Psyllid ID: psy10964
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 242011753 | 474 | G-protein coupled octopamine receptor, p | 0.825 | 0.179 | 0.588 | 3e-20 | |
| 328710440 | 502 | PREDICTED: neuropeptides capa receptor-l | 0.660 | 0.135 | 0.705 | 5e-19 | |
| 340710406 | 465 | PREDICTED: neuropeptides capa receptor-l | 0.728 | 0.161 | 0.586 | 1e-17 | |
| 350415577 | 465 | PREDICTED: neuropeptides capa receptor-l | 0.728 | 0.161 | 0.586 | 1e-17 | |
| 307207300 | 533 | Neuropeptides capa receptor [Harpegnatho | 0.728 | 0.140 | 0.573 | 3e-17 | |
| 383856235 | 659 | PREDICTED: G-protein coupled receptor 16 | 0.737 | 0.115 | 0.571 | 4e-17 | |
| 383853616 | 456 | PREDICTED: neuropeptides capa receptor-l | 0.728 | 0.164 | 0.586 | 5e-17 | |
| 345481477 | 603 | PREDICTED: neuropeptide Y receptor-like | 0.747 | 0.127 | 0.555 | 2e-16 | |
| 148277568 | 381 | capa receptor-like GPCR [Apis mellifera] | 0.728 | 0.196 | 0.586 | 2e-16 | |
| 118780947 | 493 | AGAP000658-PA [Anopheles gambiae str. PE | 0.631 | 0.131 | 0.646 | 3e-16 |
| >gi|242011753|ref|XP_002426611.1| G-protein coupled octopamine receptor, putative [Pediculus humanus corporis] gi|212510760|gb|EEB13873.1| G-protein coupled octopamine receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 102 bits (254), Expect = 3e-20, Method: Compositional matrix adjust.
Identities = 50/85 (58%), Positives = 65/85 (76%)
Query: 18 SMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINN 77
+ +D ++N ++E YL GPK L ++ ++P+T++Y IFVTG+ GNI+VCVVII N
Sbjct: 20 TRDDEDSVNFNISLEQYLLRTLGPKHLALTTVIPLTVIYIFIFVTGIFGNISVCVVIIKN 79
Query: 78 TSLHTATNYYLFSLAVSDLTLLLLG 102
SLHTATNYYLFSLAVSDLTLL LG
Sbjct: 80 PSLHTATNYYLFSLAVSDLTLLTLG 104
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328710440|ref|XP_001950333.2| PREDICTED: neuropeptides capa receptor-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|340710406|ref|XP_003393782.1| PREDICTED: neuropeptides capa receptor-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350415577|ref|XP_003490685.1| PREDICTED: neuropeptides capa receptor-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307207300|gb|EFN85050.1| Neuropeptides capa receptor [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383856235|ref|XP_003703615.1| PREDICTED: G-protein coupled receptor 161-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383853616|ref|XP_003702318.1| PREDICTED: neuropeptides capa receptor-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345481477|ref|XP_001606201.2| PREDICTED: neuropeptide Y receptor-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|148277568|ref|NP_001091702.1| capa receptor-like GPCR [Apis mellifera] gi|77921736|gb|ABB05503.1| capa receptor-like GPCR [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|118780947|ref|XP_311184.3| AGAP000658-PA [Anopheles gambiae str. PEST] gi|34419232|tpg|DAA01375.1| TPA_exp: putative pyrokinin receptor [Anopheles gambiae str. PEST] gi|116130188|gb|EAA06972.3| AGAP000658-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| FB|FBgn0038201 | 430 | Pk1r "Pyrokinin 1 receptor" [D | 0.466 | 0.111 | 0.562 | 4.1e-11 | |
| FB|FBgn0037100 | 477 | capaR "capa receptor" [Drosoph | 0.601 | 0.129 | 0.435 | 1e-10 | |
| UNIPROTKB|Q9GZQ4 | 415 | NMUR2 "Neuromedin-U receptor 2 | 0.689 | 0.171 | 0.432 | 1.3e-10 | |
| MGI|MGI:2441765 | 395 | Nmur2 "neuromedin U receptor 2 | 0.669 | 0.174 | 0.493 | 1.5e-10 | |
| UNIPROTKB|F1RQB8 | 407 | NMUR2 "Uncharacterized protein | 0.737 | 0.186 | 0.392 | 7.4e-10 | |
| UNIPROTKB|Q58CW4 | 407 | NMUR2 "Neuromedin-U receptor 2 | 0.689 | 0.174 | 0.418 | 1.6e-09 | |
| UNIPROTKB|E1BX29 | 395 | NMUR2 "Neuromedin U receptor t | 0.543 | 0.141 | 0.5 | 1.9e-09 | |
| RGD|621155 | 395 | Nmur2 "neuromedin U receptor 2 | 0.669 | 0.174 | 0.438 | 3.1e-09 | |
| UNIPROTKB|E2RBT8 | 378 | NMUR2 "Uncharacterized protein | 0.543 | 0.148 | 0.465 | 2.6e-07 | |
| WB|WBGene00019616 | 403 | nmur-2 [Caenorhabditis elegans | 0.592 | 0.151 | 0.370 | 7.9e-07 |
| FB|FBgn0038201 Pk1r "Pyrokinin 1 receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 161 (61.7 bits), Expect = 4.1e-11, P = 4.1e-11
Identities = 27/48 (56%), Positives = 39/48 (81%)
Query: 40 GPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYY 87
GP R +++++P+T+VY IF+TGV+GNI+ C+VI N S+HTATNYY
Sbjct: 11 GPPRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYY 58
|
|
| FB|FBgn0037100 capaR "capa receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GZQ4 NMUR2 "Neuromedin-U receptor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2441765 Nmur2 "neuromedin U receptor 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQB8 NMUR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58CW4 NMUR2 "Neuromedin-U receptor 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BX29 NMUR2 "Neuromedin U receptor type 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|621155 Nmur2 "neuromedin U receptor 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBT8 NMUR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00019616 nmur-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| pfam00001 | 251 | pfam00001, 7tm_1, 7 transmembrane receptor (rhodop | 0.004 |
| >gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) | Back alignment and domain information |
|---|
Score = 34.6 bits (80), Expect = 0.004
Identities = 14/30 (46%), Positives = 19/30 (63%)
Query: 72 VVIINNTSLHTATNYYLFSLAVSDLTLLLL 101
+VI+ L T TN +L +LAV+DL LL
Sbjct: 1 LVILRTKKLRTPTNIFLLNLAVADLLFLLT 30
|
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| KOG4219|consensus | 423 | 99.17 | ||
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 99.08 | |
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 98.69 | |
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 98.66 | |
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 98.63 | |
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 98.38 | |
| KOG4220|consensus | 503 | 98.36 | ||
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 98.12 | |
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 97.97 | |
| KOG2087|consensus | 363 | 95.79 | ||
| PF10328 | 274 | 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept | 95.34 | |
| PF05296 | 303 | TAS2R: Mammalian taste receptor protein (TAS2R); I | 95.33 | |
| PF10324 | 318 | 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept | 94.83 | |
| PF05462 | 303 | Dicty_CAR: Slime mold cyclic AMP receptor | 91.94 | |
| PF10321 | 313 | 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept | 90.9 | |
| PF10317 | 292 | 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept | 88.79 | |
| PF11710 | 201 | Git3: G protein-coupled glucose receptor regulatin | 84.19 |
| >KOG4219|consensus | Back alignment and domain information |
|---|
Probab=99.17 E-value=8.5e-12 Score=91.02 Aligned_cols=60 Identities=28% Similarity=0.431 Sum_probs=55.1
Q ss_pred CCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhc
Q psy10964 43 RLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLG 102 (103)
Q Consensus 43 ~~~~~~~~~~~~~~~~i~~~~~~gN~~vl~~~~~~~~l~~~~~~fl~nLa~~Dll~~~~~ 102 (103)
..|.+++.++.++|..+..++++||++|+|++..+|++|+.+|+||+|||+||++.++|+
T Consensus 29 ~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn 88 (423)
T KOG4219|consen 29 VLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFN 88 (423)
T ss_pred cCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHh
Confidence 345567788999999999999999999999999999999999999999999999999886
|
|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4220|consensus | Back alignment and domain information |
|---|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) | Back alignment and domain information |
|---|
| >PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF05462 Dicty_CAR: Slime mold cyclic AMP receptor | Back alignment and domain information |
|---|
| >PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] | Back alignment and domain information |
|---|
| >PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 3e-14 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 2e-13 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 2e-12 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 2e-11 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 2e-11 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 4e-11 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 7e-11 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 1e-10 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 1e-10 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 2e-10 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 2e-10 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 4e-10 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 5e-10 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 1e-09 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 4e-09 |
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 99.3 | |
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 99.16 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 99.15 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 99.15 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 99.14 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 99.1 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 99.05 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 99.05 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 99.03 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 99.02 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 99.02 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 99.01 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 99.0 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 98.99 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 98.98 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 98.94 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 98.93 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 98.89 | |
| 2lot_A | 64 | Apelin receptor; membrane protein; NMR {Homo sapie | 96.8 |
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.30 E-value=9.7e-12 Score=85.26 Aligned_cols=52 Identities=31% Similarity=0.496 Sum_probs=48.3
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHh
Q psy10964 49 LLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLL 100 (103)
Q Consensus 49 ~~~~~~~~~~i~~~~~~gN~~vl~~~~~~~~l~~~~~~fl~nLa~~Dll~~~ 100 (103)
+.+..++|.+++++|++||+++++++.++|++|+|+|+|+.|||++|+++++
T Consensus 11 ~~i~~i~y~ii~i~gv~gN~lvi~vi~~~~~lrt~~n~~i~nLAvaDll~~l 62 (296)
T 2lnl_A 11 KYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFAL 62 (296)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCSTTHHHHHHHHHHHHHHHH
T ss_pred HHhHHHHHHHHHHHHHHHHHHHHHHHHHccCCCChHHHHHHHHHHHHHHHHH
Confidence 4667788999999999999999999999999999999999999999998865
|
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 103 | ||||
| d1u19a_ | 348 | f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: | 7e-09 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Score = 49.2 bits (116), Expect = 7e-09
Identities = 15/51 (29%), Positives = 24/51 (47%)
Query: 52 ITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLG 102
+ F + + G N V + + L T NY L +LAV+DL ++ G
Sbjct: 40 LAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGG 90
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 99.15 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.15 E-value=1.9e-10 Score=78.29 Aligned_cols=55 Identities=25% Similarity=0.321 Sum_probs=49.2
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhh
Q psy10964 47 SVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLL 101 (103)
Q Consensus 47 ~~~~~~~~~~~~i~~~~~~gN~~vl~~~~~~~~l~~~~~~fl~nLa~~Dll~~~~ 101 (103)
+...++.+++.+++++|++||+++++++.++|++|++.|+++.|||++|++.++.
T Consensus 35 ~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~ 89 (348)
T d1u19a_ 35 WQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFG 89 (348)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHH
Confidence 3445677888999999999999999999999999999999999999999998765
|