Psyllid ID: psy10964


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MEELESFLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
cHHHHccccccHHHHcccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHcccEHHccccccccHHHccccHHHHHHHHcccccccccEEEEEEEEEEHHEHHHHHHHHEEEHHEEHccccccHHHHHHHHHHHHHHHHHHHcc
MEELESFLADDMivyncsmndsmitsynWTVEHYLYcmrgpkrlhmsvlLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
MEELESFLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
MEELESFLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYlfslavsdltllllGR
******FLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLL**
****E*F*ADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
MEELESFLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
MEELESFLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELESFLADDMIVYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
Q9GZQ4 415 Neuromedin-U receptor 2 O yes N/A 0.834 0.207 0.505 1e-13
Q8BZ39 395 Neuromedin-U receptor 2 O yes N/A 0.786 0.205 0.547 1e-13
Q9ESQ4 395 Neuromedin-U receptor 2 O yes N/A 0.786 0.205 0.5 2e-12
O55040 405 Neuromedin-U receptor 1 O no N/A 0.592 0.150 0.492 2e-10
Q8ITC7 477 Neuropeptides capa recept no N/A 0.805 0.174 0.481 3e-09
Q58CW4 407 Neuromedin-U receptor 2 O yes N/A 0.669 0.169 0.563 1e-07
Q9JJI5 412 Neuromedin-U receptor 1 O no N/A 0.475 0.118 0.450 1e-06
Q9HB89 426 Neuromedin-U receptor 1 O no N/A 0.475 0.115 0.431 1e-05
Q9EQD2 417 Neuropeptide FF receptor no N/A 0.398 0.098 0.512 2e-05
O43193 412 Motilin receptor OS=Homo no N/A 0.533 0.133 0.436 2e-05
>sp|Q9GZQ4|NMUR2_HUMAN Neuromedin-U receptor 2 OS=Homo sapiens GN=NMUR2 PE=2 SV=2 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 59/89 (66%), Gaps = 3/89 (3%)

Query: 14  VYNCSMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVV 73
           +Y   + D      N T E YL  + GP+R H    LP+++VY  IFV GVIGN+ VC+V
Sbjct: 13  IYQQKLEDPFQKHLNST-EEYLAFLCGPRRSHF--FLPVSVVYVPIFVVGVIGNVLVCLV 69

Query: 74  IINNTSLHTATNYYLFSLAVSDLTLLLLG 102
           I+ + ++ T TNYYLFSLAVSDL +LLLG
Sbjct: 70  ILQHQAMKTPTNYYLFSLAVSDLLVLLLG 98




Receptor for the neuromedin-U and neuromedin-S neuropeptides.
Homo sapiens (taxid: 9606)
>sp|Q8BZ39|NMUR2_MOUSE Neuromedin-U receptor 2 OS=Mus musculus GN=Nmur2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ESQ4|NMUR2_RAT Neuromedin-U receptor 2 OS=Rattus norvegicus GN=Nmur2 PE=1 SV=2 Back     alignment and function description
>sp|O55040|NMUR1_MOUSE Neuromedin-U receptor 1 OS=Mus musculus GN=Nmur1 PE=2 SV=1 Back     alignment and function description
>sp|Q8ITC7|CAPAR_DROME Neuropeptides capa receptor OS=Drosophila melanogaster GN=capaR PE=2 SV=3 Back     alignment and function description
>sp|Q58CW4|NMUR2_BOVIN Neuromedin-U receptor 2 OS=Bos taurus GN=NMUR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JJI5|NMUR1_RAT Neuromedin-U receptor 1 OS=Rattus norvegicus GN=Nmur1 PE=1 SV=1 Back     alignment and function description
>sp|Q9HB89|NMUR1_HUMAN Neuromedin-U receptor 1 OS=Homo sapiens GN=NMUR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9EQD2|NPFF2_RAT Neuropeptide FF receptor 2 OS=Rattus norvegicus GN=Npffr2 PE=2 SV=1 Back     alignment and function description
>sp|O43193|MTLR_HUMAN Motilin receptor OS=Homo sapiens GN=MLNR PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
242011753 474 G-protein coupled octopamine receptor, p 0.825 0.179 0.588 3e-20
328710440 502 PREDICTED: neuropeptides capa receptor-l 0.660 0.135 0.705 5e-19
340710406 465 PREDICTED: neuropeptides capa receptor-l 0.728 0.161 0.586 1e-17
350415577 465 PREDICTED: neuropeptides capa receptor-l 0.728 0.161 0.586 1e-17
307207300 533 Neuropeptides capa receptor [Harpegnatho 0.728 0.140 0.573 3e-17
383856235 659 PREDICTED: G-protein coupled receptor 16 0.737 0.115 0.571 4e-17
383853616 456 PREDICTED: neuropeptides capa receptor-l 0.728 0.164 0.586 5e-17
345481477 603 PREDICTED: neuropeptide Y receptor-like 0.747 0.127 0.555 2e-16
148277568 381 capa receptor-like GPCR [Apis mellifera] 0.728 0.196 0.586 2e-16
118780947 493 AGAP000658-PA [Anopheles gambiae str. PE 0.631 0.131 0.646 3e-16
>gi|242011753|ref|XP_002426611.1| G-protein coupled octopamine receptor, putative [Pediculus humanus corporis] gi|212510760|gb|EEB13873.1| G-protein coupled octopamine receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 65/85 (76%)

Query: 18  SMNDSMITSYNWTVEHYLYCMRGPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINN 77
           + +D    ++N ++E YL    GPK L ++ ++P+T++Y  IFVTG+ GNI+VCVVII N
Sbjct: 20  TRDDEDSVNFNISLEQYLLRTLGPKHLALTTVIPLTVIYIFIFVTGIFGNISVCVVIIKN 79

Query: 78  TSLHTATNYYLFSLAVSDLTLLLLG 102
            SLHTATNYYLFSLAVSDLTLL LG
Sbjct: 80  PSLHTATNYYLFSLAVSDLTLLTLG 104




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328710440|ref|XP_001950333.2| PREDICTED: neuropeptides capa receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340710406|ref|XP_003393782.1| PREDICTED: neuropeptides capa receptor-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415577|ref|XP_003490685.1| PREDICTED: neuropeptides capa receptor-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307207300|gb|EFN85050.1| Neuropeptides capa receptor [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383856235|ref|XP_003703615.1| PREDICTED: G-protein coupled receptor 161-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|383853616|ref|XP_003702318.1| PREDICTED: neuropeptides capa receptor-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345481477|ref|XP_001606201.2| PREDICTED: neuropeptide Y receptor-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|148277568|ref|NP_001091702.1| capa receptor-like GPCR [Apis mellifera] gi|77921736|gb|ABB05503.1| capa receptor-like GPCR [Apis mellifera] Back     alignment and taxonomy information
>gi|118780947|ref|XP_311184.3| AGAP000658-PA [Anopheles gambiae str. PEST] gi|34419232|tpg|DAA01375.1| TPA_exp: putative pyrokinin receptor [Anopheles gambiae str. PEST] gi|116130188|gb|EAA06972.3| AGAP000658-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
FB|FBgn0038201 430 Pk1r "Pyrokinin 1 receptor" [D 0.466 0.111 0.562 4.1e-11
FB|FBgn0037100 477 capaR "capa receptor" [Drosoph 0.601 0.129 0.435 1e-10
UNIPROTKB|Q9GZQ4 415 NMUR2 "Neuromedin-U receptor 2 0.689 0.171 0.432 1.3e-10
MGI|MGI:2441765 395 Nmur2 "neuromedin U receptor 2 0.669 0.174 0.493 1.5e-10
UNIPROTKB|F1RQB8 407 NMUR2 "Uncharacterized protein 0.737 0.186 0.392 7.4e-10
UNIPROTKB|Q58CW4 407 NMUR2 "Neuromedin-U receptor 2 0.689 0.174 0.418 1.6e-09
UNIPROTKB|E1BX29 395 NMUR2 "Neuromedin U receptor t 0.543 0.141 0.5 1.9e-09
RGD|621155 395 Nmur2 "neuromedin U receptor 2 0.669 0.174 0.438 3.1e-09
UNIPROTKB|E2RBT8 378 NMUR2 "Uncharacterized protein 0.543 0.148 0.465 2.6e-07
WB|WBGene00019616 403 nmur-2 [Caenorhabditis elegans 0.592 0.151 0.370 7.9e-07
FB|FBgn0038201 Pk1r "Pyrokinin 1 receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 161 (61.7 bits), Expect = 4.1e-11, P = 4.1e-11
 Identities = 27/48 (56%), Positives = 39/48 (81%)

Query:    40 GPKRLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYY 87
             GP R  +++++P+T+VY  IF+TGV+GNI+ C+VI  N S+HTATNYY
Sbjct:    11 GPPRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYY 58




GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS;NAS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0016520 "growth hormone-releasing hormone receptor activity" evidence=ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS;IDA;NAS
GO:0004930 "G-protein coupled receptor activity" evidence=ISS;IDA
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0007218 "neuropeptide signaling pathway" evidence=IDA
FB|FBgn0037100 capaR "capa receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GZQ4 NMUR2 "Neuromedin-U receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2441765 Nmur2 "neuromedin U receptor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQB8 NMUR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CW4 NMUR2 "Neuromedin-U receptor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BX29 NMUR2 "Neuromedin U receptor type 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|621155 Nmur2 "neuromedin U receptor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBT8 NMUR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00019616 nmur-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BZ39NMUR2_MOUSENo assigned EC number0.54760.78640.2050yesN/A
Q58CW4NMUR2_BOVINNo assigned EC number0.56330.66990.1695yesN/A
Q9GZQ4NMUR2_HUMANNo assigned EC number0.50560.83490.2072yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
pfam00001 251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 0.004
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
 Score = 34.6 bits (80), Expect = 0.004
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 72  VVIINNTSLHTATNYYLFSLAVSDLTLLLL 101
           +VI+    L T TN +L +LAV+DL  LL 
Sbjct: 1   LVILRTKKLRTPTNIFLLNLAVADLLFLLT 30


This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
KOG4219|consensus 423 99.17
PHA03234 338 DNA packaging protein UL33; Provisional 99.08
PHA02834 323 chemokine receptor-like protein; Provisional 98.69
PHA02638 417 CC chemokine receptor-like protein; Provisional 98.66
PHA03235 409 DNA packaging protein UL33; Provisional 98.63
PHA03087 335 G protein-coupled chemokine receptor-like protein; 98.38
KOG4220|consensus 503 98.36
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 98.12
PF10320 257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 97.97
KOG2087|consensus 363 95.79
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 95.34
PF05296 303 TAS2R: Mammalian taste receptor protein (TAS2R); I 95.33
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 94.83
PF05462 303 Dicty_CAR: Slime mold cyclic AMP receptor 91.94
PF10321 313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 90.9
PF10317 292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 88.79
PF11710 201 Git3: G protein-coupled glucose receptor regulatin 84.19
>KOG4219|consensus Back     alignment and domain information
Probab=99.17  E-value=8.5e-12  Score=91.02  Aligned_cols=60  Identities=28%  Similarity=0.431  Sum_probs=55.1

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhc
Q psy10964         43 RLHMSVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLG  102 (103)
Q Consensus        43 ~~~~~~~~~~~~~~~~i~~~~~~gN~~vl~~~~~~~~l~~~~~~fl~nLa~~Dll~~~~~  102 (103)
                      ..|.+++.++.++|..+..++++||++|+|++..+|++|+.+|+||+|||+||++.++|+
T Consensus        29 ~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn   88 (423)
T KOG4219|consen   29 VLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFN   88 (423)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHh
Confidence            345567788999999999999999999999999999999999999999999999999886



>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 3e-14
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 2e-13
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 2e-12
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 2e-11
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-11
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 4e-11
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 7e-11
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 1e-10
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 1e-10
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 2e-10
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-10
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 4e-10
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 5e-10
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 1e-09
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 4e-09
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.3
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.16
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.15
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.15
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.14
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.1
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.05
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.05
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.03
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.02
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.02
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.01
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.0
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 98.99
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 98.98
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 98.94
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 98.93
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 98.89
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 96.8
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
Probab=99.30  E-value=9.7e-12  Score=85.26  Aligned_cols=52  Identities=31%  Similarity=0.496  Sum_probs=48.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHh
Q psy10964         49 LLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLL  100 (103)
Q Consensus        49 ~~~~~~~~~~i~~~~~~gN~~vl~~~~~~~~l~~~~~~fl~nLa~~Dll~~~  100 (103)
                      +.+..++|.+++++|++||+++++++.++|++|+|+|+|+.|||++|+++++
T Consensus        11 ~~i~~i~y~ii~i~gv~gN~lvi~vi~~~~~lrt~~n~~i~nLAvaDll~~l   62 (296)
T 2lnl_A           11 KYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFAL   62 (296)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCSTTHHHHHHHHHHHHHHHH
T ss_pred             HHhHHHHHHHHHHHHHHHHHHHHHHHHHccCCCChHHHHHHHHHHHHHHHHH
Confidence            4667788999999999999999999999999999999999999999998865



>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d1u19a_ 348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 7e-09
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 49.2 bits (116), Expect = 7e-09
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 52  ITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLLG 102
           +    F + + G   N     V + +  L T  NY L +LAV+DL ++  G
Sbjct: 40  LAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGG 90


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.15
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.15  E-value=1.9e-10  Score=78.29  Aligned_cols=55  Identities=25%  Similarity=0.321  Sum_probs=49.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhh
Q psy10964         47 SVLLPITIVYFGIFVTGVIGNIAVCVVIINNTSLHTATNYYLFSLAVSDLTLLLL  101 (103)
Q Consensus        47 ~~~~~~~~~~~~i~~~~~~gN~~vl~~~~~~~~l~~~~~~fl~nLa~~Dll~~~~  101 (103)
                      +...++.+++.+++++|++||+++++++.++|++|++.|+++.|||++|++.++.
T Consensus        35 ~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~   89 (348)
T d1u19a_          35 WQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFG   89 (348)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHH
Confidence            3445677888999999999999999999999999999999999999999998765