Psyllid ID: psy10927
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 858 | ||||||
| 91077138 | 403 | PREDICTED: similar to DnaJ homolog subfa | 0.461 | 0.982 | 0.637 | 1e-148 | |
| 187105120 | 402 | DnaJ-like [Acyrthosiphon pisum] gi|89574 | 0.461 | 0.985 | 0.638 | 1e-148 | |
| 383847138 | 400 | PREDICTED: dnaJ homolog subfamily A memb | 0.463 | 0.995 | 0.605 | 1e-144 | |
| 114053203 | 401 | DnaJ (Hsp40) homolog 2 [Bombyx mori] gi| | 0.465 | 0.995 | 0.633 | 1e-141 | |
| 170033856 | 403 | DNAJ chaperone [Culex quinquefasciatus] | 0.466 | 0.992 | 0.597 | 1e-141 | |
| 291228607 | 398 | PREDICTED: DnaJ (Hsp40) homolog, subfami | 0.455 | 0.982 | 0.594 | 1e-141 | |
| 307195605 | 397 | DnaJ-like protein subfamily A member 1 [ | 0.462 | 1.0 | 0.604 | 1e-140 | |
| 350425734 | 398 | PREDICTED: dnaJ homolog subfamily A memb | 0.463 | 1.0 | 0.599 | 1e-140 | |
| 340712982 | 398 | PREDICTED: dnaJ homolog subfamily A memb | 0.463 | 1.0 | 0.599 | 1e-140 | |
| 94468856 | 402 | DNAJ chaperone [Aedes aegypti] | 0.465 | 0.992 | 0.590 | 1e-139 |
| >gi|91077138|ref|XP_971446.1| PREDICTED: similar to DnaJ homolog subfamily A member 1 [Tribolium castaneum] gi|270001716|gb|EEZ98163.1| hypothetical protein TcasGA2_TC000590 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 533 bits (1374), Expect = e-148, Method: Compositional matrix adjust.
Identities = 283/444 (63%), Positives = 334/444 (75%), Gaps = 48/444 (10%)
Query: 422 MVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEK 481
MVKET FYDILGVKP CTQD+LKKAYRKLALKYHPDKNPNEGEKFKQIS AYEVLS+PEK
Sbjct: 1 MVKETKFYDILGVKPGCTQDDLKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDPEK 60
Query: 482 RELYDQGGYQGGRLWGRRRRLLLPNGYIRDVHGWQFGGRSAAKGEAIKEGGSGGGGGGFS 541
+ +YDQGG Q A+KEGG GGFS
Sbjct: 61 KRIYDQGGEQ-----------------------------------ALKEGGV---SGGFS 82
Query: 542 SPMDIFEM--FMGGSLGGGRRRRERKGKDVVHQLTVSLEDLYRGTVKKLQLEKNVICDKC 599
SPMD+F+M GG GG RRRERKGKDV+HQL VSLE+LY+GTV+KL L+KNVICDKC
Sbjct: 83 SPMDLFDMFFGGGGFGGGRGRRRERKGKDVIHQLNVSLEELYKGTVRKLALQKNVICDKC 142
Query: 600 EGRGGKKGAAESCPGCRGTGMTVTVQQFGPGMIQQIQTVCSECRGQGSRINPKDRCKTCN 659
EGRGGKKGA E+CP CRG+GM V +QQ GPGMIQQIQ++CS+CRGQG RINPKDRCK C
Sbjct: 143 EGRGGKKGAVETCPTCRGSGMQVQIQQLGPGMIQQIQSMCSDCRGQGQRINPKDRCKQCQ 202
Query: 660 GKKTVRDRKILEVHIDKGMIDQQKIVFNGEGDQEPGLEHGDIIIVLEEKPHPVFKRSGNN 719
GKK R+RKILEVH+DKGM+D QKIVFNGEGDQEP LE GDIIIVLEEK HPVF+RSG +
Sbjct: 203 GKKVTRERKILEVHVDKGMVDGQKIVFNGEGDQEPELEPGDIIIVLEEKEHPVFRRSGLD 262
Query: 720 LIIRPYEIALVEALCGFRRPIKTLDDRDIIISAAPGEVMKHSDIKMVVGEGMPTYKDPFE 779
LIIR E+ LVE+LCGF++ I+TLDDRD++I++ PGEV KH D+K ++ EGMP YK+PFE
Sbjct: 263 LIIR-LELQLVESLCGFQKVIRTLDDRDLVITSLPGEVTKHGDVKCIMNEGMPQYKNPFE 321
Query: 780 KGNLIIVFSVKFPDVIPVDKVPAIEACLPPRPKVTIPENGEEVVLETMDPEKE---RAQN 836
KG LI+ F V+FPD +P + +PA+E LPPRP++ IP+ EE +L D +K+ R QN
Sbjct: 322 KGRLIVQFLVQFPDKLPPEVIPALENALPPRPEIMIPDQAEECILLPFDVDKQDSRRRQN 381
Query: 837 AYRQAHQEDED-QGP-SRVQCATN 858
R + ED++ GP RVQCA N
Sbjct: 382 --RNVYDEDDEMHGPGQRVQCAAN 403
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|187105120|ref|NP_001119620.1| DnaJ-like [Acyrthosiphon pisum] gi|89574485|gb|ABD76373.1| DnaJ-lik protein [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383847138|ref|XP_003699212.1| PREDICTED: dnaJ homolog subfamily A member 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|114053203|ref|NP_001040292.1| DnaJ (Hsp40) homolog 2 [Bombyx mori] gi|87248655|gb|ABD36380.1| DnaJ homolog subfamily A member 1 [Bombyx mori] gi|253721945|gb|ACT34036.1| DnaJ-2 [Bombyx mori] gi|378465711|gb|AFC01216.1| DnaJ-2 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|170033856|ref|XP_001844792.1| DNAJ chaperone [Culex quinquefasciatus] gi|167874869|gb|EDS38252.1| DNAJ chaperone [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|291228607|ref|XP_002734268.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily A, member 1-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|307195605|gb|EFN77455.1| DnaJ-like protein subfamily A member 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350425734|ref|XP_003494215.1| PREDICTED: dnaJ homolog subfamily A member 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340712982|ref|XP_003395031.1| PREDICTED: dnaJ homolog subfamily A member 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|94468856|gb|ABF18277.1| DNAJ chaperone [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 858 | ||||||
| UNIPROTKB|Q5E954 | 397 | DNAJA1 "DnaJ homolog subfamily | 0.363 | 0.785 | 0.566 | 5.9e-118 | |
| UNIPROTKB|E2RM09 | 397 | LOC474739 "Uncharacterized pro | 0.363 | 0.785 | 0.562 | 1.6e-117 | |
| UNIPROTKB|P31689 | 397 | DNAJA1 "DnaJ homolog subfamily | 0.363 | 0.785 | 0.562 | 1.6e-117 | |
| UNIPROTKB|F1SE73 | 397 | DNAJA1 "Uncharacterized protei | 0.363 | 0.785 | 0.562 | 1.6e-117 | |
| MGI|MGI:1270129 | 397 | Dnaja1 "DnaJ (Hsp40) homolog, | 0.363 | 0.785 | 0.562 | 3.3e-117 | |
| RGD|620942 | 397 | Dnaja1 "DnaJ (Hsp40) homolog, | 0.363 | 0.785 | 0.562 | 3.3e-117 | |
| RGD|1310035 | 555 | Dnaja4 "DnaJ (Hsp40) homolog, | 0.377 | 0.583 | 0.549 | 1.5e-116 | |
| UNIPROTKB|Q864B5 | 397 | DNAJA4 "PDJA1 chaperone" [Sus | 0.377 | 0.816 | 0.546 | 8.7e-115 | |
| UNIPROTKB|F1NLH8 | 402 | DNAJA4 "Uncharacterized protei | 0.379 | 0.810 | 0.550 | 2.9e-114 | |
| UNIPROTKB|F1PP91 | 399 | DNAJA4 "Uncharacterized protei | 0.377 | 0.812 | 0.544 | 6.1e-114 |
| UNIPROTKB|Q5E954 DNAJA1 "DnaJ homolog subfamily A member 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 943 (337.0 bits), Expect = 5.9e-118, Sum P(2) = 5.9e-118
Identities = 180/318 (56%), Positives = 229/318 (72%)
Query: 543 PMDIFEMFMXXXXXXXXXXXXXXXKDVVHQLTVSLEDLYRGTVKKLQLEKNVICDKCEGR 602
PMDIF+MF K+VVHQLTV+LEDLY G +KL L+KNVICDKCEGR
Sbjct: 84 PMDIFDMFFGGGGRMQRERRG---KNVVHQLTVTLEDLYNGATRKLALQKNVICDKCEGR 140
Query: 603 GGKKGAAESCPGCRGTGMTVTVQQFGPGMIQQIQTVCSECRGQGSRINPKDRCKTCNGKK 662
GGKKGA E CP CRGTGM + + Q GPGM+QQIQ+VC EC+G G RI+PKDRCK+CNG+K
Sbjct: 141 GGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRK 200
Query: 663 TVRDRKILEVHIDKGMIDQQKIVFNGEGDQEPGLEHGDIIIVLEEKPHPVFKRSGNNLII 722
VR++KILEVHIDKGM D QKI F+GEGDQEPGLE GDIIIVL++K H VF R G +L +
Sbjct: 201 IVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFM 260
Query: 723 RPYEIALVEALCGFRRPIKTLDDRDIIISAAPGEVMKHSDIKMVVGEGMPTYKDPFEKGN 782
+I LVEALCGF++PI TLD+R I+I++ PG+++KH DIK V+ EGMP Y+ P+EKG
Sbjct: 261 C-MDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGR 319
Query: 783 LIIVFSVKFPD--VIPVDKVPAIEACLPPRPKVTIPENGEEVVLETMDPEKERAQNAYRQ 840
LII F V FP+ + DK+ +E LP R +V + ++V L DP +ER ++ +
Sbjct: 320 LIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGE 379
Query: 841 AHQEDEDQGPSRVQCATN 858
A+++DE VQC T+
Sbjct: 380 AYEDDEHHPRGGVQCQTS 397
|
|
| UNIPROTKB|E2RM09 LOC474739 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31689 DNAJA1 "DnaJ homolog subfamily A member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SE73 DNAJA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1270129 Dnaja1 "DnaJ (Hsp40) homolog, subfamily A, member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620942 Dnaja1 "DnaJ (Hsp40) homolog, subfamily A, member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1310035 Dnaja4 "DnaJ (Hsp40) homolog, subfamily A, member 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q864B5 DNAJA4 "PDJA1 chaperone" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLH8 DNAJA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PP91 DNAJA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 858 | |||
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 1e-119 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 5e-95 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 6e-86 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 5e-66 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 6e-63 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-60 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 4e-60 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 3e-59 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 8e-59 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 3e-58 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 2e-55 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 3e-55 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 8e-53 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 1e-52 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 3e-50 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 3e-49 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 5e-49 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-48 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 4e-48 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 8e-48 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-47 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 6e-47 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 6e-47 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 9e-47 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-45 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 4e-42 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 1e-41 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 4e-37 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 5e-36 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 2e-34 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-33 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 8e-32 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 3e-31 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 7e-29 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 8e-26 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 9e-25 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 5e-24 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 3e-23 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 2e-22 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 4e-20 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 5e-20 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 2e-18 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 6e-18 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 8e-18 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 7e-17 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 7e-17 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 2e-16 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 3e-16 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 3e-16 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 4e-16 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 8e-16 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 1e-15 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 2e-15 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-15 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 3e-15 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 4e-15 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 6e-15 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 7e-15 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 4e-14 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 4e-14 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 9e-14 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 1e-13 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 2e-13 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-13 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 4e-13 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 1e-12 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 3e-12 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 5e-12 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 1e-11 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 3e-11 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 5e-11 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 6e-11 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 6e-11 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 6e-11 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 8e-11 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 9e-11 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 9e-11 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 1e-10 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 5e-10 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-10 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 8e-10 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-09 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-09 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 2e-09 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 3e-09 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 4e-09 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 5e-08 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 5e-08 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 5e-08 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 5e-08 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 8e-08 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 9e-08 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 2e-07 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-07 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 2e-07 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 6e-07 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 6e-07 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 7e-07 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 9e-07 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 1e-06 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 2e-06 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-06 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 6e-06 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 6e-06 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-05 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-05 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 2e-05 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 2e-05 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 3e-05 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 4e-05 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 4e-05 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-04 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 3e-04 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 5e-04 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 5e-04 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 6e-04 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 8e-04 | |
| PHA03102 | 153 | PHA03102, PHA03102, Small T antigen; Reviewed | 0.001 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 0.002 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 0.002 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 0.002 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 0.002 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 0.002 | |
| PRK01356 | 166 | PRK01356, hscB, co-chaperone HscB; Provisional | 0.002 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 0.003 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 0.003 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 0.003 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 0.003 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 0.003 | |
| PHA02624 | 647 | PHA02624, PHA02624, large T antigen; Provisional | 0.004 |
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
Score = 367 bits (943), Expect = e-119
Identities = 175/448 (39%), Positives = 244/448 (54%), Gaps = 55/448 (12%)
Query: 417 AKRPNMVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVL 476
+R V Y++L + +CT E+KKAYRKLA+K+HPDK + EKFK+IS AYEVL
Sbjct: 19 GRRKREVDNEKLYEVLNLSKDCTTSEIKKAYRKLAIKHHPDKG-GDPEKFKEISRAYEVL 77
Query: 477 SNPEKRELYDQGGYQGGRLWGRRRRLLLPNGYIRDVHGWQFGGRSAAKGEAIKEGGSGGG 536
S+PEKR++YD+ G +EG GG
Sbjct: 78 SDPEKRKIYDEYG---------------------------------------EEGLEGGE 98
Query: 537 GGGFSSPMDIFEMFMGGSLGGGRRRRERKGKDVVHQLTVSLEDLYRGTVKKLQLEKNVIC 596
D+F++ GG G ++R G+D+V L V+LE +Y G ++KL + K+VIC
Sbjct: 99 QPA--DASDLFDLIFGGGRKPGGKKR---GEDIVSHLKVTLEQIYNGAMRKLAINKDVIC 153
Query: 597 DKCEGRGGKKGAAESCPGCRGTGMTVTVQQFGPGMIQQIQTVCSECRGQGSRINPKDRCK 656
CEG GG K A C C G G+ V ++Q G MI Q Q+ C+ C GQG I +CK
Sbjct: 154 ANCEGHGGPKDAFVDCKLCNGQGIRVQIRQMGS-MIHQTQSTCNSCNGQGKIIPESKKCK 212
Query: 657 TCNGKKTVRDRKILEVHIDKGMIDQQKIVFNGEGDQEPGLEHGDIIIVLEEKPHPVFKRS 716
C+GK + RKILEV+IDKG+ +Q KI F+GE D++P G+++ +L EKPH FKR
Sbjct: 213 NCSGKGVKKTRKILEVNIDKGVPNQHKITFHGEADEKPNEIPGNVVFILNEKPHDTFKRE 272
Query: 717 GNNLIIRPYEIALVEALCGFRRPIKTLDDRDIIISAAPGEVMKHSDIKMVVGEGMPTYKD 776
G +L I +I+L EAL GF I LD R ++++ PGEV+K DIK++ EGMPTYK
Sbjct: 273 GGDLFIT-KKISLYEALTGFVFYITHLDGRKLLVNTPPGEVVKPGDIKVINNEGMPTYKS 331
Query: 777 PFEKGNLIIVFSVKFP--DVIPVDKVPAIEACLPPRPKVTIPENG---EEVVLETMDPE- 830
PF+KGNL + F V FP ++ +++ P P+ E V + +DPE
Sbjct: 332 PFKKGNLYVTFEVIFPVDRKFTNEEKEILKSLFPQNPEEKKDLEDTEIEVVTAQNVDPEE 391
Query: 831 -KERAQNAYRQAHQEDEDQGPS-RVQCA 856
K+R Q Q ++DE RV C
Sbjct: 392 VKDRDQKQQYQEDEDDEHHQEGERVACR 419
|
Length = 421 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 858 | |||
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712|consensus | 337 | 100.0 | ||
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712|consensus | 337 | 100.0 | ||
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0713|consensus | 336 | 100.0 | ||
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| KOG0715|consensus | 288 | 100.0 | ||
| KOG0713|consensus | 336 | 99.96 | ||
| KOG0715|consensus | 288 | 99.9 | ||
| KOG0714|consensus | 306 | 99.83 | ||
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.79 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.75 | |
| KOG0714|consensus | 306 | 99.69 | ||
| KOG0716|consensus | 279 | 99.64 | ||
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.62 | |
| KOG0691|consensus | 296 | 99.57 | ||
| KOG0718|consensus | 546 | 99.55 | ||
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.54 | |
| KOG0716|consensus | 279 | 99.54 | ||
| KOG0719|consensus | 264 | 99.49 | ||
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.49 | |
| KOG0721|consensus | 230 | 99.48 | ||
| KOG0717|consensus | 508 | 99.48 | ||
| KOG0718|consensus | 546 | 99.46 | ||
| KOG0691|consensus | 296 | 99.45 | ||
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.43 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 99.42 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.42 | |
| KOG0624|consensus | 504 | 99.41 | ||
| KOG0717|consensus | 508 | 99.39 | ||
| PHA03102 | 153 | Small T antigen; Reviewed | 99.39 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.37 | |
| KOG0719|consensus | 264 | 99.33 | ||
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.32 | |
| KOG0624|consensus | 504 | 99.32 | ||
| KOG0721|consensus | 230 | 99.32 | ||
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.32 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.29 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.28 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.27 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.24 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.12 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.1 | |
| KOG0722|consensus | 329 | 99.08 | ||
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.07 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.07 | |
| KOG0550|consensus | 486 | 99.05 | ||
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.04 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.04 | |
| KOG0550|consensus | 486 | 99.03 | ||
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 98.98 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 98.95 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 98.95 | |
| KOG0722|consensus | 329 | 98.9 | ||
| KOG0720|consensus | 490 | 98.86 | ||
| KOG0720|consensus | 490 | 98.84 | ||
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 98.84 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 98.82 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.81 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.81 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.7 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 98.64 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.63 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 98.63 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.5 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.44 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.39 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.34 | |
| KOG1150|consensus | 250 | 98.16 | ||
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.07 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 98.06 | |
| KOG1789|consensus | 2235 | 98.04 | ||
| KOG1150|consensus | 250 | 97.98 | ||
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 97.95 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 97.87 | |
| KOG1789|consensus | 2235 | 97.53 | ||
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.36 | |
| KOG0568|consensus | 342 | 97.27 | ||
| KOG2813|consensus | 406 | 97.06 | ||
| KOG0568|consensus | 342 | 96.88 | ||
| KOG2813|consensus | 406 | 96.22 | ||
| KOG3192|consensus | 168 | 96.21 | ||
| KOG0723|consensus | 112 | 95.84 | ||
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 95.69 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 95.54 | |
| KOG0723|consensus | 112 | 94.29 | ||
| KOG0431|consensus | 453 | 93.07 | ||
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 92.54 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 89.99 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 89.34 |
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-87 Score=755.11 Aligned_cols=386 Identities=44% Similarity=0.813 Sum_probs=344.5
Q ss_pred CCCceEEeCcCCCCCHHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHHhhCCcchhccccCCCCCCCccccccccccC
Q psy10927 425 ETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGGYQGGRLWGRRRRLLL 504 (858)
Q Consensus 425 ~~d~Y~iLgv~~~a~~~eik~ayr~la~~~HPD~~p~~~e~f~~i~~AY~vL~d~~~R~~yd~~G~~~~~~~~~~~~~~~ 504 (858)
..|||++|||+++|+.+|||+|||+||++||||+|+. .++|++|++||++|+||.+|+.||+||+.
T Consensus 27 ~~d~Y~vLGV~~~As~~eIKkAYrkla~k~HPDk~~~-~e~F~~i~~AYevLsD~~kR~~YD~~G~~------------- 92 (421)
T PTZ00037 27 NEKLYEVLNLSKDCTTSEIKKAYRKLAIKHHPDKGGD-PEKFKEISRAYEVLSDPEKRKIYDEYGEE------------- 92 (421)
T ss_pred chhHHHHcCCCCCCCHHHHHHHHHHHHHHHCCCCCch-HHHHHHHHHHHHHhccHHHHHHHhhhcch-------------
Confidence 5799999999999999999999999999999999985 58999999999999999999999999986
Q ss_pred CCCccccCCCCcCCCCCccccccccCCCCCCCCCCCCCCccccccccCcccCCCCCccccCCccEEEEEeechhhhhcCc
Q psy10927 505 PNGYIRDVHGWQFGGRSAAKGEAIKEGGSGGGGGGFSSPMDIFEMFMGGSLGGGRRRRERKGKDVVHQLTVSLEDLYRGT 584 (858)
Q Consensus 505 ~~~~~~~~~~~~~g~~~~~~g~gl~~g~~~~~~~~f~~~~d~F~~fFgg~~~~~~~~~~~kg~di~~~l~vtLeely~G~ 584 (858)
++.++++ ..++.|+|+.|||++ ++..+++++.|+.+.|.|||||+|+|+
T Consensus 93 ----------------------~~~~~~~------~~d~~d~f~~~Fggg---~~~~~~~rg~di~~~l~vtLee~~~G~ 141 (421)
T PTZ00037 93 ----------------------GLEGGEQ------PADASDLFDLIFGGG---RKPGGKKRGEDIVSHLKVTLEQIYNGA 141 (421)
T ss_pred ----------------------hcccCCC------CcchhhhHHHhhccc---cccccccCCCCEEEEeeeeHHHHhCCC
Confidence 1111100 124568999999862 222334679999999999999999999
Q ss_pred cceEeeeeeeeCCCCCCCCCCCCCcccCCCCCCcccEEEEEeecCceeeEEEEeCCCCCcccEEeCCCCCCCCCCCCceE
Q psy10927 585 VKKLQLEKNVICDKCEGRGGKKGAAESCPGCRGTGMTVTVQQFGPGMIQQIQTVCSECRGQGSRINPKDRCKTCNGKKTV 664 (858)
Q Consensus 585 ~k~i~i~r~v~C~~C~G~G~~~g~~~~C~~C~G~G~~~~~~~~gpG~~~~~~~~C~~C~G~G~~i~~~~~C~~C~G~g~v 664 (858)
+++|.+.|.+.|+.|+|+|++.+...+|+.|+|+|+++.++++|| |+++++++|+.|+|+|++++.+++|+.|+|+|++
T Consensus 142 ~~~i~~~r~~~C~~C~G~G~~~~~~~~C~~C~G~G~~~~~~~~g~-~~~q~~~~C~~C~G~G~~i~~~~~C~~C~G~g~v 220 (421)
T PTZ00037 142 MRKLAINKDVICANCEGHGGPKDAFVDCKLCNGQGIRVQIRQMGS-MIHQTQSTCNSCNGQGKIIPESKKCKNCSGKGVK 220 (421)
T ss_pred ceEEEeeccccccccCCCCCCCCCCccCCCCCCCCeEEEEEeecc-eeeEEEEeCCCCCCcceeccccccCCcCCCccee
Confidence 999999999999999999998777889999999999999999998 8889999999999999999888999999999999
Q ss_pred EEeEEEEEEecCCCCCCcEEEecCCCCCCCCCCcccEEEEEEeecCCCeEEeCCceEEecccCCHHHHhCCCEEEEecCC
Q psy10927 665 RDRKILEVHIDKGMIDQQKIVFNGEGDQEPGLEHGDIIIVLEEKPHPVFKRSGNNLIIRPYEIALVEALCGFRRPIKTLD 744 (858)
Q Consensus 665 ~e~k~l~V~Ip~G~~~G~~I~~~G~Gd~~~g~~~GDliv~i~~~~h~~F~R~G~DL~~~~~~Isl~eAL~G~~~~I~tLD 744 (858)
.+.++|+|.|||||.+|++|+|+|+|++.++..||||||+|+++||+.|+|+|+|||++ ++|||+|||+|+++.|+|||
T Consensus 221 ~~~~~l~V~Ip~G~~dG~~I~~~G~Gd~~~~~~pGDLiv~I~~~ph~~F~R~G~DL~~~-~~Isl~eAllG~~i~I~tLd 299 (421)
T PTZ00037 221 KTRKILEVNIDKGVPNQHKITFHGEADEKPNEIPGNVVFILNEKPHDTFKREGGDLFIT-KKISLYEALTGFVFYITHLD 299 (421)
T ss_pred eeeeEEEEeeCCCCCCCcEEEEecccCCCCCCCCCcEEEEEEecCCCCcEEeCCeEEEE-EeCCHHHHhcCCEEEeeCCC
Confidence 99999999999999999999999999999999999999999999999999999999999 99999999999999999999
Q ss_pred CCeEEEEeCCCceeeCCceEEEecCCCCCCCCCCCCCcEEEEEEEEcC--CCCChhhHHHHHhhCCCCCCCC---CCCCc
Q psy10927 745 DRDIIISAAPGEVMKHSDIKMVVGEGMPTYKDPFEKGNLIIVFSVKFP--DVIPVDKVPAIEACLPPRPKVT---IPENG 819 (858)
Q Consensus 745 Gr~l~i~~p~g~vi~~g~~~~I~geGmP~~~~~~~rGDL~I~f~V~fP--~~ls~~q~~~L~~lLp~~~~~~---~~~~~ 819 (858)
|+.|.|++|+|+|++||++++|+|+|||..++++.+|||||+|+|+|| +.|+++|+++|++|||.+++.. ..+++
T Consensus 300 G~~l~I~ip~g~vt~pg~~~~I~geGmP~~~~~~~rGDL~V~~~V~~P~~~~Ls~~qk~ll~~l~~~~~~~~~~~~~~~~ 379 (421)
T PTZ00037 300 GRKLLVNTPPGEVVKPGDIKVINNEGMPTYKSPFKKGNLYVTFEVIFPVDRKFTNEEKEILKSLFPQNPEEKKDLEDTEI 379 (421)
T ss_pred CCeEEEEeCCCcccCCCcEEEeCCCCcccCCCCCCCCCEEEEEEEEcCCCCCCCHHHHHHHHHhccCCCCCCCCCCcccc
Confidence 998999999999999999999999999987765678999999999999 8999999999999999755443 23569
Q ss_pred ceeEeecCChHHHhhhhhhcccCccCCC----CCCCCCcccCC
Q psy10927 820 EEVVLETMDPEKERAQNAYRQAHQEDED----QGPSRVQCATN 858 (858)
Q Consensus 820 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~c~~q 858 (858)
|+|++.+|++++...+ ..+++|+||+| +++++|||+||
T Consensus 380 e~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~v~c~~q 421 (421)
T PTZ00037 380 EVVTAQNVDPEEVKDR-DQKQQYQEDEDDEHHQEGERVACRQQ 421 (421)
T ss_pred eeEecccCCHHHhhhh-HHHHhhccccccccCCCCCccccCCC
Confidence 9999999999875443 23455544442 35689999998
|
|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712|consensus | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712|consensus | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0713|consensus | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0715|consensus | Back alignment and domain information |
|---|
| >KOG0713|consensus | Back alignment and domain information |
|---|
| >KOG0715|consensus | Back alignment and domain information |
|---|
| >KOG0714|consensus | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >KOG0714|consensus | Back alignment and domain information |
|---|
| >KOG0716|consensus | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0691|consensus | Back alignment and domain information |
|---|
| >KOG0718|consensus | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0716|consensus | Back alignment and domain information |
|---|
| >KOG0719|consensus | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721|consensus | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >KOG0718|consensus | Back alignment and domain information |
|---|
| >KOG0691|consensus | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0624|consensus | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0719|consensus | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0624|consensus | Back alignment and domain information |
|---|
| >KOG0721|consensus | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0722|consensus | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0550|consensus | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0550|consensus | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0722|consensus | Back alignment and domain information |
|---|
| >KOG0720|consensus | Back alignment and domain information |
|---|
| >KOG0720|consensus | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG1150|consensus | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >KOG1789|consensus | Back alignment and domain information |
|---|
| >KOG1150|consensus | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789|consensus | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0568|consensus | Back alignment and domain information |
|---|
| >KOG2813|consensus | Back alignment and domain information |
|---|
| >KOG0568|consensus | Back alignment and domain information |
|---|
| >KOG2813|consensus | Back alignment and domain information |
|---|
| >KOG3192|consensus | Back alignment and domain information |
|---|
| >KOG0723|consensus | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0723|consensus | Back alignment and domain information |
|---|
| >KOG0431|consensus | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 858 | ||||
| 1nlt_A | 248 | The Crystal Structure Of Hsp40 Ydj1 Length = 248 | 1e-51 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 3e-20 | ||
| 3agz_A | 190 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 5e-20 | ||
| 2qld_A | 183 | Human Hsp40 Hdj1 Length = 183 | 7e-20 | ||
| 3agx_A | 181 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 9e-20 | ||
| 2q2g_A | 180 | Crystal Structure Of Dimerization Domain Of Hsp40 F | 2e-17 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 6e-15 | ||
| 1c3g_A | 170 | S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 1 | 3e-13 | ||
| 2b26_A | 173 | The Crystal Structure Of The Protein Complex Of Yea | 4e-13 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 7e-12 | ||
| 1xao_A | 121 | Hsp40-Ydj1 Dimerization Domain Length = 121 | 7e-08 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-07 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 8e-07 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 1e-06 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 7e-06 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 8e-06 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 1e-05 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 1e-05 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 2e-05 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-05 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 3e-05 | ||
| 2ys8_A | 90 | Solution Structure Of The Dnaj-Like Domain From Hum | 4e-05 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 5e-05 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 6e-05 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 7e-05 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 5e-04 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 7e-04 |
| >pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 | Back alignment and structure |
|
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 | Back alignment and structure |
| >pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 | Back alignment and structure |
| >pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 | Back alignment and structure |
| >pdb|2Q2G|A Chain A, Crystal Structure Of Dimerization Domain Of Hsp40 From Cryptosporidium Parvum, Cgd2_1800 Length = 180 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|1C3G|A Chain A, S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 170 | Back alignment and structure |
| >pdb|2B26|A Chain A, The Crystal Structure Of The Protein Complex Of Yeast Hsp40 Sis1 And Hsp70 Ssa1 Length = 173 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|1XAO|A Chain A, Hsp40-Ydj1 Dimerization Domain Length = 121 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 858 | |||
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 1e-111 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 3e-37 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 2e-22 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 1e-10 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 9e-71 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 2e-18 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 1e-64 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 1e-16 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 3e-54 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 3e-16 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 8e-47 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 3e-20 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 4e-12 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 7e-42 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 8e-18 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-10 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 6e-40 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 2e-13 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 4e-39 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-16 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 7e-13 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 4e-33 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 3e-14 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 4e-11 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 7e-32 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 8e-15 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 3e-10 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 9e-32 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 3e-14 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 6e-12 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 2e-31 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 4e-14 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 1e-10 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 3e-31 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 8e-14 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 1e-09 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 6e-31 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 1e-13 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 6e-09 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-30 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-13 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 5e-09 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 1e-30 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 7e-14 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 6e-12 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-30 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-13 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-10 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 4e-30 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 8e-13 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 6e-09 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 9e-30 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 4e-14 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 5e-08 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 9e-30 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 1e-13 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 7e-12 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 1e-29 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 4e-14 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 6e-08 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 2e-29 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 4e-11 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 1e-08 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 4e-29 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 4e-13 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 2e-10 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 5e-29 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 3e-13 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 4e-09 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 4e-28 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 2e-13 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 7e-05 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 1e-27 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-13 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 2e-09 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 3e-27 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-10 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 6e-08 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 2e-26 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 8e-13 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 1e-05 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-24 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-12 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 6e-04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-22 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 6e-06 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 2e-19 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 1e-09 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 4e-06 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 5e-19 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 5e-07 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 1e-04 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-17 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 9e-07 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-16 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-09 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 4e-16 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 1e-08 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 1e-15 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 7e-05 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 1e-13 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 7e-05 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 2e-13 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 2e-06 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 4e-06 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 1e-12 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 1e-05 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 2e-10 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 2e-04 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 1e-09 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 |
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
Score = 340 bits (874), Expect = e-111
Identities = 108/238 (45%), Positives = 152/238 (63%), Gaps = 3/238 (1%)
Query: 556 GGGRRRRERKGKDVVHQLTVSLEDLYRGTVKKLQLEKNVICDKCEGRGGKKGAAESCPGC 615
G R R ++GKD+ H+++ SLE+LY+G KL L K ++C +CEGRGGKKGA + C C
Sbjct: 1 GAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSC 60
Query: 616 RGTGMTVTVQQFGPGMIQQIQTVCSECRGQGSRINPKDRCKTCNGKKTVRDRKILEVHID 675
G G+ +Q GP MIQ+ QT C C G G I+PKDRCK+CNGKK +RKILEVH++
Sbjct: 61 NGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVE 119
Query: 676 KGMIDQQKIVFNGEGDQEPGLEHGDIIIVLEEKPHPVFKRSGNNLIIRPYEIALVEALCG 735
GM D Q+IVF GE DQ P + GD++ ++ E+PH FKR G++L+ EI L+ A+ G
Sbjct: 120 PGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYE-AEIDLLTAIAG 178
Query: 736 FRRPIKTLDDRDIIISAAPGEVMKHSDIKMVVGEGMPTYKDPFEKGNLIIVFSVKFPD 793
++ + + + PGEV+ K++ G+GMP K GNLII F++K P+
Sbjct: 179 GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYG-GYGNLIIKFTIKDPE 235
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 858 | |||
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 100.0 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 100.0 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 100.0 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.97 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.93 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 99.92 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 99.9 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.88 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 99.87 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.79 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.72 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.7 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.69 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.69 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.69 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.69 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.68 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.68 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.68 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.68 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.67 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.67 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.66 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.66 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.66 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.66 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.66 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.65 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.65 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.63 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.61 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.6 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.6 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.59 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.59 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.59 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.58 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.58 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.56 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.56 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.56 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.56 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.55 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.54 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.54 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.53 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.51 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.51 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.5 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.49 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.48 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.48 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.46 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.46 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.46 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.45 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.44 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.43 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.43 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.43 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.42 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.42 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.42 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.4 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.38 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.37 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 99.36 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.35 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.33 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.32 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.32 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.3 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.29 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.28 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.26 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.24 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.22 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.1 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.5 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.35 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 97.92 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 97.88 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 97.86 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.46 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 97.15 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 95.99 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 94.69 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 94.5 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 92.02 |
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-59 Score=496.67 Aligned_cols=241 Identities=44% Similarity=0.853 Sum_probs=221.1
Q ss_pred ccccCCccEEEEEeechhhhhcCccceEeeeeeeeCCCCCCCCCCCCCcccCCCCCCcccEEEEEeecCceeeEEEEeCC
Q psy10927 561 RRERKGKDVVHQLTVSLEDLYRGTVKKLQLEKNVICDKCEGRGGKKGAAESCPGCRGTGMTVTVQQFGPGMIQQIQTVCS 640 (858)
Q Consensus 561 ~~~~kg~di~~~l~vtLeely~G~~k~i~i~r~v~C~~C~G~G~~~g~~~~C~~C~G~G~~~~~~~~gpG~~~~~~~~C~ 640 (858)
.++++++|+.++|+|||||+|+|++++|.+.|.+.|+.|+|+|+++++..+|+.|+|+|+++..+++|| |+++++++|+
T Consensus 6 ~~~~~g~d~~~~l~vslee~~~G~~k~i~~~r~~~C~~C~G~G~~~g~~~~C~~C~G~G~~~~~~~~g~-~~~~~~~~C~ 84 (248)
T 1nlt_A 6 RGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGP-MIQRFQTECD 84 (248)
T ss_dssp --CCBCCCEEEEEEECTTHHHHCEEEEEEEEEEEECTTTTTCSBSTTTCCCCTTSSSSSCEEEEEESSS-EEEEEECSCT
T ss_pred CCCCCCCCEEEEEEecHHHhcCCceEEEEeeEEEeCCCCcCccCCCCCCccCCCCCCCcEEEEEEecCc-eEEEEEEcCC
Confidence 345689999999999999999999999999999999999999999988899999999999999999999 8899999999
Q ss_pred CCCcccEEeCCCCCCCCCCCCceEEEeEEEEEEecCCCCCCcEEEecCCCCCCCCCCcccEEEEEEeecCCCeEEeCCce
Q psy10927 641 ECRGQGSRINPKDRCKTCNGKKTVRDRKILEVHIDKGMIDQQKIVFNGEGDQEPGLEHGDIIIVLEEKPHPVFKRSGNNL 720 (858)
Q Consensus 641 ~C~G~G~~i~~~~~C~~C~G~g~v~e~k~l~V~Ip~G~~~G~~I~~~G~Gd~~~g~~~GDliv~i~~~~h~~F~R~G~DL 720 (858)
.|+|+|++|.++++|+.|+|+|++.+.++|+|+|||||++|++|+|+|+||+.+++.+|||||+|+++||+.|+|+|+||
T Consensus 85 ~C~G~G~~i~~~~~C~~C~G~g~~~~~~~l~V~Ip~G~~~G~~ir~~g~G~~~~~g~~GDl~v~i~v~~h~~F~R~G~DL 164 (248)
T 1nlt_A 85 VCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDL 164 (248)
T ss_dssp TCSSSSSCCCTTSBCSSSTTSCEEEEEEEEEEEECTTCCTTCEEEETTCSCCCTTCBCCCEEEEEEECCCSSCEEETTEE
T ss_pred CCCCcCEEeccCCCCcccCCCceEeeeEEEEEEECCCccCCCEEEEeeeecCCCCCCcceEEEEEEEecCccceeeCCEE
Confidence 99999999988999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEecccCCHHHHhCCCEEEEecCCCCeEEEEeCCCceeeCCceEEEecCCCCCCCCCCCCCcEEEEEEEEcCCC--CChh
Q psy10927 721 IIRPYEIALVEALCGFRRPIKTLDDRDIIISAAPGEVMKHSDIKMVVGEGMPTYKDPFEKGNLIIVFSVKFPDV--IPVD 798 (858)
Q Consensus 721 ~~~~~~Isl~eAL~G~~~~I~tLDGr~l~i~~p~g~vi~~g~~~~I~geGmP~~~~~~~rGDL~I~f~V~fP~~--ls~~ 798 (858)
|++ ++|||+|||+|+++.|+||||+.+.|++|+|+|++||++++|+|+|||..+++ .+|||||+|+|+||++ |+++
T Consensus 165 ~~~-~~Isl~eAllG~~i~v~tldG~~~~i~ip~g~vt~~g~~~rl~g~Gmp~~~~~-~~GDL~V~~~V~~P~~~~Ls~~ 242 (248)
T 1nlt_A 165 VYE-AEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYG-GYGNLIIKFTIKDPENHFTSEE 242 (248)
T ss_dssp EEE-EEEEHHHHHHCBCCEEECSSSCEEECCBCTTTTCSTTCEEEETTCSCBCSSSC-SBCCEEEEEEEECCC-------
T ss_pred EEE-EEeCHHHHhcCCEEEEeCCCCCEEEEEeCCCCeeCCCeEEEEcCCCCccCCCC-CcCCEEEEEEEECCCCCCCCHH
Confidence 999 99999999999999999999998999999999999999999999999987665 6899999999999999 9999
Q ss_pred hHHHHH
Q psy10927 799 KVPAIE 804 (858)
Q Consensus 799 q~~~L~ 804 (858)
|+++|+
T Consensus 243 q~~~l~ 248 (248)
T 1nlt_A 243 NLKKLE 248 (248)
T ss_dssp ------
T ss_pred HHHhhC
Confidence 998875
|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 858 | ||||
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 1e-21 | |
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 2e-14 | |
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 3e-13 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 2e-19 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 2e-08 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 4e-06 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 4e-19 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 5e-08 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-04 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 3e-18 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 4e-09 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 1e-06 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 9e-18 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 5e-09 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 6e-04 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-17 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 5e-06 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-05 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 3e-17 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 2e-07 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 1e-15 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 2e-06 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 3e-05 | |
| d1nlta2 | 80 | b.4.1.1 (A:258-337) Mitochondrial protein import p | 3e-15 | |
| d1nlta2 | 80 | b.4.1.1 (A:258-337) Mitochondrial protein import p | 3e-06 | |
| d1c3ga2 | 90 | b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba | 5e-15 | |
| d1c3ga2 | 90 | b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba | 3e-05 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 3e-13 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 4e-06 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 4e-04 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 8e-12 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 7e-10 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 0.001 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 0.004 | |
| d1nlta1 | 74 | b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei | 2e-09 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 2e-08 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 3e-04 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 5e-04 |
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
class: Small proteins fold: DnaJ/Hsp40 cysteine-rich domain superfamily: DnaJ/Hsp40 cysteine-rich domain family: DnaJ/Hsp40 cysteine-rich domain domain: Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 87.0 bits (215), Expect = 1e-21
Identities = 38/75 (50%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
Query: 592 KNVICDKCEGRGGKKGAAESCPGCRGTGMTVTVQQFGPGMIQQIQTVCSECRGQGSRINP 651
K ++C +CEGRGGKKGA + C C G G+ +Q GP + Q+ QT C C G G I+P
Sbjct: 1 KQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMI-QRFQTECDVCHGTGDIIDP 59
Query: 652 KDRCKTCNGKKTVRD 666
KDRCK+CNGKK +
Sbjct: 60 KDRCKSCNGKKVENE 74
|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 858 | |||
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.87 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.8 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.78 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.7 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.66 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.64 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.61 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.61 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.59 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.59 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.57 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.54 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.52 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 99.47 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.46 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.45 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.43 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.39 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.38 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.33 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.27 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.26 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 98.74 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 98.13 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 98.09 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.05 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 95.2 |
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: HSP40/DnaJ peptide-binding domain superfamily: HSP40/DnaJ peptide-binding domain family: HSP40/DnaJ peptide-binding domain domain: Heat shock protein 40 Sis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.87 E-value=4.1e-23 Score=183.30 Aligned_cols=90 Identities=34% Similarity=0.619 Sum_probs=85.4
Q ss_pred CeEEeCCceEEecccCCHHHHhCCCEEEEecCCCCeEEEEeCCCceeeCCceEEEecCCCCCCCCCCCCCcEEEEEEEEc
Q psy10927 712 VFKRSGNNLIIRPYEIALVEALCGFRRPIKTLDDRDIIISAAPGEVMKHSDIKMVVGEGMPTYKDPFEKGNLIIVFSVKF 791 (858)
Q Consensus 712 ~F~R~G~DL~~~~~~Isl~eAL~G~~~~I~tLDGr~l~i~~p~g~vi~~g~~~~I~geGmP~~~~~~~rGDL~I~f~V~f 791 (858)
.|+|+|+||+++ ++|||.|||+|+++.|+|+||+.|.|++|++ +++|+.++|+|+|||.+++++.+|||||+|+|+|
T Consensus 1 ~F~R~G~DL~~~-~~I~~~eal~G~~~~i~~~dG~~i~i~ip~~--~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~ 77 (90)
T d1c3ga2 1 NFKRDGDDLIYT-LPLSFKESLLGFSKTIQTIDGRTLPLSRVQP--VQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDY 77 (90)
T ss_dssp SEEEETTEEEEE-ECCBHHHHHHCEEEEEECSSSCEEEEEESSC--CCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBC
T ss_pred CCeEeCCeEEEE-EEeCHHHHhcCCeEEEecccccceecccccc--cccccccccCCCCCCcCCCCCCcCCEEEEEEEEc
Confidence 499999999999 9999999999999999999999999999987 6999999999999999888778999999999999
Q ss_pred CCCCChhhHHHHH
Q psy10927 792 PDVIPVDKVPAIE 804 (858)
Q Consensus 792 P~~ls~~q~~~L~ 804 (858)
|++||++|+++|+
T Consensus 78 P~~ls~~qk~~lE 90 (90)
T d1c3ga2 78 PISLNDAQKRAID 90 (90)
T ss_dssp CSSCCTTHHHHTC
T ss_pred CCCCCHHHHHhhC
Confidence 9999999999874
|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|