTP-binding protein LepA; Provisional 99.55
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.55
KOG1532|consensus366 99.55
KOG0393|consensus198 99.55
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.55
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 99.54
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.54
PRK10938490 putative molybdenum transport ATP-binding protein 99.54
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.54
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.53
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.52
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.52
PRK00089292 era GTPase Era; Reviewed 99.52
COG0012 372 Predicted GTPase, probable translation factor [Tra 99.52
PRK09866 741 hypothetical protein; Provisional 99.51
COG0218200 Predicted GTPase [General function prediction only 99.51
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.51
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.51
KOG0070|consensus181 99.51
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.51
KOG1423|consensus379 99.5
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.5
PLN03073718 ABC transporter F family; Provisional 99.5
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.5
PRK12736 394 elongation factor Tu; Reviewed 99.5
PRK13409590 putative ATPase RIL; Provisional 99.49
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.49
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.49
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.49
KOG0075|consensus186 99.48
PRK10218 607 GTP-binding protein; Provisional 99.48
PRK09601 364 GTP-binding protein YchF; Reviewed 99.48
KOG3883|consensus198 99.48
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.48
CHL00071 409 tufA elongation factor Tu 99.47
cd04105203 SR_beta Signal recognition particle receptor, beta 99.47
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.47
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.47
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.47
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.47
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.47
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.46
KOG4423|consensus229 99.46
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.46
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.46
KOG1487|consensus358 99.46
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.45
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.45
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.45
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.44
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.44
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.44
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.44
PRK12735 396 elongation factor Tu; Reviewed 99.44
KOG0076|consensus197 99.44
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.43
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.43
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.43
KOG0462|consensus 650 99.43
PLN03127 447 Elongation factor Tu; Provisional 99.42
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.42
COG1123539 ATPase components of various ABC-type transport sy 99.42
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.42
COG0218200 Predicted GTPase [General function prediction only 99.41
KOG0071|consensus180 99.41
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.41
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.41
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.41
PLN03126 478 Elongation factor Tu; Provisional 99.4
KOG1145|consensus 683 99.4
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.4
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.4
PRK00007 693 elongation factor G; Reviewed 99.39
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.39
COG3596296 Predicted GTPase [General function prediction only 99.39
PRK12739 691 elongation factor G; Reviewed 99.38
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.38
PRK00049 396 elongation factor Tu; Reviewed 99.37
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.37
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.37
KOG0066|consensus807 99.37
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.37
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.37
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.36
KOG1490|consensus 620 99.36
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.36
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.36
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.36
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.36
PRK09563287 rbgA GTPase YlqF; Reviewed 99.36
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.35
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.35
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.35
PTZ00141 446 elongation factor 1- alpha; Provisional 99.35
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.34
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.34
PLN00043 447 elongation factor 1-alpha; Provisional 99.34
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.34
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.34
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.34
PRK04213201 GTP-binding protein; Provisional 99.34
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.34
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.34
cd00881189 GTP_translation_factor GTP translation factor fami 99.34
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.34
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.33
KOG0062|consensus582 99.33
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.33
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.33
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.33
KOG1490|consensus620 99.33
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.33
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.33
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.33
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.33
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.33
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.33
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.32
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.32
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.32
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.32
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.32
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.32
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.32
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.32
PRK13351 687 elongation factor G; Reviewed 99.32
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.32
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.31
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.31
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.31
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.31
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.31
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.31
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.31
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.31
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.3
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.3
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.3
PRK14845 1049 translation initiation factor IF-2; Provisional 99.3
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.3
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.3
COG2229187 Predicted GTPase [General function prediction only 99.29
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.29
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.29
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.29
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.29
KOG0410|consensus410 99.29
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.28
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.28
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.28
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.27
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.27
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.27
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.27
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.27
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.27
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.27
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.27
KOG1491|consensus 391 99.26
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.26
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.26
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.26
PLN00223181 ADP-ribosylation factor; Provisional 99.25
PTZ00133182 ADP-ribosylation factor; Provisional 99.25
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.25
KOG1191|consensus531 99.25
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.25
KOG0096|consensus216 99.25
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.24
KOG0074|consensus185 99.24
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.24
PLN03110216 Rab GTPase; Provisional 99.24
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.24
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.23
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.23
KOG1486|consensus364 99.23
KOG1144|consensus 1064 99.22
COG4586325 ABC-type uncharacterized transport system, ATPase 99.22
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.22
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.22
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.22
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.22
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.22
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.22
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.22
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.22
KOG0072|consensus182 99.22
PTZ00369189 Ras-like protein; Provisional 99.21
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.21
PLN03108210 Rab family protein; Provisional 99.21
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.21
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.21
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.21
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.2
PLN03118211 Rab family protein; Provisional 99.2
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.2
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.2
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.2
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.2
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.19
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.19
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.18
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.18
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.17
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.17
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.17
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.17
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.17
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.17
PRK13796365 GTPase YqeH; Provisional 99.17
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.16
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.16
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.16
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.16
PRK12740 668 elongation factor G; Reviewed 99.16
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.15
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.15
KOG0073|consensus185 99.15
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.15
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.14
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.14
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.14
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.13
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.13
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.13
KOG0090|consensus238 99.12
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.12
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.12
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.12
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.12
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.11
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.11
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.11
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.1
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.09
KOG0077|consensus193 99.09
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.09
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.09
PRK13537306 nodulation ABC transporter NodI; Provisional 99.09
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.08
COG4152300 ABC-type uncharacterized transport system, ATPase 99.08
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.08
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.08
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.07
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.07
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.07
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.07
PRK09435332 membrane ATPase/protein kinase; Provisional 99.07
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.07
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.07
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.06
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-79  Score=603.43  Aligned_cols=310  Identities=38%  Similarity=0.661  Sum_probs=286.6

Q ss_pred             CceeeeEEEEEEeCCCCCCCCC------------CCCCCCCCCcEEEEecCCC-ChhhhhhhcCCceEEcCCCCCCCcCC
Q psy1086          41 SRFLDSLSLYVKGGSGGNGQPK------------YGGLGGRGGNVVCKVKAGA-SLESVKKQFKGVRITAASGDNSLVHR  107 (654)
Q Consensus        41 ~~f~d~~~~~~~~g~gg~g~~~------------~gg~gg~gg~v~~~~~~~~-~~~~~~~~~~~~~~~a~~g~~g~~~~  107 (654)
                      |+|||+++|+|+||+|||||+|            +|||||+||||||+|++++ ||.+|++   +++|+|+||++|++++
T Consensus         1 m~FvD~~~I~v~aG~GGnG~VSFrREK~vp~GGPdGGdGG~GGsV~~~ad~~l~TL~d~r~---~~~f~A~~G~~G~~~~   77 (369)
T COG0536           1 MKFVDEVKIEVKAGDGGNGCVSFRREKFVPKGGPDGGDGGRGGSVIFEADENLNTLIDFRY---KKHFKAENGENGMGRN   77 (369)
T ss_pred             CCcceEEEEEEEecCCCCeeEEEEhhhcCccCCCCCCCCCCCceEEEEEcCCcccHhhhcc---ceEEEccCCCCCCCCC
Confidence            6899999999999999999964            7999999999999999999 9999985   8999999999999999


Q ss_pred             cCCCCCCCEEEEcCCCcEEEec-CcceeccccccCcEEEEeccCcCCCCCCCC------------cccccceeeEEEEEe
Q psy1086         108 LAGRNGEDKILELPVGITAYAD-GGTKLGELNTEEDSIIIAHGGAGGNAQNGW------------LGRKGEELAVRLELK  174 (654)
Q Consensus       108 ~~g~~g~~~~~~vp~gt~v~~~-~~~~~~~l~~~~~~~~~a~Gg~gg~gn~~f------------~g~~Ge~~~i~L~lk  174 (654)
                      ++|++|+|++|+||+||+|+|. ++++|+||++++|++++|+||+||+||++|            .|+|||+++|.||||
T Consensus        78 ~~G~~G~Dl~i~VP~GT~v~d~~t~e~i~Dl~~~gq~~~~akGG~GG~GN~~Fks~~nrAP~~a~~G~~Ge~r~v~LELK  157 (369)
T COG0536          78 RTGAKGKDLVIKVPVGTVVRDEDTGELLADLTEHGQRFLVAKGGRGGLGNAHFKSSVNRAPRFATPGEPGEERDLRLELK  157 (369)
T ss_pred             CCCCCCCceEEEcCCCCEEEeCCCCeEehhhccCCcEEEEEcCCCCCccchhhcCcccCCcccCCCCCCCceEEEEEEEe
Confidence            9999999999999999999997 599999999999999999999999999999            599999999999999


Q ss_pred             ecCcEEEEcCCCCcHHHHHHHHHccCCCCCCCCccccccceEEEEeCCCccEEEEecCcccccccccccchHHHHHHHHH
Q psy1086         175 LIADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVER  254 (654)
Q Consensus       175 ~~~~VgLVG~~gaGKSTLl~~Lsg~~~~i~~~~~tTl~p~~G~v~~~~~~~~~i~D~PGl~~~~~~~~~l~~~~l~~i~~  254 (654)
                      .+|+|||||+||||||||++++|.++|+|++|||||+.|++|+|...+..+|+++|+||+|++|+++.+++.+|++|++|
T Consensus       158 llADVGLVG~PNaGKSTlls~vS~AkPKIadYpFTTL~PnLGvV~~~~~~sfv~ADIPGLIEGAs~G~GLG~~FLrHIER  237 (369)
T COG0536         158 LLADVGLVGLPNAGKSTLLSAVSAAKPKIADYPFTTLVPNLGVVRVDGGESFVVADIPGLIEGASEGVGLGLRFLRHIER  237 (369)
T ss_pred             eecccccccCCCCcHHHHHHHHhhcCCcccCCccccccCcccEEEecCCCcEEEecCcccccccccCCCccHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999987777899999999999999999999999999999


Q ss_pred             HHHHHHhhcccCcccCCCCCccChHHHHHHHHHHHHHHhHhhcCcceeEeecccCccchHhHHHHHHHHHhccccccccC
Q psy1086         255 TKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKY  334 (654)
Q Consensus       255 ~~~il~vvd~~~~~l~~~~~~~~~~~~l~~~~~el~~~~~~l~~~P~ilvlNK~D~~~~~~~~~~l~~~~~~l~~~i~~~  334 (654)
                      |.+++||+|++..      +.++|.+++..++.||..|...|..+|.++|+||+|+...++.++.+.+.+.....     
T Consensus       238 t~vL~hviD~s~~------~~~dp~~~~~~i~~EL~~Y~~~L~~K~~ivv~NKiD~~~~~e~~~~~~~~l~~~~~-----  306 (369)
T COG0536         238 TRVLLHVIDLSPI------DGRDPIEDYQTIRNELEKYSPKLAEKPRIVVLNKIDLPLDEEELEELKKALAEALG-----  306 (369)
T ss_pred             hheeEEEEecCcc------cCCCHHHHHHHHHHHHHHhhHHhccCceEEEEeccCCCcCHHHHHHHHHHHHHhcC-----
Confidence            9999999999853      44789999999999999999999999999999999987777777777776654211     


Q ss_pred             CCccchhhhcccceEEEeecccCccchHHHHHHHHHHHHHhH
Q psy1086         335 PEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDLLA  376 (654)
Q Consensus       335 ~~~~~~~~~~~~~~v~~iSA~~~~~~i~~L~~~i~~~l~~~~  376 (654)
                                 +...+++||.++ +++++|+..+.+++....
T Consensus       307 -----------~~~~~~ISa~t~-~g~~~L~~~~~~~l~~~~  336 (369)
T COG0536         307 -----------WEVFYLISALTR-EGLDELLRALAELLEETK  336 (369)
T ss_pred             -----------CCcceeeehhcc-cCHHHHHHHHHHHHHHhh
Confidence                       112223999999 999999999999887764

>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF01018 GTP1_OBG: GTP1/OBG; InterPro: IPR006169 Several proteins have recently been shown to contain the 5 structural motifs characteristic of GTP-binding proteins [] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
1lnz_A342 Structure Of The Obg Gtp-Binding Protein Length = 3 1e-43
1lnz_A342 Structure Of The Obg Gtp-Binding Protein Length = 3 5e-39
1udx_A416 Crystal Structure Of The Conserved Protein Tt1381 F 1e-35
1udx_A416 Crystal Structure Of The Conserved Protein Tt1381 F 2e-32
2dwq_A368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 5e-14
2dwq_A 368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 5e-14
2dby_A368 Crystal Structure Of The Gtp-Binding Protein Ychf I 5e-14
2dby_A 368 Crystal Structure Of The Gtp-Binding Protein Ychf I 5e-14
1jal_A363 Ychf Protein (Hi0393) Length = 363 9e-13
1jal_A 363 Ychf Protein (Hi0393) Length = 363 9e-13
1wxq_A397 Crystal Structure Of Gtp Binding Protein From Pyroc 8e-12
1wxq_A 397 Crystal Structure Of Gtp Binding Protein From Pyroc 8e-12
4a9a_A376 Structure Of Rbg1 In Complex With Tma46 Dfrp Domain 3e-11
4a9a_A376 Structure Of Rbg1 In Complex With Tma46 Dfrp Domain 3e-11
2ohf_A396 Crystal Structure Of Human Ola1 In Complex With Amp 4e-10
2ohf_A 396 Crystal Structure Of Human Ola1 In Complex With Amp 4e-10
2e87_A357 Crystal Structure Of Hypothetical Gtp-Binding Prote 3e-09
2e87_A357 Crystal Structure Of Hypothetical Gtp-Binding Prote 3e-09
1ni3_A392 Structure Of The Schizosaccharomyces Pombe Ychf Gtp 6e-09
1ni3_A 392 Structure Of The Schizosaccharomyces Pombe Ychf Gtp 6e-09
2qu8_A228 Crystal Structure Of Putative Nucleolar Gtp-Binding 1e-06
2qu8_A228 Crystal Structure Of Putative Nucleolar Gtp-Binding 1e-06
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 7e-05
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 7e-05
3a1t_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 7e-04
3a1t_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 7e-04
3a1w_A168 Crystal Structue Of The G Domain Of T. Maritima Feo 8e-04
3a1w_A168 Crystal Structue Of The G Domain Of T. Maritima Feo 8e-04
>pdb|1LNZ|A Chain A, Structure Of The Obg Gtp-Binding Protein Length = 342 Back     alignment and structure 
Iteration: 1

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 169/343 (49%), Gaps = 60/343 (17%)
Query: 43  FLDSLSLYVKGGSGGNG-----QPKYXXXXXXXXN-------VVCKVKAG-ASLESV--K 87
           F+D + +YVKGG GGNG     + KY                VV +V  G  +L     K
Sbjct: 2   FVDQVKVYVKGGDGGNGXVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLXDFRYK 61
Query: 88  KQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAYADGGTK--LGELNTEEDSXX 145
           K FK +R     G++       GRN +D ++++P G T   D  TK  + +L        
Sbjct: 62  KHFKAIR-----GEHGXSKNQHGRNADDXVIKVPPG-TVVTDDDTKQVIADLTEHGQRAV 115
Query: 146 XXXXXXXXXXXXXWL------------GRKGEELAVRLELKLIADIGLVGFPNAGKSTFL 193
                        +             G  G+E  + LELK++AD+GLVGFP+ GKST L
Sbjct: 116 IARGGRGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKSTLL 175
Query: 194 KAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVE 253
             +S A+PKIA Y FTT+ PN+G +  DD R    ADLPGLIEGAH+ +G+GHQFLRH+E
Sbjct: 176 SVVSSAKPKIADYHFTTLVPNLGXVETDDGRSFVXADLPGLIEGAHQGVGLGHQFLRHIE 235
Query: 254 RTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGA 313
           RT++I  ++D +G +       R   +  L +N+EL  Y + L E+P I++ NK D   A
Sbjct: 236 RTRVIVHVIDXSGLE------GRDPYDDYLTINQELSEYNLRLTERPQIIVANKXDXPEA 289
Query: 314 QEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKT 356
            E  +  ++ L +       YP             + PISA T
Sbjct: 290 AENLEAFKEKLTD------DYP-------------VFPISAVT 313
>pdb|1LNZ|A Chain A, Structure Of The Obg Gtp-Binding Protein Length = 342 Back     alignment and structure
>pdb|1UDX|A Chain A, Crystal Structure Of The Conserved Protein Tt1381 From Thermus Thermophilus Hb8 Length = 416 Back     alignment and structure
>pdb|1UDX|A Chain A, Crystal Structure Of The Conserved Protein Tt1381 From Thermus Thermophilus Hb8 Length = 416 Back     alignment and structure
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure
>pdb|1JAL|A Chain A, Ychf Protein (Hi0393) Length = 363 Back     alignment and structure
>pdb|1JAL|A Chain A, Ychf Protein (Hi0393) Length = 363 Back     alignment and structure
>pdb|1WXQ|A Chain A, Crystal Structure Of Gtp Binding Protein From Pyrococcus Horikoshii Ot3 Length = 397 Back     alignment and structure
>pdb|1WXQ|A Chain A, Crystal Structure Of Gtp Binding Protein From Pyrococcus Horikoshii Ot3 Length = 397 Back     alignment and structure
>pdb|4A9A|A Chain A, Structure Of Rbg1 In Complex With Tma46 Dfrp Domain Length = 376 Back     alignment and structure
>pdb|4A9A|A Chain A, Structure Of Rbg1 In Complex With Tma46 Dfrp Domain Length = 376 Back     alignment and structure
>pdb|2OHF|A Chain A, Crystal Structure Of Human Ola1 In Complex With Amppcp Length = 396 Back     alignment and structure
>pdb|2OHF|A Chain A, Crystal Structure Of Human Ola1 In Complex With Amppcp Length = 396 Back     alignment and structure
>pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 Back     alignment and structure
>pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 Back     alignment and structure
>pdb|1NI3|A Chain A, Structure Of The Schizosaccharomyces Pombe Ychf Gtpase Length = 392 Back     alignment and structure
>pdb|1NI3|A Chain A, Structure Of The Schizosaccharomyces Pombe Ychf Gtpase Length = 392 Back     alignment and structure
>pdb|2QU8|A Chain A, Crystal Structure Of Putative Nucleolar Gtp-Binding Protein 1 Pff0625w From Plasmodium Falciparum Length = 228 Back     alignment and structure
>pdb|2QU8|A Chain A, Crystal Structure Of Putative Nucleolar Gtp-Binding Protein 1 Pff0625w From Plasmodium Falciparum Length = 228 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 Back     alignment and structure
>pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 Back     alignment and structure
>pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 Back     alignment and structure
>pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 9e-88
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 2e-71
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 3e-86
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 8e-69
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 5e-40
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 7e-40
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 4e-36
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 4e-36
1wxq_A397 GTP-binding protein; structural genomics, riken st 7e-21
1wxq_A 397 GTP-binding protein; structural genomics, riken st 5e-20
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 6e-14
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 6e-14
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 1e-13
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 1e-13
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 3e-13
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 3e-13
1jal_A363 YCHF protein; nucleotide-binding fold, structural 9e-13
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 9e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 4e-09
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 4e-09
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 7e-09
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 7e-09
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-08
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-08
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 2e-08
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 2e-08
2fh5_B214 SR-beta, signal recognition particle receptor beta 2e-07
2fh5_B214 SR-beta, signal recognition particle receptor beta 2e-07
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 4e-07
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 4e-07
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-06
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-06
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 2e-06
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 2e-06
3t1o_A198 Gliding protein MGLA; G domain containing protein, 9e-06
3t1o_A198 Gliding protein MGLA; G domain containing protein, 9e-06
2wji_A165 Ferrous iron transport protein B homolog; membrane 2e-05
2wji_A165 Ferrous iron transport protein B homolog; membrane 2e-05
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 4e-05
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 4e-05
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 4e-05
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 4e-05
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 5e-05
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 5e-05
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 6e-05
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 6e-05
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 6e-05
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 6e-05
2ged_A193 SR-beta, signal recognition particle receptor beta 8e-05
2ged_A193 SR-beta, signal recognition particle receptor beta 8e-05
3iby_A256 Ferrous iron transport protein B; G protein, G dom 1e-04
3iby_A256 Ferrous iron transport protein B; G protein, G dom 2e-04
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-04
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-04
1nrj_B218 SR-beta, signal recognition particle receptor beta 3e-04
1nrj_B218 SR-beta, signal recognition particle receptor beta 3e-04
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 5e-04
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 5e-04
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 5e-04
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 5e-04
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 6e-04
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 9e-04
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure
 Score =  276 bits (709), Expect = 9e-88
 Identities = 129/372 (34%), Positives = 192/372 (51%), Gaps = 69/372 (18%)

Query: 43  FLDSLSLYVKGGSGGNG------------QPKYGGLGGRGGNVVCKVKAGASLESV---- 86
           F+D + +YVKGG GGNG                GG GG+GG+VV   +    L ++    
Sbjct: 2   FVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVV--FEVDEGLRTLMDFR 59

Query: 87  -KKQFKGVRITAASGDNSLVHRLAGRNGEDKILELPVGITAY-ADGGTKLGELNTEEDSI 144
            KK FK     A  G++ +     GRN +D ++++P G      D    + +L       
Sbjct: 60  YKKHFK-----AIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRA 114

Query: 145 IIAHGGAGG--N-------------AQNGWLGRKGEELAVRLELKLIADIGLVGFPNAGK 189
           +IA GG GG  N             ++NG     G+E  + LELK++AD+GLVGFP+ GK
Sbjct: 115 VIARGGRGGRGNSRFATPANPAPQLSENGE---PGKERYIVLELKVLADVGLVGFPSVGK 171

Query: 190 STFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFL 249
           ST L  +S A+PKIA Y FTT+ PN+G++  DD R   +ADLPGLIEGAH+ +G+GHQFL
Sbjct: 172 STLLSVVSSAKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFL 231

Query: 250 RHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMD 309
           RH+ERT++I  ++D++G +       R   +  L +N+EL  Y + L E+P I++ NKMD
Sbjct: 232 RHIERTRVIVHVIDMSGLE------GRDPYDDYLTINQELSEYNLRLTERPQIIVANKMD 285

Query: 310 VEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIR 369
           +  A E  +  ++ L         YP             + PISA T    + +   ++ 
Sbjct: 286 MPEAAENLEAFKEKLT------DDYP-------------VFPISAVTR-EGLRELLFEVA 325

Query: 370 SILDLLAEEEQE 381
           + L+   E    
Sbjct: 326 NQLENTPEFPLY 337
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query654
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 100.0
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 100.0
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 100.0
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 100.0
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 100.0
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.91
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.88
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.86
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.86
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.86
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.86
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.86
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.86
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.86
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.86
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.85
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.85
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.85
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.85
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.85
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.85
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.85
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.85
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.85
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.85
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.85
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.85
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.85
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.85
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.85
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.85
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.85
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.85
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.85
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.85
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.85
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.84
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.84
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.84
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.84
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.84
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.84
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.84
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.84
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.84
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.84
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.84
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.84
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.84
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.84
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.84
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.84
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.84
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.84
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.84
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.84
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.84
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.84
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.84
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.83
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.83
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.83
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.83
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.83
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.83
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.83
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.83
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.83
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.83
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.82
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.82
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.82
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.82
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.82
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.82
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.82
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.82
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.82
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.82
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.82
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.82
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.82
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.82
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.81
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.81
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.81
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.81
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.81
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.81
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.81
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.81
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.81
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.81
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.81
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.81
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.8
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.8
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.8
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.8
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.8
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.8
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.8
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.8
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.8
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.8
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.8
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.8
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.8
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.8
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.8
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.8
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.79
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.79
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.79
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.79
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.79
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.79
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.78
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.78
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.78
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.77
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.77
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.77
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.77
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.77
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.77
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.77
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.77
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.76
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.76
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.76
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.75
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.74
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.74
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.74
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.6
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.74
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.74
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.73
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.73
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.73
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.73
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.72
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.68
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.68
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.67
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.67
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.66
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.66
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.66
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.65
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.64
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.64
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.62
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.62
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.62
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.62
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.61
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.61
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.61
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.61
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.6
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.6
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.6
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 99.6
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.6
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.59
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 99.59
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.59
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.59
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.59
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.58
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.58
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.58
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.57
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.57
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.56
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.56
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.56
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.56
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.55
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.55
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.54
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.54
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.53
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.53
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.53
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.51
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.51
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.51
2ged_A193 SR-beta, signal recognition particle receptor beta 99.51
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.5
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.5
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.5
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.5
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.5
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.5
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.5
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.5
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.49
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.49
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.49
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.49
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.48
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.48
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.48
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.47
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.47
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.47
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.46
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.46
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.45
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.45
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.45
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.44
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.44
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.44
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.44
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.44
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.44
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.44
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.43
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.43
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.42
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.42
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.42
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.42
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.41
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.41
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.41
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.41
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.41
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.41
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.41
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.41
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.41
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.4
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.4
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.4
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.4
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.4
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.4
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.4
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.4
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.39
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.39
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.39
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.39
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.39
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.39
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.38
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.38
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.38
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.38
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.38
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.38
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.38
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.37
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.37
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.37
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.37
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.37
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.37
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.37
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.37
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.36
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.36
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.36
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.36
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.36
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.36
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.36
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.35
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.35
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.35
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.35
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.35
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.35
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.35
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.35
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.35
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.35
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.34
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.34
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.34
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.34
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.34
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.34
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.34
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.33
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.33
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.33
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.33
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.32
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.32
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.32
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.31
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.31
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.3
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 99.3
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.3
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.3
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.3
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.3
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.3
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.3
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.3
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.29
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.29
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.29
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.29
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.29
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.29
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.29
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.28
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.28
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.28
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.28
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.28
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.27
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.27
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.26
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.26
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.26
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.25
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.25
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.25
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.25
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.23
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.23
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.23
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.21
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.21
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.21
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.21
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.2
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.2
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.2
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.2
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.19
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.19
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.19
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.19
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.19
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.19
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.18
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.18
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.18
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.18
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.17
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.17
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.76
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.14
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.14
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.13
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.13
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.13
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.13
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.12
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.11
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.11
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.1
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.1
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.1
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.1
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.09
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.09
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.08
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.07
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.07
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.07
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.06
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.06
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.06
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.06
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.06
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.05
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.05
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.05
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.05
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.05
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.04
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.04
1g6h_A257 High-affinity branched-chain amino acid transport 99.04
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.04
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.03
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.03
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.02
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.02
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.01
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.01
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.01
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.0
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.0
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 98.99
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 98.99
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.98
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.98
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.98
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.98
2elf_A370 Protein translation elongation factor 1A; tRNA, py 98.97
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.97
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.96
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.95
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.94
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.93
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 98.92
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.91
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 98.91
2ged_A193 SR-beta, signal recognition particle receptor beta 98.91
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 98.9
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.9
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.9
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 98.9
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 98.9
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 98.9
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.88
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.88
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.85
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.84
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.83
1f60_A458 Elongation factor EEF1A; protein-protein complex, 98.81
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 98.81
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.8
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.8
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.79
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.79
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.79
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 98.78
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.75
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.75
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 98.75
2ghi_A260 Transport protein; multidrug resistance protein, M 98.74
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 98.71
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 98.7
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.7
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.7
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.7
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 98.69
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.67
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.65
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 98.64
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 98.62
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.62
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.61
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.61
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 98.6
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 98.6
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 98.59
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 98.58
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.57
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.57
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.55
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.54
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.54
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 98.52
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.51
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.51
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.49
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.47
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.46
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.45
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.45
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.42
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 98.41
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.35
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.34
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.34
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.34
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.31
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 98.31
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 98.31
3vqt_A548 RF-3, peptide chain release factor 3; translation, 98.3
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.26
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.25
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.23
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.2
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.19
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.18
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.1
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.06
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 98.05
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.05
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.99
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.93
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.83
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.82
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.77
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.72
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.71
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.66
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 97.62
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 97.62
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.6
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.6
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.58
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 97.56
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.49
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
Probab=100.00  E-value=1.4e-61  Score=509.15  Aligned_cols=304  Identities=40%  Similarity=0.729  Sum_probs=272.5

Q ss_pred             ceeeeEEEEEEeCCCCCCCCC------------CCCCCCCCCcEEEEecCCC-ChhhhhhhcCCceEEcCCCCCCCcCCc
Q psy1086          42 RFLDSLSLYVKGGSGGNGQPK------------YGGLGGRGGNVVCKVKAGA-SLESVKKQFKGVRITAASGDNSLVHRL  108 (654)
Q Consensus        42 ~f~d~~~~~~~~g~gg~g~~~------------~gg~gg~gg~v~~~~~~~~-~~~~~~~~~~~~~~~a~~g~~g~~~~~  108 (654)
                      +|||+++|+|+||+|||||++            +|||||+||||||+|++++ ||.+|++   +++|+|+||++|+++++
T Consensus         1 ~f~d~~~i~~~~g~gg~g~~~~~r~~~~~~ggp~gg~gg~gg~v~~~~~~~~~~l~~~~~---~~~~~a~~g~~g~~~~~   77 (342)
T 1lnz_A            1 MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRY---KKHFKAIRGEHGMSKNQ   77 (342)
T ss_dssp             CEEEEEEEEEECCCCCCCCCCBCCCSSSCCCCBCCCCCCCCCCEEEEECTTCCCSCGGGT---CCEEECCCCCCCCSTTC
T ss_pred             CCcceEEEEEEecCCCCceeeeehhhcccCCCCCCCCCCCCCeEEEEeCCCcChHHHhCc---cceEEcCCCCCCCCCCC
Confidence            599999999999999999975            5999999999999999999 9999974   78999999999999999


Q ss_pred             CCCCCCCEEEEcCCCcEEEe-cCcceeccccccCcEEEEeccCcCCCCCCCC------------cccccceeeEEEEEee
Q psy1086         109 AGRNGEDKILELPVGITAYA-DGGTKLGELNTEEDSIIIAHGGAGGNAQNGW------------LGRKGEELAVRLELKL  175 (654)
Q Consensus       109 ~g~~g~~~~~~vp~gt~v~~-~~~~~~~~l~~~~~~~~~a~Gg~gg~gn~~f------------~g~~Ge~~~i~L~lk~  175 (654)
                      +|++|+|++|+||+||+|+| +++++|+||+++++++++|+||+||+||++|            .|++|+++.+.++||.
T Consensus        78 ~g~~g~d~~~~vp~gt~v~~~~~~~~~~dl~~~~~~~~~~~GG~gG~Gn~~f~~~~~~~p~~~~~g~~g~~~~~~leLk~  157 (342)
T 1lnz_A           78 HGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGGRGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKV  157 (342)
T ss_dssp             CCCCCCCEEEEECTTEEEEETTTCCEEEEECSTTCEEEEECCCCCCCCGGGSCBTTBSSCCCCCCCCCCCEEEEEEEEEC
T ss_pred             cCCCCCCEEEEcCCccEEEeCCCCcEehhhhcCCcEEEEeCCCCCccCccccccccccccccccCCCCcchhhHhhhhhh
Confidence            99999999999999999999 5899999999999999999999999999999            4889999999999999


Q ss_pred             cCcEEEEcCCCCcHHHHHHHHHccCCCCCCCCccccccceEEEEeCCCccEEEEecCcccccccccccchHHHHHHHHHH
Q psy1086         176 IADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLIEGAHRNLGMGHQFLRHVERT  255 (654)
Q Consensus       176 ~~~VgLVG~~gaGKSTLl~~Lsg~~~~i~~~~~tTl~p~~G~v~~~~~~~~~i~D~PGl~~~~~~~~~l~~~~l~~i~~~  255 (654)
                      .++|+|||.||||||||+++|++.++.+++|||+|+.|..+.+.+++...+.++|+||++++++...++++.|++|++++
T Consensus       158 la~V~lvG~~nvGKSTLln~L~~~~~~i~~~~ftTl~p~~g~v~~~~~~~~~l~DtPG~i~~a~~~~~l~~~fl~~i~~~  237 (342)
T 1lnz_A          158 LADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERT  237 (342)
T ss_dssp             CCCEEEESSTTSSHHHHHHHSEEECCEESSTTSSCCCCCEEEEECSSSCEEEEEEHHHHHHHTTCTTTTHHHHHHHHHHC
T ss_pred             cCeeeeeCCCCCCHHHHHHHHHcCCCccccCCccccCceEEEEEeCCCceEEEecCCCCcccccccchhHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999887568999999999998888889999999999999


Q ss_pred             HHHHHhhcccCcccCCCCCccChHHHHHHHHHHHHHHhHhhcCcceeEeecccCccchHhHHHHHHHHHhccccccccCC
Q psy1086         256 KLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMNLLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYP  335 (654)
Q Consensus       256 ~~il~vvd~~~~~l~~~~~~~~~~~~l~~~~~el~~~~~~l~~~P~ilvlNK~D~~~~~~~~~~l~~~~~~l~~~i~~~~  335 (654)
                      +++++|+|+++.      ..+.+++.+..+..++..|...+..+|.++|+||+|+....+..+.+.+.+...        
T Consensus       238 d~ll~VvD~s~~------~~~~~~~~~~~~~~eL~~~~~~l~~~p~ilV~NK~Dl~~~~e~~~~l~~~l~~~--------  303 (342)
T 1lnz_A          238 RVIVHVIDMSGL------EGRDPYDDYLTINQELSEYNLRLTERPQIIVANKMDMPEAAENLEAFKEKLTDD--------  303 (342)
T ss_dssp             CEEEEEEESSCS------SCCCHHHHHHHHHHHHHHSCSSTTTSCBCBEEECTTSTTHHHHHHHHHHHCCSC--------
T ss_pred             cEEEEEEECCcc------cccChHHHHHHHHHHHHHhhhhhcCCCEEEEEECccCCCCHHHHHHHHHHhhcC--------
Confidence            999999999742      124677888888888888876678899999999999986554444443332210        


Q ss_pred             CccchhhhcccceEEEeecccCccchHHHHHHHHHHHHH
Q psy1086         336 EEFQPEKVIKFQSILPISAKTNSTDVNDAKLKIRSILDL  374 (654)
Q Consensus       336 ~~~~~~~~~~~~~v~~iSA~~~~~~i~~L~~~i~~~l~~  374 (654)
                                 ..++++||+++ ++++++++.|.+.+..
T Consensus       304 -----------~~v~~iSA~tg-~gi~eL~~~l~~~l~~  330 (342)
T 1lnz_A          304 -----------YPVFPISAVTR-EGLRELLFEVANQLEN  330 (342)
T ss_dssp             -----------CCBCCCSSCCS-STTHHHHHHHHHHHTS
T ss_pred             -----------CCEEEEECCCC-cCHHHHHHHHHHHHhh
Confidence                       25789999999 9999999999887654
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 654
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 2e-30
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 2e-30
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 4e-29
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 4e-29
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 3e-28
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 4e-28
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-26
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 1e-25
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 3e-26
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 3e-26
d1udxa1156 b.117.1.1 (A:1-156) Obg GTP-binding protein N-term 2e-18
d1lnza1157 b.117.1.1 (A:1-157) Obg GTP-binding protein N-term 3e-18
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 1e-13
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 1e-13
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 7e-12
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 7e-12
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 3e-10
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 3e-10
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 4e-10
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 4e-10
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 5e-08
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 5e-08
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 4e-07
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 4e-07
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 7e-07
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 3e-06
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 7e-07
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 7e-07
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 1e-06
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 1e-06
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 3e-06
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 3e-06
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 6e-06
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 6e-06
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 1e-05
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 3e-05
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-05
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-05
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 5e-05
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 5e-05
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 4e-04
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 4e-04
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 6e-04
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 6e-04
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 7e-04
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 7e-04
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 9e-04
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 0.004
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 9e-04
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 0.001
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 0.001
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 0.001
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.002
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.002
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 0.003
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 0.003
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 0.004
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 0.004
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Bacillus subtilis [TaxId: 1423]

 Score =  115 bits (288), Expect = 2e-30
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 26/209 (12%)

Query: 176 IADIGLVGFPNAGKSTFLKAISRARPKIASYPFTTIKPNVGVITFDDFRKMSVADLPGLI 235
           +AD+GLVGFP+ GKST L  +S A+PKIA Y FTT+ PN+G++  DD R   +ADLPGLI
Sbjct: 1   LADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLI 60

Query: 236 EGAHRNLGMGHQFLRHVERTKLIAMIVDVNGFQLGLKHPKRSCVETVLLLNKELELYKMN 295
           EGAH+ +G+GHQFLRH+ERT++I  ++D++G +       R   +  L +N+EL  Y + 
Sbjct: 61  EGAHQGVGLGHQFLRHIERTRVIVHVIDMSGLE------GRDPYDDYLTINQELSEYNLR 114

Query: 296 LLEKPIILLVNKMDVEGAQEIYDGIRDTLHNLKDHIHKYPEEFQPEKVIKFQSILPISAK 355
           L E+P I++ NKMD+  A E  +  ++ L +                      + PISA 
Sbjct: 115 LTERPQIIVANKMDMPEAAENLEAFKEKLTD-------------------DYPVFPISAV 155

Query: 356 TNSTDVNDAKLKIRSILDLLAEEEQEMVD 384
           T    + +   ++ + L+   E      +
Sbjct: 156 TR-EGLRELLFEVANQLENTPEFPLYDEE 183
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udxa1 b.117.1.1 (A:1-156) Obg GTP-binding protein N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1lnza1 b.117.1.1 (A:1-157) Obg GTP-binding protein N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 157 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query654
d1lnza1157 Obg GTP-binding protein N-terminal domain {Bacillu 100.0
d1udxa1156 Obg GTP-binding protein N-terminal domain {Thermus 100.0
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.88
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.88
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.88
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.87
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.87
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.87
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.87
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.86
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.85
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.85
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.85
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.85
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.85
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.84
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.84
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.84
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.83
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.82
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.81
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.81
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.81
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.8
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.8
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.79
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.78
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.78
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.77
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.77
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.77
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.76
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.76
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.74
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.71
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.69
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.68
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.68
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.67
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.65
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.65
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.64
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.63
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.62
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.62
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.62
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.62
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.61
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.6
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.6
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.58
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.58
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.58
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.57
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.55
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.54
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.51
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.49
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.49
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.48
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.46
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.45
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.44
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.43
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.41
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.41
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.4
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.4
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.38
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.37
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.37
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.36
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.36
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.34
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.33
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.31
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.29
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.29
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.28
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.27
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.27
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.26
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.25
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.23
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.23
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.22
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.21
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.21
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.21
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.19
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.19
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.18
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.18
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.18
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.17
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.17
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.16
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.16
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.16
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.15
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.15
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.15
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.15
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.15
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.14
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.13
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.13
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.11
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.11
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.11
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.1
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.1
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.1
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.08
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.07
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.06
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.06
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.06
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.06
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.06
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.05
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.05
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.05
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.04
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.02
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.01
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.01
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.99
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.96
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.96
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.95
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.81
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.78
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.75
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.73
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.69
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.69
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.6
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.6
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.52
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.52
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.49
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.47
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.46
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.44
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.37
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.32
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.94
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.66
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 97.62
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.61
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.58
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.57
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 97.56
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.56
d1vmaa2213 GTPase domain of the signal recognition particle r 97.5
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.47
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.46
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.43
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.43
d2qy9a2211 GTPase domain of the signal recognition particle r 97.43
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.43
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.41
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.36
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.35
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.34
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.31
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.31
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.26
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.25
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.2
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.18
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.16
d1okkd2207 GTPase domain of the signal recognition particle r 97.09
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.03
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.85
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.83
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.82
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.62
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.53
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.48
d1vmaa2213 GTPase domain of the signal recognition particle r 96.43
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.35
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.12
d2qy9a2211 GTPase domain of the signal recognition particle r 96.02
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.01
d1okkd2207 GTPase domain of the signal recognition particle r 96.01
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.01
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.81
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.65
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.61
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.57
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.57
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.57
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.45
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.45
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.4
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.4
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.4
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.31
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.28
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.26
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.26
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.23
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.01
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.97
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.97
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.95
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 94.91
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 94.89
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.87
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.78
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.77
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.69
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.68
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.67
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.66
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.64
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.61
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.55
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.48
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.44
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.35
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.26
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.14
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.13
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.99
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.94
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 93.9
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.46
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.42
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.82
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.68
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.4
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.16
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.12
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.1
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.08
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.07
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 91.96
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.68
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.57
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.46
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.42
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.39
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.3
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.01
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.99
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 90.88
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.78
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.62
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.5
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.47
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.45
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.42
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.27
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 90.2
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.0
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.87
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.8
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.73
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 89.47
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.44
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.18
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 89.05
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.99
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 88.91
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 88.81
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.73
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 88.72
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.66
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.64
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.56
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 88.48
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 88.45
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.4
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.25
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 88.14
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.14
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 88.06
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.06
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.05
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 87.99
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 87.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.56
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.54
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 87.49
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.46
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 87.43
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 87.33
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.16
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 87.15
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 87.15
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.96
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 86.94
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 86.73
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 86.52
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.46
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 86.4
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.85
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 85.65
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 85.45
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 85.43
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.37
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.35
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 85.03
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.94
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.92
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 84.82
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.73
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 84.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.52
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 84.49
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 84.45
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 84.19
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.82
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 83.82
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 83.72
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 83.11
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 82.82
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 82.72
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 82.55
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 82.23
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 81.62
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.4
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 81.36
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 81.29
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 81.26
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 81.24
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 81.06
d1xpua3289 Transcription termination factor Rho, ATPase domai 80.6
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 80.42
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.35
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 80.31
d1tuea_205 Replication protein E1 helicase domain {Human papi 80.27
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 80.21
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.05
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 80.04
>d1lnza1 b.117.1.1 (A:1-157) Obg GTP-binding protein N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: All beta proteins
fold: Obg-fold
superfamily: Obg GTP-binding protein N-terminal domain
family: Obg GTP-binding protein N-terminal domain
domain: Obg GTP-binding protein N-terminal domain
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=1.6e-38  Score=289.09  Aligned_cols=131  Identities=34%  Similarity=0.650  Sum_probs=124.5

Q ss_pred             ceeeeEEEEEEeCCCCCCCCC------------CCCCCCCCCcEEEEecCCC-ChhhhhhhcCCceEEcCCCCCCCcCCc
Q psy1086          42 RFLDSLSLYVKGGSGGNGQPK------------YGGLGGRGGNVVCKVKAGA-SLESVKKQFKGVRITAASGDNSLVHRL  108 (654)
Q Consensus        42 ~f~d~~~~~~~~g~gg~g~~~------------~gg~gg~gg~v~~~~~~~~-~~~~~~~~~~~~~~~a~~g~~g~~~~~  108 (654)
                      +|||+++|+|+||+||+||++            +|||||+||||||++|+++ ||.+|++   +++|+|+||++|+++++
T Consensus         1 mFvD~~~i~v~aG~GG~G~~sf~r~k~~~~ggpdGG~GG~GG~V~l~~d~~l~tL~~~~~---~k~~~A~~G~~G~~~~~   77 (157)
T d1lnza1           1 MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRY---KKHFKAIRGEHGMSKNQ   77 (157)
T ss_dssp             CEEEEEEEEEECCCCCCCCCCBCCCSSSCCCCBCCCCCCCCCCEEEEECTTCCCSCGGGT---CCEEECCCCCCCCSTTC
T ss_pred             CCeEEEEEEEEECCCCCccccccccccccCCCCCCCCCcCCCEEEEEEchhhchhhhhee---ccceecccCCCcchhhh
Confidence            699999999999999999975            6999999999999999999 9999874   78999999999999999


Q ss_pred             CCCCCCCEEEEcCCCcEEEec-CcceeccccccCcEEEEeccCcCCCCCCCC------------cccccceeeEEEEEee
Q psy1086         109 AGRNGEDKILELPVGITAYAD-GGTKLGELNTEEDSIIIAHGGAGGNAQNGW------------LGRKGEELAVRLELKL  175 (654)
Q Consensus       109 ~g~~g~~~~~~vp~gt~v~~~-~~~~~~~l~~~~~~~~~a~Gg~gg~gn~~f------------~g~~Ge~~~i~L~lk~  175 (654)
                      +|++|+|++|+||+||+|++. ++++|+||.++++++++|+||+||+||++|            .|++||++.|.||||+
T Consensus        78 ~G~~G~Dlii~VP~GT~V~~~~~~~~i~dl~~~g~~~lvakGG~GG~GN~~f~ss~n~~P~~~~~G~~Ge~~~i~LeLKL  157 (157)
T d1lnza1          78 HGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGGRGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKV  157 (157)
T ss_dssp             CCCCCCCEEEEECTTEEEEETTTCCEEEEECSTTCEEEEECCCCCCCCGGGSCBTTBSSCCCCCCCCCCCEEEEEEEEEC
T ss_pred             cCCCCCcEEEEeccceEEecCCCcEEEEeeccCCceEEEEecCCCCCcccccccccCCCCccccCCCCceEEEEEEEEEC
Confidence            999999999999999999985 689999999999999999999999999998            3999999999999984
>d1udxa1 b.117.1.1 (A:1-156) Obg GTP-binding protein N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure