Psyllid ID: psy10924

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MQHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIYCKELGLSQATDKERLTQAMKTTQVDLLEWKKAVRVWKLHKTATHKSRKTI
ccccHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccEEEEccHHHHHHHHHHccccccccEEEEEcccccccccccEEEEEEEEEEEcccccEEEEEcccEEEccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccEEEEcccccEEEEEccccccccccHHHHHHHHHHHHHHccEEccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccc
cccccccHHHHHHHHHHHcccccccccccEEEEcccccccccEEEEEccHHHHHHHcccccccccccEEEEEEccccEEEcccEEEEEEEEEEEccccEEEEEEEccEEEEEEEEccccccccEEEEEcHHHHccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccEEEEccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHEccccccccHHcccccccccHHHEccccccccccccccccccccccccEEEEcccccEEEEEEEcEcccccccc
MQHVFARAKHVVESVEEYnkqemydgthNVWVlkpvancsghgirIYRQLEDIKRAIGtlknltcprcvvqkyiekpllihgvkFDLRVWYVITNIDKFKIWVYHEGyvrfcskpysnillDEARHLTNVRIQKqyrnvrdppqlpaeLMWDFKQLRDYFTknmnlprkWDMIMKAMEESIVTIMRCAQSINYIDLRKNsfqlfgadflihenyqpclievnngpglspttsIIAKKTTELLTDMVKVVTAernplssfqnsvdtgKFHLIYCKelglsqatdKERLTQAMKTTQVDLLEWKKAVRVWKLHKTATHKSRKTI
MQHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGtlknltcprcVVQKYiekpllihgvkFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQkqyrnvrdppqlpAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAernplssfqnsvdtGKFHLIYCKELGLSQATDKERLTQAMKTtqvdllewkkavrvwklhktathksrkti
MQHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIYCKELGLSQATDKERLTQAMKTTQVDLLEWKKAVRVWKLHKTATHKSRKTI
*********HVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIYCKELGLSQATDKERLTQAMKTTQVDLLEWKKAVRVWKLHK**********
MQHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVR**PQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPL******V**GKFHLIYC*************************************************
********KHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIYCKELGLSQATDKERLTQAMKTTQVDLLEWKKAVRVWKLHK**********
*QHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIYCKELG************AMKTTQVDLLEWKKAVRVWKLHKTAT*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIYCKELGLSQATDKERLTQAMKTTQVDLLEWKKAVRVWKLHKTATHKSRKTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query322 2.2.26 [Sep-21-2011]
Q1ECV4 771 Tubulin monoglycylase TTL yes N/A 0.810 0.338 0.340 6e-45
Q9VM91 992 Tubulin glycylase 3A OS=D yes N/A 0.767 0.248 0.390 5e-44
A4Q9F1 832 Protein monoglycylase TTL yes N/A 0.810 0.313 0.329 3e-42
Q9Y4R7 772 Tubulin monoglycylase TTL no N/A 0.801 0.334 0.334 8e-42
A4Q9E5 927 Tubulin monoglycylase TTL no N/A 0.782 0.271 0.323 3e-41
A6PVC2 850 Protein monoglycylase TTL no N/A 0.798 0.302 0.333 3e-39
Q9VM92756 Tubulin glycylase 3B OS=D no N/A 0.872 0.371 0.337 1e-38
Q23K291015 Tubulin glycylase 3D OS=T N/A N/A 0.729 0.231 0.328 7e-30
P0CAZ01160 Tubulin glycylase 3B OS=T N/A N/A 0.822 0.228 0.282 5e-26
Q23SI8433 Probable alpha-tubulin po N/A N/A 0.751 0.558 0.292 2e-24
>sp|Q1ECV4|TTLL3_DANRE Tubulin monoglycylase TTLL3 OS=Danio rerio GN=ttll3 PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (460), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 156/276 (56%), Gaps = 15/276 (5%)

Query: 2   QHVFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLK 61
           ++   R K ++E + +   Q   DG  N+W++KP A   G GI    +L+D+   +G + 
Sbjct: 307 EYYLERCKCMLEQMRQVCPQMENDGICNIWIIKPGAKSRGRGIMCMNKLDDM---LGLVD 363

Query: 62  NLTC----PRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYS 117
              C     + VVQKYIE+PLL+H  KFD+R W+++T+ +   +W Y E Y+RF ++PYS
Sbjct: 364 GDHCIMKDSKWVVQKYIERPLLVHDTKFDVRQWFLVTDWNPLTVWFYRECYLRFSTQPYS 423

Query: 118 NILLDEARHLTNVRIQKQYRNVRD-PPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKA 176
              LD + HL N  IQK Y+   D  P LPAE MW   Q R +   +        +++  
Sbjct: 424 THTLDSSVHLCNNSIQKHYQPSPDRSPSLPAECMWSCSQFRSWLAASGRAALWKAVVVPG 483

Query: 177 MEESIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAK 236
           M+++++  +  AQ  + ++ RK SF+L+GADF++  + +P L+E+N  P ++P+T + A+
Sbjct: 484 MQKAVIQTLLTAQ--DSVEPRKASFELYGADFMLGRDLRPWLLEINASPTMAPSTGVTAR 541

Query: 237 KTTELLTDMVKVVTAERNPLSSFQNSVDTGKFHLIY 272
               +  D ++VV   R+     + + DTG F LIY
Sbjct: 542 LCPAVQEDTLRVVLDRRS-----ERNTDTGGFQLIY 572
Monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha-and beta-tubulin. Involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. Not involved in elongation step of the polyglycylation reaction.
Danio rerio (taxid: 7955)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9VM91|TTL3A_DROME Tubulin glycylase 3A OS=Drosophila melanogaster GN=TTLL3A PE=1 SV=1 Back     alignment and function description
>sp|A4Q9F1|TTLL8_MOUSE Protein monoglycylase TTLL8 OS=Mus musculus GN=Ttll8 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4R7|TTLL3_HUMAN Tubulin monoglycylase TTLL3 OS=Homo sapiens GN=TTLL3 PE=1 SV=2 Back     alignment and function description
>sp|A4Q9E5|TTLL3_MOUSE Tubulin monoglycylase TTLL3 OS=Mus musculus GN=Ttll3 PE=1 SV=1 Back     alignment and function description
>sp|A6PVC2|TTLL8_HUMAN Protein monoglycylase TTLL8 OS=Homo sapiens GN=TTLL8 PE=2 SV=4 Back     alignment and function description
>sp|Q9VM92|TTL3B_DROME Tubulin glycylase 3B OS=Drosophila melanogaster GN=TTLL3B PE=1 SV=2 Back     alignment and function description
>sp|Q23K29|TTL3D_TETTS Tubulin glycylase 3D OS=Tetrahymena thermophila (strain SB210) GN=TTLL3D PE=3 SV=1 Back     alignment and function description
>sp|P0CAZ0|TTL3B_TETTS Tubulin glycylase 3B OS=Tetrahymena thermophila (strain SB210) GN=TTLL3B PE=1 SV=1 Back     alignment and function description
>sp|Q23SI8|TTLL1_TETTS Probable alpha-tubulin polyglutamylase Ttll1 OS=Tetrahymena thermophila (strain SB210) GN=Ttll1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
328710060 641 PREDICTED: tubulin glycylase 3A-like iso 0.779 0.391 0.455 1e-59
328710058 757 PREDICTED: tubulin glycylase 3A-like iso 0.779 0.331 0.455 1e-59
328715316 459 PREDICTED: tubulin glycylase 3A-like [Ac 0.829 0.581 0.432 7e-58
328704501 679 PREDICTED: tubulin glycylase 3A-like iso 0.791 0.375 0.421 3e-56
345489608 973 PREDICTED: tubulin glycylase 3A-like [Na 0.826 0.273 0.369 1e-47
270006679 1724 hypothetical protein TcasGA2_TC013038 [T 0.900 0.168 0.353 2e-47
91084097 833 PREDICTED: similar to conserved hypothet 0.900 0.348 0.353 3e-47
328724069 690 PREDICTED: tubulin glycylase 3A-like [Ac 0.810 0.378 0.397 2e-46
383857662 1307 PREDICTED: uncharacterized protein LOC10 0.816 0.201 0.372 1e-45
158298962 570 AGAP009960-PA [Anopheles gambiae str. PE 0.810 0.457 0.367 4e-45
>gi|328710060|ref|XP_003244151.1| PREDICTED: tubulin glycylase 3A-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  236 bits (602), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 4   VFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAI---GTL 60
           V+A+ K+++E+V+ Y  Q   DG  N W++KP +NCSGHGI + R L  IKR I   G L
Sbjct: 287 VYAKCKYLLENVKNYCPQHYIDGITNTWIIKPSSNCSGHGIMLSRDLHTIKRKITESGVL 346

Query: 61  KNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNIL 120
           +N      ++QKYIE+PLL++  K DLR W+++TN+    +W+Y EGYVRFC+  +S   
Sbjct: 347 RN----NYILQKYIERPLLVYTCKIDLRQWFLVTNMSPVVVWMYKEGYVRFCANSFSMQN 402

Query: 121 LDEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWD-MIMKAMEE 179
           + E+ HL+NVR+Q +YR +R+ PQ+P E MWD+++L+D+  K +     WD +I   M E
Sbjct: 403 MHESIHLSNVRLQMKYRKIRN-PQVPDECMWDYRELQDHLRK-IGQEYVWDELIFPGMGE 460

Query: 180 SIVTIMRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTT 239
           S+  +++ A   +Y   R+ SFQLFGADFLI EN+ P LIE+N+ PGL+P+TSIIA    
Sbjct: 461 SVYAVLKAATDTSY--YREKSFQLFGADFLITENFIPYLIEINSIPGLNPSTSIIANLAP 518

Query: 240 ELLTDMVKV-VTAERNPLSSFQNSVDTGKF 268
            LL+D+VKV V  E+N      ++ DTG F
Sbjct: 519 MLLSDIVKVTVDYEKN------SNADTGLF 542

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328710058|ref|XP_003244150.1| PREDICTED: tubulin glycylase 3A-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328715316|ref|XP_003245593.1| PREDICTED: tubulin glycylase 3A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328704501|ref|XP_003242510.1| PREDICTED: tubulin glycylase 3A-like isoform 1 [Acyrthosiphon pisum] gi|328704503|ref|XP_003242511.1| PREDICTED: tubulin glycylase 3A-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345489608|ref|XP_001603622.2| PREDICTED: tubulin glycylase 3A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270006679|gb|EFA03127.1| hypothetical protein TcasGA2_TC013038 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91084097|ref|XP_968827.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328724069|ref|XP_003248022.1| PREDICTED: tubulin glycylase 3A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383857662|ref|XP_003704323.1| PREDICTED: uncharacterized protein LOC100875974 [Megachile rotundata] Back     alignment and taxonomy information
>gi|158298962|ref|XP_319096.3| AGAP009960-PA [Anopheles gambiae str. PEST] gi|157014139|gb|EAA13905.3| AGAP009960-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
FB|FBgn0031854 992 TTLL3A "Tubulin tyrosine ligas 0.776 0.252 0.387 1.1e-42
ZFIN|ZDB-GENE-060616-182 789 ttll3 "tubulin tyrosine ligase 0.804 0.328 0.347 2.2e-41
UNIPROTKB|E2R1J4 847 TTLL8 "Uncharacterized protein 0.801 0.304 0.343 2.6e-41
UNIPROTKB|H3BLT7520 TTLL3 "Tubulin monoglycylase T 0.832 0.515 0.333 5.9e-41
UNIPROTKB|C9JSD3326 TTLL3 "Tubulin monoglycylase T 0.801 0.791 0.338 1.2e-40
UNIPROTKB|H0Y5E3 619 TTLL3 "Tubulin monoglycylase T 0.801 0.416 0.338 1.2e-40
UNIPROTKB|D4AE66 829 D4AE66 "Uncharacterized protei 0.807 0.313 0.335 1.6e-40
UNIPROTKB|E2QXM3 752 E2QXM3 "Uncharacterized protei 0.801 0.343 0.342 2.2e-40
UNIPROTKB|F1PZ08 865 F1PZ08 "Uncharacterized protei 0.801 0.298 0.342 3.8e-40
MGI|MGI:1922902 832 Ttll8 "tubulin tyrosine ligase 0.807 0.312 0.332 4.3e-40
FB|FBgn0031854 TTLL3A "Tubulin tyrosine ligase-like 3A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 461 (167.3 bits), Expect = 1.1e-42, P = 1.1e-42
 Identities = 103/266 (38%), Positives = 153/266 (57%)

Query:    11 VVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCP---R 67
             +V+ ++ +  Q   DG  N+W++KP   C G GI +   ++++K+ +G + NL+     R
Sbjct:   398 LVDKMKVHWPQYSLDGYQNMWIVKPANKCRGRGIIL---MDNLKKILGVV-NLSIASKSR 453

Query:    68 CVVQKYIEKPLLIHGVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLDEARHL 127
              VVQKYIE+PL++   KFD+R W++ITN     +W Y E Y+RF S+ YS     E+ HL
Sbjct:   454 YVVQKYIERPLILFQTKFDIRQWFLITNTQPLVVWFYRESYLRFSSQEYSLSNHHESVHL 513

Query:   128 TNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKW-DMIMKAMEESIVTIMR 186
             TN  IQK+Y N +   +LP+E MWD    + Y  + +     W + I   M ++IV  M 
Sbjct:   514 TNYAIQKKYTNGKRDKRLPSENMWDCYSFQAYL-RQIGKYNMWLERIFPGMRKAIVGCML 572

Query:   187 CAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMV 246
              +Q  N +D R N+F+LFGADF+I EN+ P LIE+N+ P L  TTS+ A+   + L D+V
Sbjct:   573 ASQE-N-MDRRPNTFELFGADFMICENFYPWLIEINSSPDLGATTSVTARMCPQCLEDVV 630

Query:   247 KVVTAERNPLSSFQNSVDTGKFHLIY 272
             KVV   R          + G F L Y
Sbjct:   631 KVVIDRRT-----DPKAELGNFELAY 651
GO:0004835 "tubulin-tyrosine ligase activity" evidence=ISS
GO:0018094 "protein polyglycylation" evidence=IDA
ZFIN|ZDB-GENE-060616-182 ttll3 "tubulin tyrosine ligase-like family, member 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1J4 TTLL8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H3BLT7 TTLL3 "Tubulin monoglycylase TTLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JSD3 TTLL3 "Tubulin monoglycylase TTLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y5E3 TTLL3 "Tubulin monoglycylase TTLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4AE66 D4AE66 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXM3 E2QXM3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZ08 F1PZ08 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1922902 Ttll8 "tubulin tyrosine ligase-like family, member 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
pfam03133291 pfam03133, TTL, Tubulin-tyrosine ligase family 6e-54
>gnl|CDD|217380 pfam03133, TTL, Tubulin-tyrosine ligase family Back     alignment and domain information 
 Score =  177 bits (452), Expect = 6e-54
 Identities = 77/226 (34%), Positives = 118/226 (52%), Gaps = 13/226 (5%)

Query: 29  NVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLR 88
           N W++KP A+  G GIRI   L  I + I +         VVQKYIE+PLLI G KFD+R
Sbjct: 67  NTWIVKPSASARGRGIRITNDLSQILKQIQS------RPLVVQKYIERPLLIDGRKFDIR 120

Query: 89  VWYVITNIDKFKIWVYHEGYVRFCSKPYSNI---LLDEARHLTNVRIQKQYRNVRDPPQL 145
           ++ ++T+++  +++VY EG +RF S  YS     L D   HLTN  IQK+  ++ +    
Sbjct: 121 LYVLVTSVNPLRVYVYREGLLRFASVKYSPSVSDLDDVEMHLTNYSIQKKSSSLNEDYNE 180

Query: 146 PAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQ-SINYIDLRKNSFQLF 204
           P    W       Y  +  +    W  I   + ++I+      + S   +    N F+L+
Sbjct: 181 PNGHKWSLFNFWKY-LEEKDKEEIWLEIESIIIKTIL--AAEVEASRLNVQPLYNCFELY 237

Query: 205 GADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVT 250
           G DF+I EN +P L+EVN  P L  TT + A+   +L+ D++  V 
Sbjct: 238 GFDFMIDENLKPWLLEVNASPSLHSTTKLDARLKEQLIDDVLNSVV 283

Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyzes the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis. Bacterial homologs of TTL are predicted to form peptide tags. Some of these are fused to a 2-oxoglutarate Fe(II)-dependent dioxygenase domain. Length = 291

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 322
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 100.0
KOG2157|consensus497 100.0
KOG2156|consensus662 100.0
KOG2158|consensus565 99.97
KOG2155|consensus631 99.92
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 99.89
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 99.29
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 99.11
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 99.1
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 99.08
PRK10446300 ribosomal protein S6 modification protein; Provisi 99.08
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 99.06
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 99.04
PRK14571299 D-alanyl-alanine synthetase A; Provisional 99.04
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 99.03
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.01
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 98.98
PRK14569296 D-alanyl-alanine synthetase A; Provisional 98.96
PRK14570364 D-alanyl-alanine synthetase A; Provisional 98.95
PLN02941328 inositol-tetrakisphosphate 1-kinase 98.9
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 98.9
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 98.85
PRK14572347 D-alanyl-alanine synthetase A; Provisional 98.84
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 98.79
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 98.77
PRK05246316 glutathione synthetase; Provisional 98.69
PLN02257434 phosphoribosylamine--glycine ligase 98.66
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 98.58
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 98.56
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 98.54
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 98.5
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 98.48
PRK13790379 phosphoribosylamine--glycine ligase; Provisional 98.44
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 98.44
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 98.44
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 98.4
PRK06524493 biotin carboxylase-like protein; Validated 98.4
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 98.38
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 98.37
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 98.36
PRK12458338 glutathione synthetase; Provisional 98.35
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 98.35
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 98.34
PRK14016 727 cyanophycin synthetase; Provisional 98.33
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 98.3
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 98.29
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 98.28
PRK07206416 hypothetical protein; Provisional 98.28
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.26
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 98.23
PRK08462445 biotin carboxylase; Validated 98.21
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 98.21
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 98.19
PRK08463478 acetyl-CoA carboxylase subunit A; Validated 98.19
PRK02186 887 argininosuccinate lyase; Provisional 98.18
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 98.15
PRK06849389 hypothetical protein; Provisional 98.15
PRK05586447 biotin carboxylase; Validated 98.15
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 98.08
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 98.08
PRK07178472 pyruvate carboxylase subunit A; Validated 98.07
PRK08654499 pyruvate carboxylase subunit A; Validated 98.06
PRK12999 1146 pyruvate carboxylase; Reviewed 98.01
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 98.0
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 98.0
PRK052941066 carB carbamoyl phosphate synthase large subunit; R 97.99
PLN02948 577 phosphoribosylaminoimidazole carboxylase 97.99
TIGR013691050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 97.85
PRK128151068 carB carbamoyl phosphate synthase large subunit; R 97.78
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 97.75
PLN027351102 carbamoyl-phosphate synthase 97.75
PRK05784486 phosphoribosylamine--glycine ligase; Provisional 97.66
PLN02735 1102 carbamoyl-phosphate synthase 97.66
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 97.63
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 97.63
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 97.5
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 97.49
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 97.48
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 97.3
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 97.24
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 97.07
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 96.91
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 96.61
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 96.42
KOG0238|consensus 670 95.8
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 95.39
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 94.9
KOG0369|consensus 1176 94.8
COG2232389 Predicted ATP-dependent carboligase related to bio 94.73
COG0027394 PurT Formate-dependent phosphoribosylglycinamide f 93.75
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 93.72
COG0458400 CarB Carbamoylphosphate synthase large subunit (sp 93.69
KOG2158|consensus 565 88.83
TIGR02049403 gshA_ferroox glutamate--cysteine ligase, T. ferroo 88.7
PF08886404 GshA: Glutamate-cysteine ligase; InterPro: IPR0117 87.68
COG2308488 Uncharacterized conserved protein [Function unknow 86.01
PHA02117397 glutathionylspermidine synthase domain-containing 84.48
PF07065299 D123: D123; InterPro: IPR009772 This family contai 84.1
PF04174 330 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In 82.93
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information 
Probab=100.00  E-value=1.4e-55  Score=412.50  Aligned_cols=244  Identities=33%  Similarity=0.639  Sum_probs=133.2

Q ss_pred             HHHHHHHHHHHHHHhhhhhhhcCCcceEEEeCCCCCCCCCeEEeCChhHHHHHHhhCCCCCCCceeEeeccccccccCCc
Q psy10924          4 VFARAKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGV   83 (322)
Q Consensus         4 ~~~~~~~~l~~~~~~~pq~~~~~~~~~WIvKP~~~s~G~GI~~~~~~~~i~~~~~~~~~~~~~~~IvQkYI~~PlLi~gr   83 (322)
                      |+.+...+..+..++ .++......++||+||+++++|+||+++++++++.++...    ....|||||||+||+|++||
T Consensus        42 ~~p~t~~l~~~~~~~-~~~~~~~~~~~wI~KP~~~~rG~GI~l~~~~~~i~~~~~~----~~~~~vvQkYI~~PlLi~gr  116 (292)
T PF03133_consen   42 FYPETFILPQDYKEF-LKYFEKNPKNLWIVKPSNGSRGRGIKLFNNLEQILRFSKN----KNQPYVVQKYIENPLLIDGR  116 (292)
T ss_dssp             -------HHHHHHHH-HHHHHTTS---EEEEES-------EEEES-HHHHHCCHCC----TTS-EEEEE--SSB--BTTB
T ss_pred             CCcceEecHHHHHHH-HHHHhcCCCCEEEEeccccCCCCCceecCCHHHHHHHhhh----hhhhhhhhhccCCCeEEeee
Confidence            455555555554444 3344555558999999999999999999999998864211    16789999999999999999


Q ss_pred             eeeEEEEEEEeeecCcEEEEecceEEEecCCCCC--CCcc-cccccchhhhhhhhcccCCCCCCCCCCCccchHHHHHHH
Q psy10924         84 KFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYS--NILL-DEARHLTNVRIQKQYRNVRDPPQLPAELMWDFKQLRDYF  160 (322)
Q Consensus        84 KFDiR~yvlvts~~pl~vy~y~~g~vR~s~~~y~--~~~~-d~~~HLTN~~iqk~~~~~~~~~~~~~~~~ws~~~~~~~L  160 (322)
                      |||||+||||||++|+++|+|++||+|+|+.+|+  ..+. +.++||||+++|+..+....+.....+++|++..|..++
T Consensus       117 KFDlR~yvlvts~~pl~vy~y~~g~vR~~~~~Y~~~~~~~~~~~~HlTN~~i~k~~~~~~~~~~~~~~~~~~~~~~~~~l  196 (292)
T PF03133_consen  117 KFDLRVYVLVTSLNPLRVYLYKEGYVRFASEPYDPDLDDLSDRFAHLTNYSIQKKSESNEEDSNEENGNKWSLDQFEEYL  196 (292)
T ss_dssp             -EEEEEEEEE-T--T--EEEES--EEEE-SS------------------------------------EEEHHHHHHHCTT
T ss_pred             eEEEEEEEEEeeccceeeeeccCceEEeccceeeccccccccccccccccccccccccccccccccccccchhhhhhhhc
Confidence            9999999999999999999999999999999999  4554 579999999999995522233445578899999999888


Q ss_pred             HHhcCChhhHHHHHHHHHHHHHHH-HHHhccccccccCCCceeEEeeeEEeecCCceEEEEecCCCCCCCCChhHHHHHH
Q psy10924        161 TKNMNLPRKWDMIMKAMEESIVTI-MRCAQSINYIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTT  239 (322)
Q Consensus       161 ~~~~g~~~~~~~i~~~i~~~i~~~-l~a~~~~~~~~~~~~~Fel~G~DfllD~~~kpwLIEVN~~P~l~~~~~~~~~l~~  239 (322)
                      ......+..|.++.+.+.+.+..+ ..++..  .+..+.+|||+||+|||||++++|||||||++|++..+++.+..+++
T Consensus       197 ~~~~~~~~~~~~i~~~i~~~~~~~~~~~~~~--~~~~~~~~Fel~G~DfmlD~~~kpwLLEvN~~Psl~~~~~~~~~~~~  274 (292)
T PF03133_consen  197 KEGIDWEKIWEKICDIIIKTILAAEFRSSQP--NMPPRPNCFELFGFDFMLDEDLKPWLLEVNSNPSLSTSTPVDKELKP  274 (292)
T ss_dssp             TSSS-STTTCHHHHHHHHHHHHHH-HHHHH----TTSSSEE-EEEEEEEEEBTTS-EEEEEEESS------TTTHHHHHH
T ss_pred             ccCCCcccchhhhhHHHHHHhhhhhhhhccc--cccccccccceeeeEEEecCCCeEEEeeCCCCCCcccCCHhHHHHHH
Confidence            762222344555544444444444 344444  67788999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhchhcCCC
Q psy10924        240 ELLTDMVKVVTAERN  254 (322)
Q Consensus       240 ~li~d~l~lv~d~~~  254 (322)
                      +|++|+|++++++..
T Consensus       275 ~li~d~l~i~v~~~~  289 (292)
T PF03133_consen  275 QLIDDLLKIVVDPDK  289 (292)
T ss_dssp             HHHHHTTTTTS----
T ss_pred             HHHHHHhEEEeCCCC
Confidence            999999999887653

This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL) []. Tubulin-tyrosine ligase (TTL) catalyses the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. The true physiological function of TTL has so far not been established. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness []. 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis [].; GO: 0004835 tubulin-tyrosine ligase activity, 0006464 protein modification process; PDB: 3TII_A 3TIN_A 3TIG_A.
>KOG2157|consensus Back     alignment and domain information
>KOG2156|consensus Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>KOG2155|consensus Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>TIGR02049 gshA_ferroox glutamate--cysteine ligase, T Back     alignment and domain information
>PF08886 GshA: Glutamate-cysteine ligase; InterPro: IPR011718 This entry represents a rare family of glutamate--cysteine ligases, demonstrated first in Thiobacillus ferrooxidans and present in a few other Proteobacteria [] Back     alignment and domain information
>COG2308 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02117 glutathionylspermidine synthase domain-containing protein Back     alignment and domain information
>PF07065 D123: D123; InterPro: IPR009772 This family contains a number of eukaryotic D123 proteins approximately 330 residues long Back     alignment and domain information
>PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
4i4t_F384 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 3e-20
3tig_A380 Tubulin Tyrosine Ligase Length = 380 1e-19
>pdb|4I4T|F Chain F, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 384 Back     alignment and structure 
Iteration: 1

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 120/243 (49%), Gaps = 25/243 (10%)
Query: 29  NVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGV--KFD 86
           NVW+ K  A   G GI I  +  ++   I     +     V+QKY+EKPLL+     KFD
Sbjct: 145 NVWIAKSSAGAKGEGILISSEASELLDFIDEQGQVH----VIQKYLEKPLLLEPGHRKFD 200
Query: 87  LRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNI-LLDEARHLTNVRIQKQYRNVRDPPQL 145
           +R W ++ ++  + I++Y EG +R  S+PY++    D+  HLTN  IQK+Y       + 
Sbjct: 201 IRSWVLVDHL--YNIYLYREGVLRTSSEPYNSANFQDKTCHLTNHCIQKEYSKNYGRYEE 258
Query: 146 PAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQ-SINYIDLRKNSFQLF 204
             E+   F++   Y    +N   + + I+  ++  I + + C + +I+   L   SFQLF
Sbjct: 259 GNEMF--FEEFNQYLMDALNTTLE-NSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLF 315
Query: 205 GADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVVTAERNPLSSFQNSVD 264
           G DF++ E  +  LIEVN  P  +       K   EL   +V V  +   PL+      D
Sbjct: 316 GFDFMVDEELKVWLIEVNGAPACA------QKLYAELCQGIVDVAISSVFPLA------D 363
Query: 265 TGK 267
           TG+
Sbjct: 364 TGQ 366
>pdb|3TIG|A Chain A, Tubulin Tyrosine Ligase Length = 380 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 4e-52
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Length = 380 Back     alignment and structure
 Score =  175 bits (444), Expect = 4e-52
 Identities = 66/237 (27%), Positives = 112/237 (47%), Gaps = 15/237 (6%)

Query: 17  EYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEK 76
               ++  +   NVW+ K  +   G GI I     ++   I           V+QKY+E 
Sbjct: 136 SSFNKKKENEEGNVWIAKSSSGAKGEGILISSDATELLDFIDNQGQ----VHVIQKYLES 191

Query: 77  PLLIH--GVKFDLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNI-LLDEARHLTNVRIQ 133
           PLL+     KFD+R W ++ N  ++ I++Y EG +R  S+PYS+    D   HLTN  IQ
Sbjct: 192 PLLLEPGHRKFDIRSWVLVDN--QYNIYLYREGVLRTSSEPYSDTNFQDMTSHLTNHCIQ 249

Query: 134 KQYRNVRDPPQLPAELMWDFKQLRDYFTKNMNLPRKWDMIMKAMEESIVTIMRCAQS-IN 192
           K++    +  +        F++   Y   ++N     + I+  ++E I   + C +  I+
Sbjct: 250 KEHSK--NYGRYEEGNEMFFEEFNQYLVTSLN-INLENSILCQIKEIIRVCLSCLEPAIS 306

Query: 193 YIDLRKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTTELLTDMVKVV 249
              L  +SFQLFG DF++ +N +  LIEVN  P  +    + A+    ++   +  V
Sbjct: 307 TKYLPYHSFQLFGFDFMVDKNLKVWLIEVNGAPACA--QKLYAELCKGIVDLAISSV 361
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 100.0
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 99.18
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 99.13
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 99.12
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 99.09
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 99.06
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 99.06
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 99.05
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 99.03
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 99.02
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 98.99
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 98.98
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 98.97
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 98.94
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 98.94
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 98.91
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 98.88
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 98.86
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 98.86
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 98.83
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 98.8
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 98.74
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 98.73
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 98.69
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 98.68
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 98.68
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 98.63
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 98.59
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 98.58
3ouz_A446 Biotin carboxylase; structural genomics, center fo 98.53
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 98.52
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 98.48
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 98.46
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide r 98.45
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 98.45
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 98.45
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 98.45
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 98.44
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 98.43
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syn 98.43
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 98.42
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide 98.41
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 98.41
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, struc 98.4
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 98.38
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 98.37
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 98.37
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 98.34
2qk4_A452 Trifunctional purine biosynthetic protein adenosi; 98.3
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 98.29
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 98.26
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 98.24
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 98.22
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 98.2
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 98.19
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 98.18
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 98.16
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 97.96
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 97.95
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 97.94
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 97.92
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 97.87
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 97.82
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 97.69
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 97.65
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 97.65
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 97.6
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 97.03
3n6x_A474 Putative glutathionylspermidine synthase; domain o 96.85
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 96.41
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 90.46
2vob_A652 Trypanothione synthetase; ligase; 2.3A {Leishmania 89.85
3k1t_A432 Glutamate--cysteine ligase GSHA; putative gamma-gl 87.92
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-54  Score=410.19  Aligned_cols=229  Identities=31%  Similarity=0.520  Sum_probs=166.7

Q ss_pred             HHHHHHHHHHhhhhhhhcCCcceEEEeCCCCCCCCCeEEeCChhHHHHHHhhCCCCCCCceeEeecccccccc--CCcee
Q psy10924          8 AKHVVESVEEYNKQEMYDGTHNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLI--HGVKF   85 (322)
Q Consensus         8 ~~~~l~~~~~~~pq~~~~~~~~~WIvKP~~~s~G~GI~~~~~~~~i~~~~~~~~~~~~~~~IvQkYI~~PlLi--~grKF   85 (322)
                      +.++++++.+    ...+|.+++||+||+++|+|+||.++++++++.+++...    ...+|||+||++|+|+  +||||
T Consensus       131 ~~~F~~~~~~----~~~~~~~~~wI~KP~~~srG~GI~l~~~~~~i~~~~~~~----~~~~VvQkYI~~PlLi~~~grKF  202 (380)
T 3tig_A          131 REEFRSSFNK----KKENEEGNVWIAKSSSGAKGEGILISSDATELLDFIDNQ----GQVHVIQKYLESPLLLEPGHRKF  202 (380)
T ss_dssp             CHHHHHHHHH----HHHTTCCCCEEEEESCC----CCBCCSCSHHHHHHHHHH----TSCEEEEECCSSBCCBTTTTBCE
T ss_pred             HHHHHHHHHH----hhhcCCCCeEEEeCCccCCCCCEEEeCCHHHHHHHHhcc----CCcEEEEecccCceeecCCCcee
Confidence            3445555443    345689999999999999999999999999999887643    4689999999999999  99999


Q ss_pred             eEEEEEEEeeecCcEEEEecceEEEecCCCCCCCccc-ccccchhhhhhhhc-ccCCCCCCCCCCCccchHHHHHHHHHh
Q psy10924         86 DLRVWYVITNIDKFKIWVYHEGYVRFCSKPYSNILLD-EARHLTNVRIQKQY-RNVRDPPQLPAELMWDFKQLRDYFTKN  163 (322)
Q Consensus        86 DiR~yvlvts~~pl~vy~y~~g~vR~s~~~y~~~~~d-~~~HLTN~~iqk~~-~~~~~~~~~~~~~~ws~~~~~~~L~~~  163 (322)
                      |||+||||||  |+++|+|++|++|||+.+|++.+++ .++||||+|+||++ +++.   ..+.+++|++++|..||.+.
T Consensus       203 DlR~Yvlvts--~l~vy~y~~g~~Rfa~~~y~~~~~~~~~~HLTN~~iqk~~~~~y~---~~~~g~~~~~~~f~~yL~~~  277 (380)
T 3tig_A          203 DIRSWVLVDN--QYNIYLYREGVLRTSSEPYSDTNFQDMTSHLTNHCIQKEHSKNYG---RYEEGNEMFFEEFNQYLVTS  277 (380)
T ss_dssp             EEEEEEEECT--TCCEEECSCCEEEECC-------------------------------------CCBCHHHHHHHHSTT
T ss_pred             EEEEEEEEcC--CCEEEEEcCCEEEecCCCcCccchhhhhhhccccccccccccccc---cccCCCcCcHHHHHHHHHHh
Confidence            9999999997  9999999999999999999999885 69999999999974 4453   22368899999999999874


Q ss_pred             cCChhhH-HHHHHHHHHHHHHHHHHhcccccccc---CCCceeEEeeeEEeecCCceEEEEecCCCCCCCCChhHHHHHH
Q psy10924        164 MNLPRKW-DMIMKAMEESIVTIMRCAQSINYIDL---RKNSFQLFGADFLIHENYQPCLIEVNNGPGLSPTTSIIAKKTT  239 (322)
Q Consensus       164 ~g~~~~~-~~i~~~i~~~i~~~l~a~~~~~~~~~---~~~~Fel~G~DfllD~~~kpwLIEVN~~P~l~~~~~~~~~l~~  239 (322)
                      .|.  .| +.|+++|+++++.++.|+++  .+..   +.+|||+||+|||||++++|||||||++|++..      .+.+
T Consensus       278 ~~~--~~~~~i~~~I~~ii~~~l~a~~~--~i~~~~~~~~~FEl~G~D~lid~~l~~wllEVN~~P~~~q------~~i~  347 (380)
T 3tig_A          278 LNI--NLENSILCQIKEIIRVCLSCLEP--AISTKYLPYHSFQLFGFDFMVDKNLKVWLIEVNGAPACAQ------KLYA  347 (380)
T ss_dssp             SSC--CHHHHTHHHHHHHHHHHHHHHHH--HHCCTTSSSEECEEEEEEEEEBTTCCEEEEEEESSCCCCT------TTHH
T ss_pred             cCc--cHHHHHHHHHHHHHHHHHHHHHH--HhhhcccCCceEEEEeEEEEEcCCCcEEEEEEeCCCCccH------HhHH
Confidence            443  34 46799999999999999887  4433   468999999999999999999999999999975      3889


Q ss_pred             HHHHHHhhchhcCCCCCCCC
Q psy10924        240 ELLTDMVKVVTAERNPLSSF  259 (322)
Q Consensus       240 ~li~d~l~lv~d~~~p~~~~  259 (322)
                      +|+++++++++|+.+|++..
T Consensus       348 ~l~~~~~~iavdp~f~~~~~  367 (380)
T 3tig_A          348 ELCKGIVDLAISSVFPLNEE  367 (380)
T ss_dssp             HHHHHHHHHTTTTTSCCCC-
T ss_pred             HHHHHHHHHhcccccCCccc
Confidence            99999999999999976544
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure
>2vob_A Trypanothione synthetase; ligase; 2.3A {Leishmania major} PDB: 2vps_A 2vpm_A Back     alignment and structure
>3k1t_A Glutamate--cysteine ligase GSHA; putative gamma-glutamylcysteine synthetase; HET: MSE; 1.90A {Methylobacillus flagellatus KT} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 99.25
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 99.21
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 99.18
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 99.02
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 98.84
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 98.81
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 98.76
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 98.66
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 98.63
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 98.62
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 98.48
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 98.2
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 97.93
d1a9xa6259 Carbamoyl phosphate synthetase (CPS), large subuni 97.8
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 97.67
d1a9xa5275 Carbamoyl phosphate synthetase (CPS), large subuni 97.3
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 96.78
d2io8a3297 Glutathionylspermidine synthase, synthetase domain 82.8
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: Synapsin C-terminal domain
domain: Synapsin II
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.25  E-value=7.8e-12  Score=107.70  Aligned_cols=57  Identities=19%  Similarity=0.175  Sum_probs=45.1

Q ss_pred             cceEEEeCCCCCCCCCeEEeCChhHHHHHHhhCCCCCCCceeEeeccccccccCCceeeEEEEEE
Q psy10924         28 HNVWVLKPVANCSGHGIRIYRQLEDIKRAIGTLKNLTCPRCVVQKYIEKPLLIHGVKFDLRVWYV   92 (322)
Q Consensus        28 ~~~WIvKP~~~s~G~GI~~~~~~~~i~~~~~~~~~~~~~~~IvQkYI~~PlLi~grKFDiR~yvl   92 (322)
                      ....|+||..|+.|+||.++++.+++...+...... ...+++|+||+.       ++|+|+.++
T Consensus        50 ~~PvVvKP~~g~~g~Gv~~v~~~~~l~~~~~~~~~~-~~~~~vqe~I~~-------~~dirv~vi  106 (206)
T d1i7na2          50 TFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALT-QTYATAEPFIDA-------KYDIRVQKI  106 (206)
T ss_dssp             CSSEEEEESSCSTTTTEEEECSHHHHHHHHHHHHHH-TCCEEEEECCCE-------EEEEEEEEE
T ss_pred             CCceEEecCCCCCCCCeEEEeecchhhhHHHHHhhc-cCeEEEEEeecc-------cceEEEEEE
Confidence            457899999999999999999998877655431111 467999999973       479999987
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2io8a3 d.142.1.8 (A:201-378,A:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure