Psyllid ID: psy10921


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQLQHILRNQDPRDTKVIGDKLRDQATT
ccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEcHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
cccEEEEEEEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccHHHHHHHcHHHHHHHHHHHHHccccccccccHHHEEcHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccHHHccccccEccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEdrigkqlepdytkgifqsigfkefhnylmlsdqdrqepdytkgifqsigfkefhnylmlsdsdresdkGREIFNKSLDALVLANVQYAKKQNQWVRNRllkcpdrmvppvyslnctdlttwaqsvtapALHIVQSYldnraptgieplaqeyvdpsyynagtfncdvcnrlfigqHQYEQHMNSVKHRRMKVKMERQLQHILrnqdprdtkvigdklrdqatt
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQLQHilrnqdprdtkvigdklrdqatt
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQLQHILRNQDPRDTKVIGDKLRDQATT
*****KFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLML***********EIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQ*******************************************
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIG*****DYTKGIFQSIGFKEFHNYLMLSDQDR********IFQSIGFKEFHNYLMLSD********REIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPT****************AGTFNCDVCNRLFIGQHQYEQHM*****************************************
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQLQHILRNQDPRDTKVIGDKLRDQATT
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQL*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQLQHILRNQDPRDTKVIGDKLRDQATT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q9H3H1467 tRNA dimethylallyltransfe yes N/A 0.702 0.404 0.357 4e-35
Q80UN9467 tRNA dimethylallyltransfe yes N/A 0.706 0.406 0.363 9e-35
Q9UT75434 tRNA dimethylallyltransfe yes N/A 0.695 0.430 0.258 1e-10
P07884428 tRNA dimethylallyltransfe yes N/A 0.717 0.450 0.235 7e-10
Q9ZUX7466 tRNA dimethylallyltransfe yes N/A 0.762 0.439 0.229 6e-08
>sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1 Back     alignment and function desciption
 Score =  148 bits (374), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 120/224 (53%), Gaps = 35/224 (15%)

Query: 11  HLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEF 70
           H +  VLD+RL+ RV  M+  GL+EEL  FHR+YN+  + +  +                
Sbjct: 230 HADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQ---------------- 273

Query: 71  HNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLAN 130
                         DY  GIFQSIGFKEFH YL +++     +   ++  K ++AL    
Sbjct: 274 --------------DYQHGIFQSIGFKEFHEYL-ITEGKCTLETSNQLLKKGIEALKQVT 318

Query: 131 VQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTG 190
            +YA+KQN+WV+NR L  P  +VPPVY L  +D++ W +SV  PAL IVQS++    PT 
Sbjct: 319 KRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTA 378

Query: 191 IEPLAQEYVDPSYYNAGTFN-CDVCNRLFIGQHQYEQHMNSVKH 233
             P+   Y +    N  +++ CD+C+R+ IG  ++  H+ S  H
Sbjct: 379 T-PIKMPYNEAE--NKRSYHLCDLCDRIIIGDREWAAHIKSKSH 419




Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 7EC: 5
>sp|Q80UN9|MOD5_MOUSE tRNA dimethylallyltransferase, mitochondrial OS=Mus musculus GN=Trit1 PE=2 SV=2 Back     alignment and function description
>sp|Q9UT75|MOD5_SCHPO tRNA dimethylallyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tit1 PE=3 SV=1 Back     alignment and function description
>sp|P07884|MOD5_YEAST tRNA dimethylallyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOD5 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZUX7|IPT2_ARATH tRNA dimethylallyltransferase 2 OS=Arabidopsis thaliana GN=IPT2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
156555105 494 PREDICTED: tRNA dimethylallyltransferase 0.739 0.402 0.385 8e-44
340720913 470 PREDICTED: tRNA dimethylallyltransferase 0.750 0.429 0.389 1e-43
350397955 449 PREDICTED: tRNA dimethylallyltransferase 0.702 0.420 0.393 4e-42
270003038 373 hypothetical protein TcasGA2_TC000060 [T 0.762 0.549 0.383 2e-41
91092888 419 PREDICTED: similar to tRNA isopentenyltr 0.762 0.489 0.383 3e-41
110760779251 PREDICTED: tRNA dimethylallyltransferase 0.739 0.792 0.382 3e-40
380019144 901 PREDICTED: uncharacterized protein LOC10 0.743 0.221 0.380 8e-40
383853924 610 PREDICTED: tRNA dimethylallyltransferase 0.691 0.304 0.399 2e-39
405965862 545 tRNA isopentenyltransferase, mitochondri 0.691 0.341 0.380 1e-37
346468251 476 hypothetical protein [Amblyomma maculatu 0.710 0.401 0.363 1e-36
>gi|156555105|ref|XP_001604528.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/236 (38%), Positives = 137/236 (58%), Gaps = 37/236 (15%)

Query: 13  NSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHN 72
           N +VLD+RL+ RV +M++  L++ELL FH +YN+DRI                       
Sbjct: 227 NRDVLDRRLDARVDSMLKADLVQELLDFHERYNKDRI----------------------- 263

Query: 73  YLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQ 132
                 Q  +  DY+KGIFQSIGFKEFHNYL+L   +R+S+ G+++  ++++ L +A  +
Sbjct: 264 ------QKNESADYSKGIFQSIGFKEFHNYLILPKQERDSETGQKLLKEAIENLKIATRR 317

Query: 133 YAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAP---- 188
           YA++Q++WVRNRL++  DR VPPVYSL+CTDL  W   V   A+ IV + +    P    
Sbjct: 318 YARRQHKWVRNRLIRRVDRQVPPVYSLDCTDLEQWESEVYGKAVEIVAAVMSGETPRVKA 377

Query: 189 --TGIEPLAQEYVDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMER 242
             + ++    +  DPS        C+VC R+FIG+ Q+ +HM   KH+R+  K  R
Sbjct: 378 TNSSVDDTDAKVTDPSIET--NHFCEVCQRVFIGEFQWTEHMTGAKHKRVLEKKRR 431




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340720913|ref|XP_003398873.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350397955|ref|XP_003485043.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|270003038|gb|EEZ99485.1| hypothetical protein TcasGA2_TC000060 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91092888|ref|XP_970625.1| PREDICTED: similar to tRNA isopentenyltransferase 1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|110760779|ref|XP_001120157.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|380019144|ref|XP_003693474.1| PREDICTED: uncharacterized protein LOC100868799 [Apis florea] Back     alignment and taxonomy information
>gi|383853924|ref|XP_003702472.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|405965862|gb|EKC31211.1| tRNA isopentenyltransferase, mitochondrial [Crassostrea gigas] Back     alignment and taxonomy information
>gi|346468251|gb|AEO33970.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
UNIPROTKB|Q5QPK7379 TRIT1 "tRNA dimethylallyltrans 0.747 0.530 0.339 2.9e-32
UNIPROTKB|Q9H3H1467 TRIT1 "tRNA dimethylallyltrans 0.713 0.411 0.345 2e-31
MGI|MGI:1914216467 Trit1 "tRNA isopentenyltransfe 0.713 0.411 0.35 2e-31
RGD|1304781479 Trit1 "tRNA isopentenyltransfe 0.747 0.419 0.344 2.6e-31
UNIPROTKB|Q3T7B8221 TRIT1 "tRNA dimethylallyltrans 0.661 0.805 0.360 4.9e-30
UNIPROTKB|E1C6R1459 TRIT1 "Uncharacterized protein 0.776 0.455 0.333 1.3e-29
UNIPROTKB|F1SMC5413 TRIT1 "Uncharacterized protein 0.710 0.462 0.343 4.4e-29
ZFIN|ZDB-GENE-060503-297455 trit1 "tRNA isopentenyltransfe 0.702 0.415 0.354 1.2e-28
UNIPROTKB|F6RA00467 TRIT1 "Uncharacterized protein 0.743 0.428 0.325 4.8e-28
UNIPROTKB|F1Q3P4468 TRIT1 "Uncharacterized protein 0.717 0.412 0.321 8.6e-28
UNIPROTKB|Q5QPK7 TRIT1 "tRNA dimethylallyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 2.9e-32, P = 2.9e-32
 Identities = 71/209 (33%), Positives = 117/209 (55%)

Query:    37 LLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGF 96
             +L  H    ++R+ K+++     G+ + +  ++FH      +      DY  GIFQSIGF
Sbjct:   140 ILWLHADQADERLDKRVDDMLAAGLLEEL--RDFHRRYNQKNVSENSQDYQHGIFQSIGF 197

Query:    97 KEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPV 156
             KEFH YL +++     +   ++  K ++AL     +YA+KQN+WV+NR L  P  +VPPV
Sbjct:   198 KEFHEYL-ITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPV 256

Query:   157 YSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFN-CDVCN 215
             Y L  +D++ W +SV  PAL IVQS++    PT   P+   Y +    N  +++ CD+C+
Sbjct:   257 YGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTAT-PIKMPYNEAE--NKRSYHLCDLCD 313

Query:   216 RLFIGQHQYEQHMNSVKHRRMKVKMERQL 244
             R+ IG  ++  H+ S  H   ++K  R+L
Sbjct:   314 RIIIGDREWAAHIKSKSHLN-QLKKRRRL 341


GO:0005524 "ATP binding" evidence=IEA
GO:0008033 "tRNA processing" evidence=IEA
UNIPROTKB|Q9H3H1 TRIT1 "tRNA dimethylallyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914216 Trit1 "tRNA isopentenyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304781 Trit1 "tRNA isopentenyltransferase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T7B8 TRIT1 "tRNA dimethylallyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6R1 TRIT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMC5 TRIT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-297 trit1 "tRNA isopentenyltransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6RA00 TRIT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3P4 TRIT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
PLN02748468 PLN02748, PLN02748, tRNA dimethylallyltransferase 2e-13
COG0324308 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph 9e-07
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 6e-06
pfam1287425 pfam12874, zf-met, Zinc-finger of C2H2 type 1e-04
PRK00091307 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp 2e-04
pfam01715253 pfam01715, IPPT, IPP transferase 3e-04
TIGR00174287 TIGR00174, miaA, tRNA dimethylallyltransferase 6e-04
>gnl|CDD|215399 PLN02748, PLN02748, tRNA dimethylallyltransferase Back     alignment and domain information
 Score = 69.5 bits (170), Expect = 2e-13
 Identities = 51/223 (22%), Positives = 100/223 (44%), Gaps = 18/223 (8%)

Query: 16  VLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLM 75
           VLD+ +  RV  MI  GL++E+   +              DYT+G+ Q+IG +EF ++L 
Sbjct: 239 VLDRYVNQRVDCMIDAGLLDEVYDIYDPG----------ADYTRGLRQAIGVREFEDFLR 288

Query: 76  LSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAK 135
           L     +  + T         KE    ++    D   DK + + ++++D + L   +  +
Sbjct: 289 LYLSRNENGELTSSSNNDKVMKENSRKILNFPHD---DKLKILLDEAIDQVKLNTRRLVR 345

Query: 136 KQNQWVR--NRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRAPTGIEP 193
           +Q + +   N +       +    ++ C    +W   V  PA+ IV+ +L +   +G + 
Sbjct: 346 RQKRRLHRLNTVFGWNIHYIDATEAILCKSEESWNAKVVKPAVEIVRRFLSDDTSSGPDA 405

Query: 194 LAQEYVDPSYYNAGTFNCDVC-NRLFIGQHQYEQHMNSVKHRR 235
            + + V    +    + C+ C N++  G H++EQH     HR+
Sbjct: 406 SSGKSVSRELWT--QYVCEACGNKVLRGAHEWEQHKQGRGHRK 446


Length = 468

>gnl|CDD|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information
>gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type Back     alignment and domain information
>gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>gnl|CDD|216659 pfam01715, IPPT, IPP transferase Back     alignment and domain information
>gnl|CDD|213512 TIGR00174, miaA, tRNA dimethylallyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
PLN02748468 tRNA dimethylallyltransferase 100.0
PLN02165334 adenylate isopentenyltransferase 100.0
KOG1384|consensus348 99.97
PF01715253 IPPT: IPP transferase; InterPro: IPR002627 tRNA is 99.96
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 99.96
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 99.96
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 99.95
PLN02840421 tRNA dimethylallyltransferase 99.94
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 99.94
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 98.55
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 98.5
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 98.17
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 96.93
KOG0717|consensus 508 96.43
KOG3408|consensus129 96.0
KOG3032|consensus 264 95.57
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.32
KOG4727|consensus193 94.76
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.32
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 93.94
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.72
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 93.62
PF0753549 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc 93.06
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 92.77
KOG2785|consensus 390 91.95
COG5188 470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 91.82
smart0035526 ZnF_C2H2 zinc finger. 91.02
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 90.56
KOG0227|consensus 222 89.34
PTZ00448373 hypothetical protein; Provisional 88.31
KOG3454|consensus165 86.77
PF11931196 DUF3449: Domain of unknown function (DUF3449); Int 85.1
COG5246 222 PRP11 Splicing factor 3a, subunit 2 [RNA processin 80.98
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
Probab=100.00  E-value=8.8e-51  Score=394.44  Aligned_cols=224  Identities=21%  Similarity=0.376  Sum_probs=166.5

Q ss_pred             CCceEEEEEeCChHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhcccccccCCCCCCcCCccccccHHHHHHHHhhhccCC
Q psy10921          2 ELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDR   81 (269)
Q Consensus         2 ~~~~l~~wL~~~~~vL~~RLd~RVd~Mi~~GLldEv~~l~~~~~~~~~~~~~~~d~~~gi~qaIGyKEf~~yL~~~~~~~   81 (269)
                      +|++++|||++++++|++||++|||.||++||++||+.|+..+          .+++.|+|||||||||.+||..+....
T Consensus       225 ~~~~~~i~l~~~r~~L~~RI~~Rvd~Mle~GlleEv~~l~~~~----------~~~~~~~~qaIGykE~~~yL~~~~~~~  294 (468)
T PLN02748        225 RFDCCFICVDADTAVLDRYVNQRVDCMIDAGLLDEVYDIYDPG----------ADYTRGLRQAIGVREFEDFLRLYLSRN  294 (468)
T ss_pred             CCceEEEEeCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHhcC----------CCCCcccceeEcHHHHHHHHHhccccc
Confidence            5899999999999999999999999999999999999999642          245689999999999999998542211


Q ss_pred             CCCccccchhhhcccccch-hhcccCCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCeEEec
Q psy10921         82 QEPDYTKGIFQSIGFKEFH-NYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLN  160 (269)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~-~~l~~~~~~~~~~~~~~~l~eaie~~k~~TRqYAKRQ~tWir~~~l~~~~~~~~~i~~lD  160 (269)
                      +....+.|...+...+... ..|+.. ++.+..   .++++||+.||.+||||||||+|||++.. ...   .+.+||||
T Consensus       295 ~~g~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~---~~l~eaie~ik~~Tr~yAKRQ~tw~~rl~-~~~---~~~i~~lD  366 (468)
T PLN02748        295 ENGELTSSSNNDKVMKENSRKILNFP-HDDKLK---ILLDEAIDQVKLNTRRLVRRQKRRLHRLN-TVF---GWNIHYID  366 (468)
T ss_pred             ccccccccccccchhhhhhhcccccc-chhhhh---hhHHHHHHHHHHHHHHHHHHHHHHHhhhh-hcc---cCCeeEee
Confidence            0000000000000001000 111111 122223   68999999999999999999999999642 111   26899999


Q ss_pred             CCCc------chhhhhhHHHHHHHHHHHhccCCCCCCCccccccCCCCCCCCcccccccCcc-cccCHHHHHHHhhhhHH
Q psy10921        161 CTDL------TTWAQSVTAPALHIVQSYLDNRAPTGIEPLAQEYVDPSYYNAGTFNCDVCNR-LFIGQHQYEQHMNSVKH  233 (269)
Q Consensus       161 ~t~~------~~W~~~V~~~A~~iv~~fl~~~~p~~~~~l~~~~~~~~~~~~~~~~Ce~C~~-~~~ge~eW~~HlkSr~H  233 (269)
                      +|++      +.|.+.|++||++||++||++.+|. ..+.......+. +.|++|+||+|++ +++|++||++|++||+|
T Consensus       367 ~t~~~~~~~~~~W~~~V~~pa~~iv~~fL~~~~~~-~~~~~~~~~~~~-~~~~~~~Ce~C~~~~~~G~~eW~~Hlksr~H  444 (468)
T PLN02748        367 ATEAILCKSEESWNAKVVKPAVEIVRRFLSDDTSS-GPDASSGKSVSR-ELWTQYVCEACGNKVLRGAHEWEQHKQGRGH  444 (468)
T ss_pred             chhhhhhccHhHHHHHhHHHHHHHHHHHHcCCCCC-CcCccccccccc-cccccccccCCCCcccCCHHHHHHHhcchHH
Confidence            9987      8999999999999999999997754 222211111223 6899999999997 99999999999999999


Q ss_pred             HHHhHHHHHHhh
Q psy10921        234 RRMKVKMERQLQ  245 (269)
Q Consensus       234 rk~~kk~kk~~~  245 (269)
                      |+++++.+|++.
T Consensus       445 k~~~~~~~k~~~  456 (468)
T PLN02748        445 RKRVQRLKQKQT  456 (468)
T ss_pred             HHHHhHHHhhhh
Confidence            999999988754



>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>KOG1384|consensus Back     alignment and domain information
>PF01715 IPPT: IPP transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2 Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>KOG3032|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4727|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG0227|consensus Back     alignment and domain information
>PTZ00448 hypothetical protein; Provisional Back     alignment and domain information
>KOG3454|consensus Back     alignment and domain information
>PF11931 DUF3449: Domain of unknown function (DUF3449); InterPro: IPR024598 This presumed domain is functionally uncharacterised Back     alignment and domain information
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3eph_A409 Crystallographic Snapshots Of Eukaryotic Dimethylal 6e-11
>pdb|3EPH|A Chain A, Crystallographic Snapshots Of Eukaryotic Dimethylallyltransferase Acting On Trna: Insight Into Trna Recognition And Reaction Mechanism Length = 409 Back     alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 59/251 (23%), Positives = 108/251 (43%), Gaps = 58/251 (23%) Query: 2 ELNLKFTVNHL----NSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDY 57 ++ LKF L E L +RL+ RV M++ G ++E+ Q + Y++++ P+ Sbjct: 182 KITLKFDTLFLWLYSKPEPLFQRLDDRVDDMLERGALQEIKQLYEYYSQNK----FTPEQ 237 Query: 58 TKGIFQSIGFKEFHNYLMLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGRE 117 + G++Q IGFKEF +L ++D Sbjct: 238 CEN----------------------------GVWQVIGFKEFLPWLT-----GKTDDNTV 264 Query: 118 IFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALH 177 ++ + QYAK+Q +W++ L+ PD + +Y L+ TDL+ W + + A+ Sbjct: 265 KLEDCIERMKTRTRQYAKRQVKWIKKMLI--PD-IKGDIYLLDATDLSQWDTNASQRAIA 321 Query: 178 IVQSYLDN------RAPTGIEPLAQ--EYVDPSYYNAGTFNCDVC------NRLFIGQHQ 223 I ++ N RAP +E L E + + C+VC N + IG+ Sbjct: 322 ISNDFISNRPIKQERAPKALEELLSKGETTMKKLDDWTHYTCNVCRNADGKNVVAIGEKY 381 Query: 224 YEQHMNSVKHR 234 ++ H+ S +H+ Sbjct: 382 WKIHLGSRRHK 392

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 1e-33
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 2e-22
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 7e-05
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 9e-05
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 7e-04
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Length = 409 Back     alignment and structure
 Score =  125 bits (316), Expect = 1e-33
 Identities = 53/246 (21%), Positives = 96/246 (39%), Gaps = 54/246 (21%)

Query: 15  EVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYL 74
           E L +RL+ RV  M++ G ++E+ Q +  Y+++   K        G++Q IGFKEF  +L
Sbjct: 199 EPLFQRLDDRVDDMLERGALQEIKQLYEYYSQN---KFTPEQCENGVWQVIGFKEFLPWL 255

Query: 75  MLSDQDRQEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYA 134
                                               ++D         ++ +     QYA
Sbjct: 256 ----------------------------------TGKTDDNTVKLEDCIERMKTRTRQYA 281

Query: 135 KKQNQWVRNRLLKCPDRMVPPVYSLNCTDLTTWAQSVTAPALHIVQSYLDNRA-PTGIEP 193
           K+Q +W++  L+         +Y L+ TDL+ W  + +  A+ I   ++ NR       P
Sbjct: 282 KRQVKWIKKMLIPDIK---GDIYLLDATDLSQWDTNASQRAIAISNDFISNRPIKQERAP 338

Query: 194 LAQEYVDPSYYNAGT-------FNCDVC------NRLFIGQHQYEQHMNSVKHRRMKVKM 240
            A E +                + C+VC      N + IG+  ++ H+ S +H+    + 
Sbjct: 339 KALEELLSKGETTMKKLDDWTHYTCNVCRNADGKNVVAIGEKYWKIHLGSRRHKSNLKRN 398

Query: 241 ERQLQH 246
            RQ   
Sbjct: 399 TRQADF 404


>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Length = 339 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Length = 316 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Length = 323 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 340 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 100.0
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 100.0
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 99.97
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 99.96
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 99.96
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 99.96
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 99.35
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.42
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.37
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.51
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 96.41
1ard_A29 Yeast transcription factor ADR1; transcription reg 92.08
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 91.8
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 91.58
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 91.34
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 91.07
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 90.9
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 90.64
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 90.63
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 90.31
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.21
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 89.85
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.83
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.63
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.54
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 89.41
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 88.96
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 89.12
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 89.03
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 88.8
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.61
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.5
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 88.39
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 88.04
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 87.29
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 87.39
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 87.25
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.16
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 87.07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.86
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 86.79
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 86.69
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.65
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 86.65
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.64
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.36
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 86.36
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.32
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.26
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 86.19
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 86.24
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 86.12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 86.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.01
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 85.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.97
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.91
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.87
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.85
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.85
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.84
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.81
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.79
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.66
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 85.63
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.6
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.6
1paa_A30 Yeast transcription factor ADR1; transcription reg 85.58
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.58
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.57
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.57
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.55
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 85.51
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 85.46
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 85.38
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 85.38
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 85.37
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.37
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.32
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 85.28
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.23
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.18
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.01
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.01
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.92
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 84.89
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 84.86
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 84.85
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.73
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 84.71
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.51
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 84.46
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 84.45
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 84.35
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.27
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.25
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.24
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 84.21
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 84.18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 84.17
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.17
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 84.14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 84.01
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 83.98
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.93
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 83.92
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.91
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 83.9
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 83.9
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.89
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.89
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 83.86
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 83.76
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.7
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.68
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.5
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 83.5
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 83.49
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 83.1
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 82.79
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 82.58
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.26
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.11
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 82.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 81.96
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 81.79
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 81.43
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 81.34
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 81.2
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 81.05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 80.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 80.98
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 80.94
4f9c_B144 Protein DBF4 homolog A; Ser/Thr protein kinase, tr 80.8
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 80.77
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 80.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 80.54
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 80.13
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
Probab=100.00  E-value=2e-52  Score=399.27  Aligned_cols=205  Identities=24%  Similarity=0.471  Sum_probs=168.3

Q ss_pred             CCceEEEEEeCChHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhcccccccCCCCCCcCCccccccHHHHHHHHhhhccCC
Q psy10921          2 ELNLKFTVNHLNSEVLDKRLEGRVHTMIQNGLIEELLQFHRQYNEDRIGKQLEPDYTKGIFQSIGFKEFHNYLMLSDQDR   81 (269)
Q Consensus         2 ~~~~l~~wL~~~~~vL~~RLd~RVd~Mi~~GLldEv~~l~~~~~~~~~~~~~~~d~~~gi~qaIGyKEf~~yL~~~~~~~   81 (269)
                      +|++++|||++++++|++||++|||.||++||++||+.|++.+......   ..+++.|++||||||||.+||.+...  
T Consensus       186 ~~~~~~i~L~~~R~~L~~RI~~Rvd~Ml~~GlleEv~~L~~~~~~~~~~---~~~~~~~~~~aIGYkE~~~yL~g~~~--  260 (409)
T 3eph_A          186 KFDTLFLWLYSKPEPLFQRLDDRVDDMLERGALQEIKQLYEYYSQNKFT---PEQCENGVWQVIGFKEFLPWLTGKTD--  260 (409)
T ss_dssp             SSEEEEEEEECCHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHTTTTCC---GGGTTSGGGGSTTTGGGGGGGC------
T ss_pred             CcceEEEEEeCCHHHHHHHHHHHHHHHHHCcHHHHHHHHHHhccccccc---cccccccchhcccHHHHHHHHcCCCc--
Confidence            5899999999999999999999999999999999999999875321000   11356899999999999999964200  


Q ss_pred             CCCccccchhhhcccccchhhcccCCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCeEEecC
Q psy10921         82 QEPDYTKGIFQSIGFKEFHNYLMLSDSDRESDKGREIFNKSLDALVLANVQYAKKQNQWVRNRLLKCPDRMVPPVYSLNC  161 (269)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~eaie~~k~~TRqYAKRQ~tWir~~~l~~~~~~~~~i~~lD~  161 (269)
                                                   ..+   ..+++|++.++.+||||||||+||||+++++.+.   +++||||+
T Consensus       261 -----------------------------~~e---~~l~eaie~ik~~TRqyAKRQ~TWfR~~~~~~~~---~~i~~lD~  305 (409)
T 3eph_A          261 -----------------------------DNT---VKLEDCIERMKTRTRQYAKRQVKWIKKMLIPDIK---GDIYLLDA  305 (409)
T ss_dssp             -----------------------------------CCHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTT---TCEEEEEC
T ss_pred             -----------------------------ccc---cCHHHHHHHHHHHHHHHHHHHHHHHHhhcccccC---CceEEEcC
Confidence                                         112   5699999999999999999999999999988754   57999999


Q ss_pred             CCcchhhhhhHHHHHHHHHHHhccCCCC---CCCcccc-----ccCCCCCCCCcccccccCcc------cccCHHHHHHH
Q psy10921        162 TDLTTWAQSVTAPALHIVQSYLDNRAPT---GIEPLAQ-----EYVDPSYYNAGTFNCDVCNR------LFIGQHQYEQH  227 (269)
Q Consensus       162 t~~~~W~~~V~~~A~~iv~~fl~~~~p~---~~~~l~~-----~~~~~~~~~~~~~~Ce~C~~------~~~ge~eW~~H  227 (269)
                      |+++.|+++|.+||++||++||+|.+.+   .++.++.     .....+.+.|++|+||+|++      +++|+++|++|
T Consensus       306 t~~~~W~~~V~~pa~~iv~~fl~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~Ce~C~~~~~~~~~~~ge~~W~~H  385 (409)
T 3eph_A          306 TDLSQWDTNASQRAIAISNDFISNRPIKQERAPKALEELLSKGETTMKKLDDWTHYTCNVCRNADGKNVVAIGEKYWKIH  385 (409)
T ss_dssp             SCTTTCTTTTHHHHHHHHHHHHTTCCCCSCSSCGGGGGGGSGGGTGGGSCCCCCEEEEEEEECTTSCEEEEESHHHHHHH
T ss_pred             CChhHHHHHHHHHHHHHHHHHhcCCCCCCCcccHHHHHHhccccccccccccccceeCCCCCCCCCCcceEEcHHHHHHH
Confidence            9999999999999999999999997522   2333321     11111236899999999998      99999999999


Q ss_pred             hhhhHHHHHhHHHHHHhhh
Q psy10921        228 MNSVKHRRMKVKMERQLQH  246 (269)
Q Consensus       228 lkSr~Hrk~~kk~kk~~~~  246 (269)
                      ++||+||+++++++|+++.
T Consensus       386 ~ksr~Hk~~~~~~~k~~~~  404 (409)
T 3eph_A          386 LGSRRHKSNLKRNTRQADF  404 (409)
T ss_dssp             HTSHHHHHHHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHHHHHHhh
Confidence            9999999999999998764



>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 1e-05
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.5 bits (95), Expect = 1e-05
 Identities = 11/45 (24%), Positives = 17/45 (37%)

Query: 199 VDPSYYNAGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMERQ 243
            DP     G   C  C R FI     + H  S  H++   ++  +
Sbjct: 6   FDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVE 50


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 98.39
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 97.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.95
d1zu1a172 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 95.6
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 93.39
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 92.95
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 92.63
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 92.48
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 92.46
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 92.13
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 91.82
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.81
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 91.08
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.47
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 90.02
d2cota238 Zinc finger and SCAN domain-containing protein 16, 89.56
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 88.28
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 87.35
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 86.27
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 81.97
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 81.25
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 81.07
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.39  E-value=5.9e-08  Score=68.45  Aligned_cols=37  Identities=24%  Similarity=0.539  Sum_probs=33.7

Q ss_pred             CcccccccCcccccCHHHHHHHhhhhHHHHHhHHHHH
Q psy10921        206 AGTFNCDVCNRLFIGQHQYEQHMNSVKHRRMKVKMER  242 (269)
Q Consensus       206 ~~~~~Ce~C~~~~~ge~eW~~HlkSr~Hrk~~kk~kk  242 (269)
                      -.+|+|-+|++.|..+.+|+.|.+||+||++++..+.
T Consensus        13 ~gqfYCv~C~K~F~se~~l~~H~ksKkHKrrvk~L~~   49 (67)
T d1zr9a1          13 GGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSV   49 (67)
T ss_dssp             GGCSEETTTTEECSSHHHHHHHTTCHHHHHHHHHHTS
T ss_pred             CCEEecccccCccCCHHHHHHHHcccHHHHHHHHhcc
Confidence            3689999999999999999999999999999987743



>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure