Psyllid ID: psy10938


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLPATGKKELD
ccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHEEEEEEEEEcEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccc
MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVlpsaqcdfgmtssdkgwlnaapmLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFIngfasrplipghpgkvasvcdvsalqpadnstvatcsgevnpevfSHTLIIGLacipsslampLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSStfgrfggltgnlmfgfliDGHCLILICTLAAMLLIAGVFsmflpatgkkeld
MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMflpatgkkeld
MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLPATGKKELD
*******QFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLP********
************FENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLP*TG*****
MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLPATGKKELD
********FDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLPAT******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASRPLIPGHPGKVASVCDVSALQPADNSTVATCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLPATGKKELD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query314 2.2.26 [Sep-21-2011]
Q69ZS6 727 Synaptic vesicle glycopro yes N/A 0.410 0.177 0.364 5e-13
Q9Z2I6 727 Synaptic vesicle glycopro yes N/A 0.410 0.177 0.364 9e-13
Q496J9 727 Synaptic vesicle glycopro yes N/A 0.410 0.177 0.364 9e-13
Q7L1I2 683 Synaptic vesicle glycopro no N/A 0.398 0.183 0.384 1e-12
Q8BG39 683 Synaptic vesicle glycopro no N/A 0.385 0.177 0.371 2e-11
Q8N4V2 548 Synaptic vesicle 2-relate no N/A 0.398 0.228 0.330 5e-11
Q5R5T8 548 Synaptic vesicle 2-relate no N/A 0.398 0.228 0.330 5e-11
Q1JP63 548 Synaptic vesicle 2-relate no N/A 0.398 0.228 0.330 5e-11
Q8BFT9 548 Synaptic vesicle 2-relate no N/A 0.398 0.228 0.322 9e-11
Q63564 683 Synaptic vesicle glycopro no N/A 0.385 0.177 0.363 1e-10
>sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%)

Query: 7   EQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKG 66
           E+    +E  +   G+G+F + L    G+      + + V+ FVLPSA+ D  + +S  G
Sbjct: 132 EELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSG 191

Query: 67  WLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFIN 126
           WL +   LGM+ G++FWG LAD  GRK +L+  + V+G     SS  Q YG FL  R ++
Sbjct: 192 WLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLVCRLLS 251

Query: 127 GFASRPLIP 135
           GF     IP
Sbjct: 252 GFGIGGAIP 260




Receptor for the botulinium neurotoxin type A/BOTA.
Mus musculus (taxid: 10090)
>sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 Back     alignment and function description
>sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=2 SV=1 Back     alignment and function description
>sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=2 SV=1 Back     alignment and function description
>sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 Back     alignment and function description
>sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 Back     alignment and function description
>sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
328777882355 PREDICTED: synaptic vesicle glycoprotein 0.974 0.861 0.404 5e-58
345486887 513 PREDICTED: synaptic vesicle glycoprotein 0.566 0.346 0.546 9e-49
383856155 509 PREDICTED: synaptic vesicle glycoprotein 0.563 0.347 0.554 3e-48
357611405 543 hypothetical protein KGM_03534 [Danaus p 0.563 0.325 0.564 3e-48
340717508 510 PREDICTED: synaptic vesicle glycoprotein 0.563 0.347 0.552 7e-47
157131469 504 synaptic vesicle protein [Aedes aegypti] 0.563 0.351 0.55 8e-47
350407545 510 PREDICTED: synaptic vesicle glycoprotein 0.566 0.349 0.544 1e-46
189234743 512 PREDICTED: similar to synaptic vesicle p 0.566 0.347 0.554 2e-46
270001549 521 hypothetical protein TcasGA2_TC000393 [T 0.566 0.341 0.554 2e-46
332026137 539 Synaptic vesicle glycoprotein 2B [Acromy 0.563 0.328 0.560 3e-46
>gi|328777882|ref|XP_001122587.2| PREDICTED: synaptic vesicle glycoprotein 2C-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 190/363 (52%), Gaps = 57/363 (15%)

Query: 1   MGLDFGEQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGM 60
           MGLDF     A FE+A+   G+GKFHY+L+   GL+Y   AI +T+LSFVLP+AQCD  M
Sbjct: 1   MGLDFLADGGADFEHAITVTGFGKFHYMLLTICGLIYMDTAIGVTILSFVLPAAQCDLEM 60

Query: 61  TSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFL 120
            S+ KGWL A+PMLGMV GSY WGCLAD +GRK+ LI  LL+DG+ G+ SS  QY+ +FL
Sbjct: 61  DSTAKGWLTASPMLGMVVGSYIWGCLADIKGRKVVLIATLLMDGIVGVVSSFVQYFWIFL 120

Query: 121 ALRFINGFASRPLIPGHPGKVASVC--DVSALQPADNSTVATCSGE-------------- 164
             RF NGFA    + G  G    +C   +   QP        C  E              
Sbjct: 121 VFRFFNGFA----VTGAMG----ICFPYLGEFQPTKYREKCLCWMEMFWTVGVILLPLIA 172

Query: 165 --VNPEVF----------SHTLIIGLACIPS-SLAMPLLVHKMGAKWFLVAGLVLSSGVA 211
             + P  F          S  L + L  +PS  L + L       K+ L  G   ++   
Sbjct: 173 WLIIPMNFMYLTDTFYFKSWNLFVALCALPSLMLGLWLFAFPESPKFLLECGETDAALEV 232

Query: 212 MALYYVQ-----------------TSTQNLILSC---IFEALTGCCISVVYCIMVDLFPT 251
               Y Q                 T T++ I+      F+      IS+VYC++VD+FPT
Sbjct: 233 FKWIYSQNTGEDPDSYPVKSLQEKTKTKHEIVELHKERFKVFERLGISLVYCVIVDMFPT 292

Query: 252 NLRVLAAALSSTFGRFGGLTGNLMFGFLIDGHCLILICTLAAMLLIAGVFSMFLPATGKK 311
           NLRV+AAALS T GR G L GNL+FG+LID  C+I I   AA L + G  S  LP TGK+
Sbjct: 293 NLRVMAAALSLTMGRLGALVGNLVFGYLIDLACVIPIVLFAAFLFVCGFMSFLLPKTGKE 352

Query: 312 ELD 314
            L+
Sbjct: 353 TLE 355




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345486887|ref|XP_001607777.2| PREDICTED: synaptic vesicle glycoprotein 2B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383856155|ref|XP_003703575.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|357611405|gb|EHJ67462.1| hypothetical protein KGM_03534 [Danaus plexippus] Back     alignment and taxonomy information
>gi|340717508|ref|XP_003397223.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|157131469|ref|XP_001655861.1| synaptic vesicle protein [Aedes aegypti] gi|108871532|gb|EAT35757.1| AAEL012098-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|350407545|ref|XP_003488120.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|189234743|ref|XP_974142.2| PREDICTED: similar to synaptic vesicle protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270001549|gb|EEZ97996.1| hypothetical protein TcasGA2_TC000393 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332026137|gb|EGI66285.1| Synaptic vesicle glycoprotein 2B [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
FB|FBgn0029896 632 CG3168 [Drosophila melanogaste 0.394 0.196 0.448 4.6e-52
ZFIN|ZDB-GENE-000607-80 541 id:ibd5037 "id:ibd5037" [Danio 0.394 0.229 0.411 1.6e-40
FB|FBgn0051272 563 CG31272 [Drosophila melanogast 0.385 0.214 0.363 2.4e-34
FB|FBgn0051106513 CG31106 [Drosophila melanogast 0.528 0.323 0.271 1.5e-31
FB|FBgn0040350558 CG3690 [Drosophila melanogaste 0.503 0.283 0.281 1.8e-29
MGI|MGI:1922459 727 Sv2c "synaptic vesicle glycopr 0.410 0.177 0.364 3.1e-27
FB|FBgn0037829 522 CG14691 [Drosophila melanogast 0.372 0.224 0.341 3.9e-27
RGD|619718 727 Sv2c "synaptic vesicle glycopr 0.410 0.177 0.364 5.4e-27
UNIPROTKB|Q496J9 727 SV2C "Synaptic vesicle glycopr 0.410 0.177 0.364 1.1e-26
UNIPROTKB|E1BLJ9 725 SV2C "Uncharacterized protein" 0.410 0.177 0.356 1.8e-26
FB|FBgn0029896 CG3168 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 296 (109.3 bits), Expect = 4.6e-52, Sum P(2) = 4.6e-52
 Identities = 57/127 (44%), Positives = 80/127 (62%)

Query:    11 ATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNA 70
             A FE A+   GYGKFHYIL+   GL+     + +  +SF+LPSA+CD  + +  KGWLN+
Sbjct:   135 ANFERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNS 194

Query:    71 APMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFA- 129
                +GM+ G+YFWG +AD+ GRK  LI    ++  C +ASS +Q Y  F+  RF+NG A 
Sbjct:   195 IIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAAL 254

Query:   130 --SRPLI 134
               S P+I
Sbjct:   255 GGSGPVI 261


GO:0016021 "integral to membrane" evidence=IEA
GO:0022857 "transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
ZFIN|ZDB-GENE-000607-80 id:ibd5037 "id:ibd5037" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0051272 CG31272 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051106 CG31106 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040350 CG3690 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1922459 Sv2c "synaptic vesicle glycoprotein 2c" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0037829 CG14691 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|619718 Sv2c "synaptic vesicle glycoprotein 2c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q496J9 SV2C "Synaptic vesicle glycoprotein 2C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLJ9 SV2C "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 1e-20
TIGR00895398 TIGR00895, 2A0115, benzoate transport 3e-10
TIGR00898505 TIGR00898, 2A0119, cation transport protein 5e-07
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 1e-06
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-06
PRK11102377 PRK11102, PRK11102, bicyclomycin/multidrug efflux 9e-06
TIGR01299742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 1e-05
TIGR00893 399 TIGR00893, 2A0114, D-galactonate transporter 7e-05
PRK11551 406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 1e-04
TIGR00710385 TIGR00710, efflux_Bcr_CflA, drug resistance transp 1e-04
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 1e-04
TIGR00886366 TIGR00886, 2A0108, nitrite extrusion protein (nitr 0.001
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 0.002
COG2814394 COG2814, AraJ, Arabinose efflux permease [Carbohyd 0.002
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
 Score = 92.3 bits (229), Expect = 1e-20
 Identities = 49/129 (37%), Positives = 67/129 (51%)

Query: 7   EQFDATFENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKG 66
           E+    +E  +   G+G+F + L    GL      + + V+ FVLPSA+ D  +  S KG
Sbjct: 146 EELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKG 205

Query: 67  WLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFIN 126
            L     LGM+ G++FWG LAD  GRK  L+  L V+G     SS  Q YG FL  R ++
Sbjct: 206 MLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLS 265

Query: 127 GFASRPLIP 135
           GF     IP
Sbjct: 266 GFGIGGAIP 274


This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices. Length = 742

>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|182964 PRK11102, PRK11102, bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|233099 TIGR00710, efflux_Bcr_CflA, drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233170 TIGR00886, 2A0108, nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|225371 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 314
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.97
KOG0253|consensus528 99.97
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.96
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.96
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.96
PRK03545390 putative arabinose transporter; Provisional 99.95
PRK03699394 putative transporter; Provisional 99.95
PRK09705393 cynX putative cyanate transporter; Provisional 99.95
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.95
PRK05122399 major facilitator superfamily transporter; Provisi 99.95
TIGR00898505 2A0119 cation transport protein. 99.95
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.95
PRK12307426 putative sialic acid transporter; Provisional 99.95
TIGR00891405 2A0112 putative sialic acid transporter. 99.94
PRK03633381 putative MFS family transporter protein; Provision 99.94
PRK10642490 proline/glycine betaine transporter; Provisional 99.94
PRK11663434 regulatory protein UhpC; Provisional 99.94
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.94
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.94
PRK09952438 shikimate transporter; Provisional 99.94
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.93
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.93
PRK12382392 putative transporter; Provisional 99.93
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.93
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.93
PRK03893496 putative sialic acid transporter; Provisional 99.93
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.93
PRK09874408 drug efflux system protein MdtG; Provisional 99.92
PRK10091382 MFS transport protein AraJ; Provisional 99.92
PLN00028476 nitrate transmembrane transporter; Provisional 99.92
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.92
PRK15075434 citrate-proton symporter; Provisional 99.92
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.92
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.92
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.92
TIGR00895398 2A0115 benzoate transport. 99.92
TIGR00893399 2A0114 d-galactonate transporter. 99.92
KOG0252|consensus538 99.91
PRK10489417 enterobactin exporter EntS; Provisional 99.91
KOG0569|consensus485 99.91
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.91
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.91
PRK10504471 putative transporter; Provisional 99.91
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.91
PRK10133438 L-fucose transporter; Provisional 99.91
TIGR00900365 2A0121 H+ Antiporter protein. 99.91
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.91
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.9
TIGR00897402 2A0118 polyol permease family. This family of prot 99.9
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.89
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.89
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.89
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.89
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.89
PRK10054395 putative transporter; Provisional 99.89
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.89
PRK15011393 sugar efflux transporter B; Provisional 99.88
PRK11652394 emrD multidrug resistance protein D; Provisional 99.88
PRK11043401 putative transporter; Provisional 99.88
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.88
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.87
PRK09528420 lacY galactoside permease; Reviewed 99.87
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.87
PRK11195393 lysophospholipid transporter LplT; Provisional 99.86
KOG1330|consensus493 99.86
TIGR00896355 CynX cyanate transporter. This family of proteins 99.86
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.86
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.85
PRK11646400 multidrug resistance protein MdtH; Provisional 99.85
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.85
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.84
KOG0254|consensus513 99.84
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.84
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.84
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.83
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.83
KOG0255|consensus521 99.83
KOG2504|consensus509 99.82
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.82
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.82
PRK11010491 ampG muropeptide transporter; Validated 99.79
KOG2615|consensus451 99.78
KOG4686|consensus459 99.77
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.76
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.75
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.75
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.74
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.74
KOG2532|consensus466 99.74
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.73
KOG3764|consensus464 99.72
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.72
PRK11902402 ampG muropeptide transporter; Reviewed 99.71
COG2270438 Permeases of the major facilitator superfamily [Ge 99.68
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.66
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.64
PTZ00207 591 hypothetical protein; Provisional 99.62
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.62
TIGR00901356 2A0125 AmpG-related permease. 99.62
KOG2533|consensus495 99.62
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.61
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.59
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.57
TIGR00805 633 oat sodium-independent organic anion transporter. 99.55
PRK09669444 putative symporter YagG; Provisional 99.54
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.52
PF13347428 MFS_2: MFS/sugar transport protein 99.52
PRK09848448 glucuronide transporter; Provisional 99.52
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.44
TIGR00900 365 2A0121 H+ Antiporter protein. 99.44
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.43
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.42
TIGR00893 399 2A0114 d-galactonate transporter. 99.42
PRK03545 390 putative arabinose transporter; Provisional 99.42
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.42
PRK10429473 melibiose:sodium symporter; Provisional 99.41
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.41
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.41
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.4
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.39
PRK10054 395 putative transporter; Provisional 99.39
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.38
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.38
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.37
PRK11663 434 regulatory protein UhpC; Provisional 99.37
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.37
PRK10091 382 MFS transport protein AraJ; Provisional 99.36
TIGR00891 405 2A0112 putative sialic acid transporter. 99.36
KOG2563|consensus480 99.35
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.35
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.35
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.35
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.33
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.32
TIGR00895 398 2A0115 benzoate transport. 99.31
KOG3764|consensus 464 99.31
TIGR00898 505 2A0119 cation transport protein. 99.3
PRK10504 471 putative transporter; Provisional 99.3
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.29
KOG2615|consensus 451 99.29
KOG3762|consensus618 99.29
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.29
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.29
PRK11043 401 putative transporter; Provisional 99.28
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.28
PRK12307 426 putative sialic acid transporter; Provisional 99.28
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.28
PRK03699 394 putative transporter; Provisional 99.27
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.27
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.26
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.26
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.25
PRK09705 393 cynX putative cyanate transporter; Provisional 99.25
PRK03893 496 putative sialic acid transporter; Provisional 99.24
PRK10489 417 enterobactin exporter EntS; Provisional 99.24
COG2211467 MelB Na+/melibiose symporter and related transport 99.23
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.23
KOG2325|consensus 488 99.23
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.23
PRK12382 392 putative transporter; Provisional 99.22
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.22
PLN00028 476 nitrate transmembrane transporter; Provisional 99.22
PRK05122 399 major facilitator superfamily transporter; Provisi 99.22
PRK03633 381 putative MFS family transporter protein; Provision 99.21
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.21
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.2
PRK09874 408 drug efflux system protein MdtG; Provisional 99.2
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.2
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.19
PRK11462460 putative transporter; Provisional 99.19
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.19
PRK15011393 sugar efflux transporter B; Provisional 99.18
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.18
PRK10642 490 proline/glycine betaine transporter; Provisional 99.18
KOG1330|consensus 493 99.17
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.17
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.17
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.17
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.16
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.15
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.15
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 99.14
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.14
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.13
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.11
KOG0255|consensus 521 99.11
PRK09528420 lacY galactoside permease; Reviewed 99.1
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.09
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.08
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.07
PRK09952 438 shikimate transporter; Provisional 99.07
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.06
KOG2532|consensus 466 99.04
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.03
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.03
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.03
PRK11902 402 ampG muropeptide transporter; Reviewed 99.02
KOG0254|consensus 513 99.0
PRK15075 434 citrate-proton symporter; Provisional 99.0
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.0
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.99
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 98.98
TIGR00901 356 2A0125 AmpG-related permease. 98.97
PRK10133 438 L-fucose transporter; Provisional 98.95
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.95
TIGR00805 633 oat sodium-independent organic anion transporter. 98.95
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.93
KOG2816|consensus463 98.91
PTZ00207 591 hypothetical protein; Provisional 98.86
PRK11010 491 ampG muropeptide transporter; Validated 98.84
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.81
KOG0569|consensus 485 98.81
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.77
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.75
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.74
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.71
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.66
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 98.65
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.64
KOG2533|consensus 495 98.62
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.6
PF1283277 MFS_1_like: MFS_1 like family 98.57
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.56
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.55
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.55
KOG2504|consensus 509 98.49
PF13347428 MFS_2: MFS/sugar transport protein 98.49
KOG0252|consensus 538 98.47
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.41
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.36
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.35
KOG2816|consensus 463 98.35
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.32
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.27
PRK09848448 glucuronide transporter; Provisional 98.27
KOG3626|consensus 735 98.25
PRK10429473 melibiose:sodium symporter; Provisional 98.17
COG2270438 Permeases of the major facilitator superfamily [Ge 98.17
PRK09669 444 putative symporter YagG; Provisional 98.17
KOG0253|consensus 528 98.1
PRK11462 460 putative transporter; Provisional 98.07
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 98.06
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.04
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.02
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.96
KOG0637|consensus 498 97.95
COG2211467 MelB Na+/melibiose symporter and related transport 97.94
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.93
KOG4332|consensus 454 97.9
COG0477338 ProP Permeases of the major facilitator superfamil 97.88
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.8
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.65
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.61
KOG3098|consensus 461 97.43
KOG4686|consensus459 97.36
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.31
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.3
COG0477 338 ProP Permeases of the major facilitator superfamil 97.26
KOG3762|consensus618 97.22
KOG2325|consensus 488 97.04
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 96.92
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 96.76
KOG2563|consensus 480 96.76
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 96.58
PF1283277 MFS_1_like: MFS_1 like family 96.19
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 96.15
KOG3574|consensus510 96.15
KOG3098|consensus 461 95.76
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 95.63
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 95.5
PRK03612 521 spermidine synthase; Provisional 95.08
KOG3097|consensus390 94.22
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 94.01
KOG1479|consensus406 93.88
KOG3626|consensus 735 93.87
KOG1237|consensus 571 93.72
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 91.36
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 89.98
KOG3810|consensus433 89.7
PRK03612 521 spermidine synthase; Provisional 89.28
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 87.02
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 86.75
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 84.92
KOG1237|consensus 571 82.97
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
Probab=99.97  E-value=4.7e-30  Score=236.60  Aligned_cols=301  Identities=28%  Similarity=0.441  Sum_probs=238.0

Q ss_pred             HHHHHHHcCCchHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccccccchhhHHhHhhHHHHHHhhhhhhhcccccch
Q psy10938         13 FENALAAAGYGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGR   92 (314)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~g~~~s~~~~~~~i~~~~~g~l~dr~Gr   92 (314)
                      .++..++.+.++++|.++++++++.+..+++...+++++|.+.+++|++..+.+++.+++.++.+++++++|+++||+||
T Consensus       152 ~d~~l~~~~~~~~~~~l~~i~~l~~~~~g~d~~~is~ilp~i~~~~gls~~~~g~l~s~~~lG~iiG~li~G~LsDR~GR  231 (742)
T TIGR01299       152 YELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVYLGMMVGAFFWGGLADKLGR  231 (742)
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            34455667788899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHhHHHHhhhHHHHHHHHHHHhhcccC--------------C--------------------------
Q psy10938         93 KITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFASR--------------P--------------------------  132 (314)
Q Consensus        93 r~~l~~~~~~~~~~~~~~~~~~~~~~l~~~r~l~G~~~~--------------P--------------------------  132 (314)
                      |+++++++++.+++.++++++++++.++++|++.|++.+              |                          
T Consensus       232 R~~lii~lil~~i~~ll~afa~s~~~llv~R~l~G~g~g~~~p~~~~~isE~~p~~~Rg~~~g~~~~~~~iG~ila~~la  311 (742)
T TIGR01299       232 KQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEHLSWLCMFWMIGGIYAAAMA  311 (742)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999988              1                          


Q ss_pred             ------------------------------------------CC--------CCCcc----------------c--chh-
Q psy10938        133 ------------------------------------------LI--------PGHPG----------------K--VAS-  143 (314)
Q Consensus       133 ------------------------------------------l~--------~~~~~----------------~--~~~-  143 (314)
                                                                ++        +.+.+                .  ... 
T Consensus       312 ~~il~~~G~~~~~g~~~~~~gWR~l~~i~~lp~ll~ll~~~~lPESPrwL~~~gr~~eA~~iL~~i~~~n~~~~~~~~~~  391 (742)
T TIGR01299       312 WAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWMILKLIHDTNMRAKGHPEKV  391 (742)
T ss_pred             HHHHHhccchhccccccccccHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHCCCHHHHHHHHHHHhcCCCCCcCchhHH
Confidence                                                      00        00000                0  000 


Q ss_pred             --hhh--h---h----c-CCcCCC-------------------c----Ccc-----------------------------
Q psy10938        144 --VCD--V---S----A-LQPADN-------------------S----TVA-----------------------------  159 (314)
Q Consensus       144 --~~~--~---~----~-~~~~~~-------------------~----~~~-----------------------------  159 (314)
                        ..+  .   .    + ......                   .    .+.                             
T Consensus       392 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lf~~~~~~~tl~l~~~wf~~~~~yygl~~w~P~~  471 (742)
T TIGR01299       392 FSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMGVWFTLSFGYYGLSVWFPDM  471 (742)
T ss_pred             HHHHHHHHhhhhhhhhcccccccchhhcchhhhhhhhhhHHHHHHHHcCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence              000  0   0    0 000000                   0    000                             


Q ss_pred             -ccc------------------------------------------CC---------C----------------------
Q psy10938        160 -TCS------------------------------------------GE---------V----------------------  165 (314)
Q Consensus       160 -~~~------------------------------------------~~---------~----------------------  165 (314)
                       ...                                          +.         +                      
T Consensus       472 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~  551 (742)
T TIGR01299       472 IKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFEECTFDDVTSSNTFFKNCTF  551 (742)
T ss_pred             HHHHHHHHHHhhhccccccchhccccccchhhhhccccccccchhhcccccccccccccccccceeeccccchhhhccch
Confidence             000                                          00         0                      


Q ss_pred             ------------------------------------------ChhHHHHHHHHHhhhhhHHhHHHHHHHHhhhHHHHHHH
Q psy10938        166 ------------------------------------------NPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAG  203 (314)
Q Consensus       166 ------------------------------------------~~~~~~~~~~~~~~~~~~~~~~g~l~d~~g~~~~~~~~  203 (314)
                                                                .........+..++.+++.+++++++||+|||+++..+
T Consensus       552 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~l~~l~~i~G~il~g~L~Dr~GRr~~l~~~  631 (742)
T TIGR01299       552 IDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEGAYMIYFVNFLGTLAVLPGNIVSALLMDKIGRLRMLAGS  631 (742)
T ss_pred             hhhhccccchhhhhhhhhhhhhccccccCCccCccCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHH
Confidence                                                      00123345566788999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcchhHHHHHHHHHHHhhhhhchhheeeecccccchhhHHHHHHHHhhhhhhhhhHHHHHHHHHhhh
Q psy10938        204 LVLSSGVAMALYYVQTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRFGGLTGNLMFGFLIDGH  283 (314)
Q Consensus       204 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~r~~~~g~~~~~~~~g~~~~p~~~g~l~~~~  283 (314)
                      .++.+++.+++.+.++....++..++.+++.++.++....+++|++|++.|++++|+.+...++|++++|++.|.+.+..
T Consensus       632 ~~lsai~~ll~~~~~s~~~ll~~~~l~g~~~~~~~~~~~a~~aEl~Pt~~Rgta~Gi~~~~~rlGaiigp~i~g~L~~~~  711 (742)
T TIGR01299       632 MVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNALCKAAAVLGILIFGSFVGIT  711 (742)
T ss_pred             HHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999998888887776666666667777777888889999999999999999999999999999999999999988876


Q ss_pred             hHHHHHHHHHHHHHHHHHHHhcccCCCCCC
Q psy10938        284 CLILICTLAAMLLIAGVFSMFLPATGKKEL  313 (314)
Q Consensus       284 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  313 (314)
                      ...++++.+++.++++++.+++|||+++.+
T Consensus       712 ~~~pf~i~a~~lll~~ll~~~LPET~~~~l  741 (742)
T TIGR01299       712 KAAPILFASAALACGGLLALKLPDTRGQVL  741 (742)
T ss_pred             hHHHHHHHHHHHHHHHHHHHhCCCCccccc
Confidence            567888888888888888888899998875



This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.

>KOG0253|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3097|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 8e-05
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 3e-04
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Length = 375 Back     alignment and structure
 Score = 42.6 bits (101), Expect = 8e-05
 Identities = 17/101 (16%), Positives = 38/101 (37%)

Query: 29  LVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLAD 88
           L++   LL A   ++ T+    +     D  +       +  A +L       F+G ++D
Sbjct: 1   LLLMLVLLVAVGQMAQTIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQLFYGPISD 60

Query: 89  TQGRKITLIGALLVDGLCGIASSVAQYYGVFLALRFINGFA 129
             GR+  ++  + +  L  + +       V +A   + G  
Sbjct: 61  RVGRRPVILVGMSIFMLATLVAVTTSSLTVLIAASAMQGMG 101


>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.97
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.96
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.95
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.9
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.9
2cfq_A417 Lactose permease; transport, transport mechanism, 99.9
2xut_A 524 Proton/peptide symporter family protein; transport 99.82
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.42
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.42
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.41
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.4
2xut_A 524 Proton/peptide symporter family protein; transport 99.3
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.16
2cfq_A417 Lactose permease; transport, transport mechanism, 98.77
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.97  E-value=8.1e-31  Score=235.34  Aligned_cols=291  Identities=18%  Similarity=0.234  Sum_probs=210.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccc--------ccchhhHHhHhhHHHHHHhhhhhhhcccccchhHH
Q psy10938         24 KFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGM--------TSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKIT   95 (314)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------s~~~~g~~~s~~~~~~~i~~~~~g~l~dr~Grr~~   95 (314)
                      ++.+.+.+..+++.++.++|...++..+|.+.++++.        +..+.|++.+++.+|..+|++++|+++||+|||++
T Consensus         8 ~y~~~i~~~a~lg~~~~Gyd~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~s~~~~G~~iG~~~~G~laDr~GRk~~   87 (491)
T 4gc0_A            8 SYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDS   87 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHGGGGTHHHHHHHHTGGGCCCHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHH
Confidence            4556666677788899999999999999988887743        33567899999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhHHHH------------------hhhHHHHHHHHHHHhhcccC--------------C-----------
Q psy10938         96 LIGALLVDGLCGIASS------------------VAQYYGVFLALRFINGFASR--------------P-----------  132 (314)
Q Consensus        96 l~~~~~~~~~~~~~~~------------------~~~~~~~l~~~r~l~G~~~~--------------P-----------  132 (314)
                      +.++.+++.++.++++                  +++|+++++++|+++|++.|              |           
T Consensus        88 l~~~~~l~~i~~i~~a~~~~~~~~~~~~~~~~~~~a~~~~~l~~~R~l~G~g~G~~~~~~~~~i~E~~p~~~rg~~~~~~  167 (491)
T 4gc0_A           88 LKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFN  167 (491)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTTTSCSSSSSSCCGGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCGGGHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhhcchhHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCHHhhhhhHHhh
Confidence            9999999999999988                  58899999999999999988              1           


Q ss_pred             ----------------------------------------------------CC--------CCCcccch-hhhhhh---
Q psy10938        133 ----------------------------------------------------LI--------PGHPGKVA-SVCDVS---  148 (314)
Q Consensus       133 ----------------------------------------------------l~--------~~~~~~~~-~~~~~~---  148 (314)
                                                                          ++        +.+.++.. ..++..   
T Consensus       168 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~peSp~~L~~~~~~~~a~~~l~~~~~~~  247 (491)
T 4gc0_A          168 QFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNT  247 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHHHHHHHHGGGSCCCHHHHHHTTCHHHHHHHHHHHHHHH
T ss_pred             hhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhhhhhhhhhhcCCCChHHHHHcCchhHHHHhHHHhcCCc
Confidence                                                                00        00000000 000000   


Q ss_pred             --------------cCCcCCC-----cCcc---------------------------cccCCCChhHHHHHHHHHhhhhh
Q psy10938        149 --------------ALQPADN-----STVA---------------------------TCSGEVNPEVFSHTLIIGLACIP  182 (314)
Q Consensus       149 --------------~~~~~~~-----~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~~~  182 (314)
                                    +.++...     ....                           ...+.............++...+
T Consensus       248 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  327 (491)
T 4gc0_A          248 LATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLT  327 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTHHHHSCCTHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHhhhhhhhHHHHhcccHHHHHHHHHHHHHHhhhhHHHhcchHHHHhcCCCccchhhHHHHHHHHHHH
Confidence                          0000000     0000                           22344455566667777888999


Q ss_pred             HHhHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhc----chhHHHHHHHHH-HHhhhhhchhheeeecccccchhhHHH
Q psy10938        183 SSLAMPLLVHKMGAKWFLVAGLVLSSGVAMALYYVQ----TSTQNLILSCIF-EALTGCCISVVYCIMVDLFPTNLRVLA  257 (314)
Q Consensus       183 ~~~~~g~l~d~~g~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~p~~~r~~~  257 (314)
                      +.++++++.||+|||+.+..+.....++++.+....    +.+.......+. ..+.....+..+.+.+|++|++.|+++
T Consensus       328 ~~~~~~~l~dr~Grr~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~R~~~  407 (491)
T 4gc0_A          328 FTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKA  407 (491)
T ss_dssp             HHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTTHHHH
T ss_pred             HHHHHHHHHHhhcCcchhccchHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhHHHHH
Confidence            999999999999999999888888777766554321    122222222222 223344456778899999999999999


Q ss_pred             HHHHHhhhhhhhhhHHHHHHHHHhhhh-------HHHHHHHHHHHHHHHHHH-HhcccCCCCCCC
Q psy10938        258 AALSSTFGRFGGLTGNLMFGFLIDGHC-------LILICTLAAMLLIAGVFS-MFLPATGKKELD  314 (314)
Q Consensus       258 ~g~~~~~~~~g~~~~p~~~g~l~~~~~-------~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~  314 (314)
                      .|+.+..+++++.+++.+.+.+.+..+       ...+++++++++++.++. +++||||+|++|
T Consensus       408 ~g~~~~~~~~~~~i~~~~~p~l~~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~tLe  472 (491)
T 4gc0_A          408 LAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLE  472 (491)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTCCHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCCCCCCHH
Confidence            999999999999999999887765422       345777888887777765 456999999763



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 314
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 8e-07
d1pv7a_ 417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 0.002
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 47.8 bits (112), Expect = 8e-07
 Identities = 18/128 (14%), Positives = 40/128 (31%), Gaps = 5/128 (3%)

Query: 22  YGKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSY 81
           Y +  + + +     YA   +     +  +P    + G +  D G+  +   +   F  +
Sbjct: 19  YRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLV-EQGFSRGDLGFALSGISIAYGFSKF 77

Query: 82  FWGCLADTQGRKITLIGALLVDGL----CGIASSVAQYYGVFLALRFINGFASRPLIPGH 137
             G ++D    ++ L   L++        G          V   L F+ G+      P  
Sbjct: 78  IMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPC 137

Query: 138 PGKVASVC 145
              +    
Sbjct: 138 GRTMVHWW 145


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.96
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.94
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.37
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.05
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=5.3e-29  Score=218.23  Aligned_cols=281  Identities=12%  Similarity=0.137  Sum_probs=203.5

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccccccchhhHHhHhhHHHHHHhhhhhhhcccccchhHHHHHHHHH
Q psy10938         23 GKFHYILVIFGGLLYAYAAISITVLSFVLPSAQCDFGMTSSDKGWLNAAPMLGMVFGSYFWGCLADTQGRKITLIGALLV  102 (314)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~g~~~s~~~~~~~i~~~~~g~l~dr~Grr~~l~~~~~~  102 (314)
                      ++++|.++..++++++..+.++..++.+.|.++ |+|+|.+|.|++.+++.+++.++++++|+++||+|||+++..+.++
T Consensus        20 ~~~~w~i~~~~~~~~~~~~~~~~~~~~~~p~~~-~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~   98 (447)
T d1pw4a_          20 RRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLV-EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLIL   98 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTSHHHHHHHTT-SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHH
Confidence            467888888888899999999988898889876 5899999999999999999999999999999999999999999999


Q ss_pred             HHHHhHHHHhhh----HHHHHHHHHHHhhcccC--------------C--------------------------------
Q psy10938        103 DGLCGIASSVAQ----YYGVFLALRFINGFASR--------------P--------------------------------  132 (314)
Q Consensus       103 ~~~~~~~~~~~~----~~~~l~~~r~l~G~~~~--------------P--------------------------------  132 (314)
                      .+++.+++++++    +++.+++.|++.|++.+              |                                
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~  178 (447)
T d1pw4a_          99 AAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAW  178 (447)
T ss_dssp             HHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHH
T ss_pred             HHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhh
Confidence            999999888764    67789999999999887              1                                


Q ss_pred             -------------------------CCCCCcc--------cchhhhhhhcCCcCCCc------------Ccc--------
Q psy10938        133 -------------------------LIPGHPG--------KVASVCDVSALQPADNS------------TVA--------  159 (314)
Q Consensus       133 -------------------------l~~~~~~--------~~~~~~~~~~~~~~~~~------------~~~--------  159 (314)
                                               +++.+++        .+....+..+.+.+++.            .+.        
T Consensus       179 ~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  258 (447)
T d1pw4a_         179 FNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIAN  258 (447)
T ss_dssp             TCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHH
T ss_pred             hhcccccchhhhhhHHHHHHHHHHhcccchhhcccchhhhhhhhcccchhhccccccchhhHHHHHHHcCchHHHHHHHh
Confidence                                     1110000        00000000000000000            000        


Q ss_pred             -------------------cccCCCChhHHHHHHHHHhhhhhHHhHHHHHHHHhhhHHHHHHHHHHHH---HHHHHHHHh
Q psy10938        160 -------------------TCSGEVNPEVFSHTLIIGLACIPSSLAMPLLVHKMGAKWFLVAGLVLSS---GVAMALYYV  217 (314)
Q Consensus       160 -------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~d~~g~~~~~~~~~~~~~---~~~~~~~~~  217 (314)
                                         +..+.+..+.+.......+..+++.++.|++.||++|++..........   ++.......
T Consensus       259 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  338 (447)
T d1pw4a_         259 VFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMN  338 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHTTSC
T ss_pred             hhhhhhhhcchhhhhhhcccccccccchhhhhhhcchhhhhhhhhhhhhhhhhccccccccccchhHHHHHHHHHHHHhc
Confidence                               3445677788888899999999999999999999987654333322222   222222221


Q ss_pred             --cchhHHHHHHHHHHHhhhhhchhheeeecccccchhhHHHHHHHHhhhhh-hhhhHHHHHHHHHhhhh-HHHHHHHHH
Q psy10938        218 --QTSTQNLILSCIFEALTGCCISVVYCIMVDLFPTNLRVLAAALSSTFGRF-GGLTGNLMFGFLIDGHC-LILICTLAA  293 (314)
Q Consensus       218 --~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~r~~~~g~~~~~~~~-g~~~~p~~~g~l~~~~~-~~~~~~~~~  293 (314)
                        .+.+......++.+++.....+....+..|.+|++.|+++.|+.+.+.++ |...+|.+.|.+.|..| ...+++.++
T Consensus       339 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~~~g~~~~~~~~~~  418 (447)
T d1pw4a_         339 PAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIG  418 (447)
T ss_dssp             CTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSHHHHHHHHH
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHH
Confidence              23444455556667777777888888999999999999999999999887 45678999999999987 555666666


Q ss_pred             HHHHHHHHHHh
Q psy10938        294 MLLIAGVFSMF  304 (314)
Q Consensus       294 ~~~~~~~~~~~  304 (314)
                      +.+++.++..+
T Consensus       419 ~~~~~~~~~~~  429 (447)
T d1pw4a_         419 GSILAVILLIV  429 (447)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            66665555443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure