Psyllid ID: psy11027

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDSAESRDDAIE
ccHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccc
ccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccc
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKfpdalrpafprlkekledpdsgvqSAAVNVVCELArknpknylsLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELArknpknylsLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGefrehldspraTLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDSaesrddaie
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKekledpdsgvQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARIldsaesrddaie
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKlvlyavlyaaaWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDSAESRDDAIE
**************NQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFP**************SAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARIL***********
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDS*********
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEK*********SAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDS*********
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDSAESRD****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKLVLYAVLYAAAWICGEFREHLDSPRATLEAMTRRGLSLLPGHIQAVYVQNMLKILARILDSAESRDDAIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
P54362 1034 AP-3 complex subunit delt yes N/A 0.527 0.128 0.851 8e-66
O14617 1153 AP-3 complex subunit delt yes N/A 0.535 0.117 0.785 1e-61
O54774 1199 AP-3 complex subunit delt yes N/A 0.535 0.112 0.785 1e-61
Q865S1 1207 AP-3 complex subunit delt yes N/A 0.535 0.111 0.785 1e-61
Q54WN0 1143 AP-3 complex subunit delt yes N/A 0.535 0.118 0.566 1e-41
Q9UTL8 825 AP-3 complex subunit delt yes N/A 0.535 0.163 0.511 6e-37
Q08951 932 AP-3 complex subunit delt yes N/A 0.638 0.172 0.396 7e-33
Q755A1 899 AP-3 complex subunit delt yes N/A 0.642 0.180 0.377 2e-31
Q9C744 869 AP-3 complex subunit delt yes N/A 0.535 0.155 0.466 2e-30
Q5R5M2 822 AP-1 complex subunit gamm no N/A 0.476 0.145 0.333 1e-13
>sp|P54362|AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster GN=g PE=1 SV=4 Back     alignment and function desciption
 Score =  250 bits (638), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 128/135 (94%)

Query: 1   MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLM 60
           MLTTNMIRKDLN+QNQYDAG+ALS L+CF S DL+RDLANDIM L++STKPYLR KAVLM
Sbjct: 111 MLTTNMIRKDLNSQNQYDAGVALSGLSCFISPDLSRDLANDIMTLMSSTKPYLRMKAVLM 170

Query: 61  MYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLM 120
           MYKVFL++P+ALRPAFP+LKEKLEDPD GVQSAAVNV+CELARKNPKNYL LAP+FFKLM
Sbjct: 171 MYKVFLRYPEALRPAFPKLKEKLEDPDPGVQSAAVNVICELARKNPKNYLPLAPIFFKLM 230

Query: 121 TTSSNNWMLIKIIKL 135
           TTS+NNWMLIKIIKL
Sbjct: 231 TTSTNNWMLIKIIKL 245
May be a coat protein involved in the formation of specialized structures like pigment granules.
Drosophila melanogaster (taxid: 7227)
>sp|O14617|AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens GN=AP3D1 PE=1 SV=1 Back     alignment and function description
>sp|O54774|AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus GN=Ap3d1 PE=1 SV=1 Back     alignment and function description
>sp|Q865S1|AP3D1_BOVIN AP-3 complex subunit delta-1 OS=Bos taurus GN=AP3D1 PE=1 SV=2 Back     alignment and function description
>sp|Q54WN0|AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum GN=ap3d1 PE=3 SV=1 Back     alignment and function description
>sp|Q9UTL8|AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl5 PE=3 SV=2 Back     alignment and function description
>sp|Q08951|AP3D_YEAST AP-3 complex subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL5 PE=1 SV=1 Back     alignment and function description
>sp|Q755A1|AP3D_ASHGO AP-3 complex subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL5 PE=3 SV=1 Back     alignment and function description
>sp|Q9C744|AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana GN=DELTA-ADR PE=1 SV=1 Back     alignment and function description
>sp|Q5R5M2|AP1G1_PONAB AP-1 complex subunit gamma-1 OS=Pongo abelii GN=AP1G1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
350402396 1189 PREDICTED: AP-3 complex subunit delta-1- 0.416 0.088 0.925 2e-68
340711936 1189 PREDICTED: AP-3 complex subunit delta-1- 0.416 0.088 0.925 2e-68
380025614 1189 PREDICTED: LOW QUALITY PROTEIN: AP-3 com 0.412 0.087 0.925 4e-68
328790270 1189 PREDICTED: AP-3 complex subunit delta-1 0.412 0.087 0.925 4e-68
383849410 1200 PREDICTED: AP-3 complex subunit delta-1- 0.392 0.082 0.918 6e-68
307204535 1197 AP-3 complex subunit delta-1 [Harpegnath 0.416 0.087 0.918 1e-67
322785824 1147 hypothetical protein SINV_04691 [Solenop 0.535 0.117 0.918 2e-67
307189900 1111 AP-3 complex subunit delta-1 [Camponotus 0.416 0.094 0.918 2e-67
332025161 1198 AP-3 complex subunit delta-1 [Acromyrmex 0.535 0.112 0.918 2e-67
242008067 1295 AP-3 complex subunit delta-1, putative [ 0.531 0.103 0.896 3e-67
>gi|350402396|ref|XP_003486469.1| PREDICTED: AP-3 complex subunit delta-1-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/135 (92%), Positives = 131/135 (97%)

Query: 1   MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLM 60
           MLTTNMIRKDLN+QNQYDAGLALS L+CF S+DLARDL NDIM LLTSTKPYLRKKAVLM
Sbjct: 110 MLTTNMIRKDLNSQNQYDAGLALSGLSCFISSDLARDLVNDIMTLLTSTKPYLRKKAVLM 169

Query: 61  MYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLM 120
           MYKVFL+FP+ALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLM
Sbjct: 170 MYKVFLRFPEALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLM 229

Query: 121 TTSSNNWMLIKIIKL 135
           TTS+NNWMLIKIIKL
Sbjct: 230 TTSTNNWMLIKIIKL 244

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340711936|ref|XP_003394522.1| PREDICTED: AP-3 complex subunit delta-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380025614|ref|XP_003696565.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-1-like [Apis florea] Back     alignment and taxonomy information
>gi|328790270|ref|XP_395563.4| PREDICTED: AP-3 complex subunit delta-1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383849410|ref|XP_003700338.1| PREDICTED: AP-3 complex subunit delta-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307204535|gb|EFN83215.1| AP-3 complex subunit delta-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322785824|gb|EFZ12443.1| hypothetical protein SINV_04691 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307189900|gb|EFN74144.1| AP-3 complex subunit delta-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332025161|gb|EGI65341.1| AP-3 complex subunit delta-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242008067|ref|XP_002424834.1| AP-3 complex subunit delta-1, putative [Pediculus humanus corporis] gi|212508384|gb|EEB12096.1| AP-3 complex subunit delta-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
ZFIN|ZDB-GENE-050208-437 1247 ap3d1 "adaptor-related protein 0.535 0.108 0.792 3.4e-70
UNIPROTKB|E1BWK3 1153 AP3D1 "Uncharacterized protein 0.535 0.117 0.792 5.7e-70
MGI|MGI:107734 1199 Ap3d1 "adaptor-related protein 0.535 0.112 0.785 5.8e-70
UNIPROTKB|O14617 1153 AP3D1 "AP-3 complex subunit de 0.535 0.117 0.785 5.9e-70
UNIPROTKB|Q865S1 1207 AP3D1 "AP-3 complex subunit de 0.535 0.111 0.785 6.1e-70
UNIPROTKB|E1C262 1208 AP3D1 "Uncharacterized protein 0.535 0.111 0.792 7.5e-70
UNIPROTKB|E2QXV5 1216 AP3D1 "Uncharacterized protein 0.535 0.111 0.785 1.7e-69
FB|FBgn0001087 1034 g "garnet" [Drosophila melanog 0.535 0.130 0.851 4.9e-68
WB|WBGene00000162 1251 apd-3 [Caenorhabditis elegans 0.535 0.107 0.748 1.1e-63
DICTYBASE|DDB_G0279537 1143 ap3d1 "delta adaptin" [Dictyos 0.535 0.118 0.566 5e-46
ZFIN|ZDB-GENE-050208-437 ap3d1 "adaptor-related protein complex 3, delta 1 subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 575 (207.5 bits), Expect = 3.4e-70, Sum P(2) = 3.4e-70
 Identities = 107/135 (79%), Positives = 126/135 (93%)

Query:     1 MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLM 60
             MLTTN IRKDL++ NQYD G+AL+ L+CF + DLARDLANDIM L++ TKPY+RKKAVL+
Sbjct:   110 MLTTNQIRKDLSSPNQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLI 169

Query:    61 MYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLM 120
             MYKVFLK+P++LRPAFPRLKEKLEDPD GVQSAAVNV+CELAR+NPKNYLSLAP+FFKLM
Sbjct:   170 MYKVFLKYPESLRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLM 229

Query:   121 TTSSNNWMLIKIIKL 135
             T+S+NNW+LIKIIKL
Sbjct:   230 TSSTNNWVLIKIIKL 244
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0030117 "membrane coat" evidence=IEA
UNIPROTKB|E1BWK3 AP3D1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:107734 Ap3d1 "adaptor-related protein complex 3, delta 1 subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O14617 AP3D1 "AP-3 complex subunit delta-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q865S1 AP3D1 "AP-3 complex subunit delta-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C262 AP3D1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXV5 AP3D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0001087 g "garnet" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00000162 apd-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279537 ap3d1 "delta adaptin" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UTL8AP3D_SCHPONo assigned EC number0.51110.53570.1636yesN/A
O54774AP3D1_MOUSENo assigned EC number0.78510.53570.1125yesN/A
O14617AP3D1_HUMANNo assigned EC number0.78510.53570.1170yesN/A
Q54WN0AP3D_DICDINo assigned EC number0.56610.53570.1181yesN/A
P54362AP3D_DROMENo assigned EC number0.85180.52770.1286yesN/A
Q865S1AP3D1_BOVINNo assigned EC number0.78510.53570.1118yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
pfam01602 522 pfam01602, Adaptin_N, Adaptin N terminal region 7e-39
COG5096 757 COG5096, COG5096, Vesicle coat complex, various su 3e-05
pfam01602522 pfam01602, Adaptin_N, Adaptin N terminal region 2e-04
>gnl|CDD|216598 pfam01602, Adaptin_N, Adaptin N terminal region Back     alignment and domain information 
 Score =  141 bits (357), Expect = 7e-39
 Identities = 58/139 (41%), Positives = 80/139 (57%), Gaps = 4/139 (2%)

Query: 1   MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLM 60
           +L TN I+KDL + N    GLAL  L+C    +LARDLA DI  LL    PY+RKKA L 
Sbjct: 77  ILVTNSIKKDLQSPNPLIRGLALRTLSCIRVPELARDLAPDIKKLLVDRDPYVRKKAALA 136

Query: 61  MYKVFLKFPDALRPA-FPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKL 119
           + K++ K PD +R    P LKE L D D GV SAAV ++ E+ + +      L P+  + 
Sbjct: 137 ILKLYRKDPDLVRDFLVPELKELLSDKDPGVVSAAVALLYEIRKNDRLYLNKLLPLLVRR 196

Query: 120 MT---TSSNNWMLIKIIKL 135
           +    T  N W+ +KI++L
Sbjct: 197 LCNLLTVCNPWLQVKILRL 215

This family consists of the N terminal region of various alpha, beta and gamma subunits of the AP-1, AP-2 and AP-3 adaptor protein complexes. The adaptor protein (AP) complexes are involved in the formation of clathrin-coated pits and vesicles. The N-terminal region of the various adaptor proteins (APs) is constant by comparison to the C-terminal which is variable within members of the AP-2 family; and it has been proposed that this constant region interacts with another uniform component of the coated vesicles. Length = 522
>gnl|CDD|227427 COG5096, COG5096, Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|216598 pfam01602, Adaptin_N, Adaptin N terminal region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
KOG1059|consensus 877 100.0
KOG1062|consensus 866 100.0
KOG1077|consensus 938 100.0
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.97
PTZ00429 746 beta-adaptin; Provisional 99.96
KOG1059|consensus 877 99.9
KOG1060|consensus 968 99.81
KOG1061|consensus 734 99.74
COG5096 757 Vesicle coat complex, various subunits [Intracellu 99.66
KOG1058|consensus 948 99.46
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.78
PTZ00429 746 beta-adaptin; Provisional 98.65
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.63
KOG1078|consensus 865 98.16
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.7
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.53
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.45
KOG1062|consensus 866 97.41
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.36
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.35
PRK09687280 putative lyase; Provisional 97.29
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.13
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.11
KOG2171|consensus 1075 97.08
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.06
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 96.88
PRK09687280 putative lyase; Provisional 96.86
KOG0166|consensus514 96.79
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.63
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.37
KOG0414|consensus1251 96.37
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.32
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 96.18
KOG1020|consensus 1692 96.11
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.1
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 96.07
KOG1060|consensus 968 95.94
KOG2023|consensus 885 95.88
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 95.76
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 95.74
KOG0414|consensus1251 95.73
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 95.65
PF1036392 DUF2435: Protein of unknown function (DUF2435) 95.64
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.54
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 95.21
KOG2171|consensus 1075 95.18
KOG1078|consensus 865 94.8
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.7
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 94.66
KOG0166|consensus 514 94.37
COG5098 1128 Chromosome condensation complex Condensin, subunit 94.26
KOG2023|consensus 885 94.13
KOG1824|consensus1233 94.1
PF08167165 RIX1: rRNA processing/ribosome biogenesis 93.78
COG1413335 FOG: HEAT repeat [Energy production and conversion 93.59
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 93.53
KOG1058|consensus 948 93.23
TIGR02270410 conserved hypothetical protein. Members are found 92.92
KOG1061|consensus 734 92.86
smart00638574 LPD_N Lipoprotein N-terminal Domain. 92.54
TIGR02270410 conserved hypothetical protein. Members are found 92.36
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 91.61
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 91.51
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 91.47
cd06561197 AlkD_like A new structural DNA glycosylase. This d 91.47
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 90.08
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 90.03
COG50981128 Chromosome condensation complex Condensin, subunit 89.99
KOG2160|consensus342 89.82
KOG0168|consensus 1051 89.28
KOG1077|consensus 938 88.81
COG1413335 FOG: HEAT repeat [Energy production and conversion 88.7
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 88.12
PF05804 708 KAP: Kinesin-associated protein (KAP) 88.05
KOG2274|consensus 1005 87.94
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 87.63
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 87.21
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 86.96
PF11701157 UNC45-central: Myosin-binding striated muscle asse 86.8
KOG0946|consensus 970 86.71
KOG4224|consensus550 86.68
PF1036392 DUF2435: Protein of unknown function (DUF2435) 86.6
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 86.58
KOG0212|consensus 675 86.48
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 85.8
KOG4524|consensus1014 85.26
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 84.91
PF07539141 DRIM: Down-regulated in metastasis; InterPro: IPR0 83.75
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 82.9
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 82.89
PF13251182 DUF4042: Domain of unknown function (DUF4042) 82.83
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 82.18
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 82.16
KOG2160|consensus342 82.11
cd03561133 VHS VHS domain family; The VHS domain is present i 82.03
cd07064208 AlkD_like_1 A new structural DNA glycosylase conta 81.5
KOG1242|consensus 569 80.14
>KOG1059|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.5e-55  Score=420.70  Aligned_cols=249  Identities=59%  Similarity=0.953  Sum_probs=230.1

Q ss_pred             CcchHHHHHhcccCCHHHHHHHHHHhhcCCchHhHHHHHHHHHHhhcCCChHHHHHHHHHHHHHHhhCCCCcCchhHHHH
Q psy11027          1 MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLK   80 (252)
Q Consensus         1 ~L~~N~i~kDL~s~n~~~~~LAL~~la~i~~~el~~~l~~~V~~lL~s~~p~VRKkA~lal~ki~~~~Pd~l~~~~~~l~   80 (252)
                      ||+||.++||++|+|.|..|+||.++|++.+|+++|+++++|..+|+|+.||+||||++.++|+|.+|||.++..||+++
T Consensus       108 mL~tn~~rkdl~S~n~ye~giAL~GLS~fvTpdLARDLa~Dv~tLL~sskpYvRKkAIl~lykvFLkYPeAlr~~FprL~  187 (877)
T KOG1059|consen  108 MLTTNLLRKDLNSSNVYEVGLALSGLSCIVTPDLARDLADDVFTLLNSSKPYVRKKAILLLYKVFLKYPEALRPCFPRLV  187 (877)
T ss_pred             HHHHHHHHHHhccCccchhhheecccccccCchhhHHHHHHHHHHHhcCchHHHHHHHHHHHHHHHhhhHhHhhhHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhCCCChhHHHHHHHHHHHHHhhCchhhhhhHHHHHHHhhcCCChhHHHHHhhc---------ccc-------------
Q psy11027         81 EKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTTSSNNWMLIKIIKL---------RLQ-------------  138 (252)
Q Consensus        81 ~lL~d~d~~V~~~al~ll~ei~~~~p~~~~~l~p~l~~lL~~~~~pwlqikiLkl---------rL~-------------  138 (252)
                      +.|+|+||||++||++++||+++++|++|..++|.|+++|++++++|+.||++|+         |||             
T Consensus       188 EkLeDpDp~V~SAAV~VICELArKnPknyL~LAP~ffkllttSsNNWmLIKiiKLF~aLtplEPRLgKKLieplt~li~s  267 (877)
T KOG1059|consen  188 EKLEDPDPSVVSAAVSVICELARKNPQNYLQLAPLFYKLLVTSSNNWVLIKLLKLFAALTPLEPRLGKKLIEPITELMES  267 (877)
T ss_pred             HhccCCCchHHHHHHHHHHHHHhhCCcccccccHHHHHHHhccCCCeehHHHHHHHhhccccCchhhhhhhhHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999998         776             


Q ss_pred             ------------chhhh--------------------hhhhhhcccCccchhchh-------------------------
Q psy11027        139 ------------GVFAV--------------------NVVCELARKNPKNYLSLA-------------------------  161 (252)
Q Consensus       139 ------------~v~a~--------------------~v~~e~~~~n~~~~l~l~-------------------------  161 (252)
                                  +|+++                    .+|+||+|||+| |+||.                         
T Consensus       268 T~AmSLlYECvNTVVa~s~s~g~~d~~asiqLCvqKLr~fiedsDqNLK-YlgLlam~KI~ktHp~~Vqa~kdlIlrcL~  346 (877)
T KOG1059|consen  268 TVAMSLLYECVNTVVAVSMSSGMSDHSASIQLCVQKLRIFIEDSDQNLK-YLGLLAMSKILKTHPKAVQAHKDLILRCLD  346 (877)
T ss_pred             hHHHHHHHHHHHHheeehhccCCCCcHHHHHHHHHHHhhhhhcCCccHH-HHHHHHHHHHhhhCHHHHHHhHHHHHHHhc
Confidence                        23322                    299999999999 99997                         


Q ss_pred             ------------------------hHHHHHhc---------------------CCCcchhHHH-----------HH----
Q psy11027        162 ------------------------PVFFKLMT---------------------TSSNNWMLIK-----------II----  181 (252)
Q Consensus       162 ------------------------~~l~~lL~---------------------~~~nN~~~i~-----------li----  181 (252)
                                              ++++++|.                     ||.+||.||.           |.    
T Consensus       347 DkD~SIRlrALdLl~gmVskkNl~eIVk~LM~~~~~ae~t~yrdell~~II~iCS~snY~~ItdFEWYlsVlveLa~l~~  426 (877)
T KOG1059|consen  347 DKDESIRLRALDLLYGMVSKKNLMEIVKTLMKHVEKAEGTNYRDELLTRIISICSQSNYQYITDFEWYLSVLVELARLEG  426 (877)
T ss_pred             cCCchhHHHHHHHHHHHhhhhhHHHHHHHHHHHHHhccchhHHHHHHHHHHHHhhhhhhhhhhhHHHHHHHHHHHHhccc
Confidence                                    34455543                     8999999998           11    


Q ss_pred             ---------------------H---------H--------------hhHHHHHHHHHHHHHHHhhccChhHHHHHHHhhh
Q psy11027        182 ---------------------K---------L--------------VLYAVLYAAAWICGEFREHLDSPRATLEAMTRRG  217 (252)
Q Consensus       182 ---------------------k---------l--------------~~~e~l~~~~~iv~~~~~~l~~~~~~~~~~l~~~  217 (252)
                                           |         +              ..+|+|||++||+|||.+|++++.++++.++++|
T Consensus       427 ~~~G~~I~eQi~Dv~iRV~~iR~fsV~~m~~Ll~~~~~~~s~q~n~~l~eVL~AaaWi~GEyse~ven~~~~leamlrpr  506 (877)
T KOG1059|consen  427 TRHGSLIAEQIIDVAIRVPSIRPFSVSQMSALLDDPLLAGSAQINSQLCEVLYAAAWILGEYSEFVENPNDTLEAMLRPR  506 (877)
T ss_pred             cchhhHHHHHHHHHheechhhhHhHHHHHHHHHhchhhccchhhccchhHHHHHHHHHHHHHHHHhhCHHHHHHHHhcCc
Confidence                                 1         1              1789999999999999999999999999999999


Q ss_pred             hccCCccchHHHHHHHHHHHHHHHHhhcccccc
Q psy11027        218 LSLLPGHIQAVYVQNMLKILARILDSAESRDDA  250 (252)
Q Consensus       218 i~~l~~~~~~~~~~~~~k~~~~~~~~~~~~~~~  250 (252)
                      .+.+|+|+|+|||||+.|+|+.|+.+.|+++|.
T Consensus       507 ~~~lp~~iq~vyvqni~Klfc~~~~~~ee~~~~  539 (877)
T KOG1059|consen  507 SDLLPGHIQAVYVQNIVKLFCSWCSQFEETKDF  539 (877)
T ss_pred             cccCchHHHHHHHHHHHHHHHHHHhhcCcccch
Confidence            999999999999999999999999999888763

>KOG1062|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>cd06561 AlkD_like A new structural DNA glycosylase Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>KOG4524|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF07539 DRIM: Down-regulated in metastasis; InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>cd07064 AlkD_like_1 A new structural DNA glycosylase containing HEAT-like repeats Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
1w63_A 618 Ap1 Clathrin Adaptor Core Length = 618 4e-15
>pdb|1W63|A Chain A, Ap1 Clathrin Adaptor Core Length = 618 Back     alignment and structure 
Iteration: 1

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 66/123 (53%), Gaps = 3/123 (2%)
Query: 1   MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLM 60
           +L TN I+ DLN   Q+  GLAL  L C  S+++ RDLA ++  LL ++  YLRKKA L 
Sbjct: 106 LLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALC 165
Query: 61  MYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPK---NYLSLAPVFF 117
              V  K P+ +    P  K  L + + GV   +V ++ E+  ++P    ++  L P   
Sbjct: 166 AVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLV 225
Query: 118 KLM 120
           +++
Sbjct: 226 RIL 228

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 1e-39
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 4e-12
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 1e-34
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 8e-09
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 1e-32
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 9e-10
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 4e-27
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-13
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 Back     alignment and structure
 Score =  143 bits (362), Expect = 1e-39
 Identities = 49/208 (23%), Positives = 96/208 (46%), Gaps = 32/208 (15%)

Query: 1   MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLLTSTKPYLRKKAVLM 60
           +L TN I+ DLN   Q+  GLAL  L C  S+++ RDLA ++  LL ++  YLRKKA L 
Sbjct: 106 LLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALC 165

Query: 61  MYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNP---KNYLSLAPVFF 117
              V  K P+ +    P  K  L + + GV   +V ++ E+  ++P    ++  L P   
Sbjct: 166 AVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLV 225

Query: 118 KLM--------------TTSSNNWMLIKIIKLRLQGVFAVNVVCELARKNPKNYLSLAPV 163
           +++              +  S+ ++ ++I++L          +  L R +  +  ++  +
Sbjct: 226 RILKNLIMSGYSPEHDVSGISDPFLQVRILRL----------LRILGRNDDDSSEAMNDI 275

Query: 164 FFKLMTTSS-----NNWMLIKIIKLVLY 186
             ++ T +       N +L + +  ++ 
Sbjct: 276 LAQVATNTETSKNVGNAILYETVLTIMD 303
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Length = 621 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Length = 621 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Length = 355 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 100.0
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.97
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 99.95
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.94
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.93
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 98.72
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.63
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.19
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.13
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.13
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.13
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.02
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.99
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 97.97
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 97.96
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.95
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.92
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.89
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 97.87
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 97.87
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.87
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.82
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.81
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.81
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 97.75
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.74
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 97.73
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 97.65
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.62
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.57
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 97.55
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 97.52
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 97.49
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.38
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 97.32
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 97.32
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 97.18
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.11
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.09
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 97.05
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 97.03
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 96.98
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 96.87
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 96.82
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 96.81
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 96.7
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 96.65
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 96.63
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.6
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 96.57
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 96.54
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 96.39
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.29
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 96.2
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 96.01
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 95.94
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 95.93
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 95.68
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 95.68
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 95.56
1qgr_A 876 Protein (importin beta subunit); transport recepto 95.48
3grl_A 651 General vesicular transport factor P115; vesicle t 95.35
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 95.03
3nmz_A458 APC variant protein; protein-protein complex, arma 95.03
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.96
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 94.68
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 94.53
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 94.53
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 94.42
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.4
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 94.34
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.32
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 94.22
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 93.91
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 93.38
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 93.1
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 92.8
2x19_B 963 Importin-13; nuclear transport, protein transport; 92.73
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 92.12
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 91.68
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 91.25
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 91.22
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 91.09
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 90.71
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 90.68
3nmz_A458 APC variant protein; protein-protein complex, arma 90.2
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 89.62
2x1g_F 971 Cadmus; transport protein, developmental protein, 89.57
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 89.48
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 89.38
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 88.51
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 88.26
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 87.31
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 87.23
2x19_B 963 Importin-13; nuclear transport, protein transport; 85.04
1t06_A235 Hypothetical protein; structural genomics, PSI, pr 83.11
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 82.41
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 82.27
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 80.49
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
Probab=100.00  E-value=4e-33  Score=272.76  Aligned_cols=239  Identities=21%  Similarity=0.340  Sum_probs=199.9

Q ss_pred             CcchHHHHHhcccCCHHHHHHHHHHhhcCCchHhHHHHHHHHHHhh--cCCChHHHHHHHHHHHHHHhhCCCCcC--chh
Q psy11027          1 MLTTNMIRKDLNAQNQYDAGLALSALACFTSTDLARDLANDIMMLL--TSTKPYLRKKAVLMMYKVFLKFPDALR--PAF   76 (252)
Q Consensus         1 ~L~~N~i~kDL~s~n~~~~~LAL~~la~i~~~el~~~l~~~V~~lL--~s~~p~VRKkA~lal~ki~~~~Pd~l~--~~~   76 (252)
                      +|+||+|+|||+|+||+++|+||+++|+++++||++++.++|.+++  .|++|||||+|++|++|+|+.+|+.++  .++
T Consensus       110 ~L~iN~l~kDl~~~n~~ir~lALr~L~~i~~~e~~~~l~~~v~~~l~~~d~~~~VRK~A~~al~kl~~~~p~~~~~~~~~  189 (621)
T 2vgl_A          110 RLINNAIKNDLASRNPTFMGLALHCIANVGSREMAEAFAGEIPKILVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWT  189 (621)
T ss_dssp             HHHHHHHHHHHHSCCHHHHHHHHHHHHHHCCHHHHHHHTTHHHHHHHCSSSCHHHHHHHHHHHHHHHHHCGGGCCCCSCH
T ss_pred             HHHHHHHHHhcCCCCHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHhChhhcCchhHH
Confidence            4789999999999999999999999999999999999999999999  899999999999999999999999999  788


Q ss_pred             HHHHhhhCCCChhHHHHHHHHHHHHHhhCchhhhhhHHHHHHHhhc------C----------CChhHHHHHhhc--ccc
Q psy11027         77 PRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKLMTT------S----------SNNWMLIKIIKL--RLQ  138 (252)
Q Consensus        77 ~~l~~lL~d~d~~V~~~al~ll~ei~~~~p~~~~~l~p~l~~lL~~------~----------~~pwlqikiLkl--rL~  138 (252)
                      +++.++|+|+||+|+.+|+++++++++++|+.|.+++|.++++|.+      .          ++||+|++++++  +++
T Consensus       190 ~~l~~lL~d~d~~V~~~a~~~l~~i~~~~~~~~~~~~~~~~~~L~~ll~~~~~~~~~~~~~~~~~~w~qi~il~ll~~~~  269 (621)
T 2vgl_A          190 SRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSASTDLQDYTYYFVPAPWLSVKLLRLLQCYP  269 (621)
T ss_dssp             HHHHHHTTCSCHHHHHHHHHHHHHHHHHCHHHHTTHHHHHHHHHHHHHHCCSSSCSTTEETTEESHHHHHHHHHHGGGSS
T ss_pred             HHHHHHhCCCCccHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHHHhCCCCCccchhhcCCCCchHHHHHHHHHHHhC
Confidence            9999999999999999999999999999999999999998877652      2          289999999998  222


Q ss_pred             ------------chhhh---------------------hhhhhhc------ccCccchh-chhhHHHHHhcCCCcchhHH
Q psy11027        139 ------------GVFAV---------------------NVVCELA------RKNPKNYL-SLAPVFFKLMTTSSNNWMLI  178 (252)
Q Consensus       139 ------------~v~a~---------------------~v~~e~~------~~n~~~~l-~l~~~l~~lL~~~~nN~~~i  178 (252)
                                  +++..                     ++..|..      +.++. ++ ...+.+++||.++++|.||+
T Consensus       270 ~~~d~~~~~~l~~~L~~il~~~~~~~ks~~l~~~n~~~aVl~ea~~~i~~l~~~~~-~~~~~~~~L~~~L~~~~~niry~  348 (621)
T 2vgl_A          270 PPEDPAVRGRLTECLETILNKAQEPPKSKKVQHSNAKNAVLFEAISLIIHHDSEPN-LLVRACNQLGQFLQHRETNLRYL  348 (621)
T ss_dssp             SCSSHHHHHHHHHHHHHHHHHHHSCCSCSSHHHHHHHHHHHHHHHHHHHHHCCCHH-HHHHHHHHHHHHSSCSCHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHhhccCcccccccccchHHHHHHHHHHHHHhcCCcHH-HHHHHHHHHHHHhcCCCcchHHH
Confidence                        11111                     1111111      12222 22 23478889999999999999


Q ss_pred             HHH----------------------------------HHhhHHHHHHH------HHHHHHHHhhccChhHHHHHHHhhhh
Q psy11027        179 KII----------------------------------KLVLYAVLYAA------AWICGEFREHLDSPRATLEAMTRRGL  218 (252)
Q Consensus       179 ~li----------------------------------kl~~~e~l~~~------~~iv~~~~~~l~~~~~~~~~~l~~~i  218 (252)
                      +|-                                  |...+|.++.+      ..|+.++.+|+++.+.-++..+..+|
T Consensus       349 aL~~l~~l~~~~~~~~~~~~~~~~i~~~L~~d~d~~Ir~~aL~lL~~l~~~~Nv~~Iv~eL~~yl~~~d~~~~~~~v~~I  428 (621)
T 2vgl_A          349 ALESMCTLASSEFSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAQQIVAEMLSYLETADYSIREEIVLKV  428 (621)
T ss_dssp             HHHHHHHHTTCTTTHHHHHTTHHHHHHHHTTCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHhccCcHHHHHHHHHHHHHHhccCCCHhHHHHHHHHHHHHcChhhHHHHHHHHHHHHHhcCHHHHHHHHHHH
Confidence            851                                  11258888887      48999999999999888888888888


Q ss_pred             ccCC---ccchHHHHHHHHHHHHHH
Q psy11027        219 SLLP---GHIQAVYVQNMLKILARI  240 (252)
Q Consensus       219 ~~l~---~~~~~~~~~~~~k~~~~~  240 (252)
                      ..++   +++..|||..+++++...
T Consensus       429 ~~la~k~~~~~~~~v~~Ll~ll~~~  453 (621)
T 2vgl_A          429 AILAEKYAVDYTWYVDTILNLIRIA  453 (621)
T ss_dssp             HHHHHHHCSSTHHHHHHHHHHHHHH
T ss_pred             HHHHHhcCCcHHHHHHHHHHHHHhh
Confidence            8888   678999999999999764
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1t06_A Hypothetical protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, unknown function; 1.90A {Bacillus cereus} SCOP: a.118.1.17 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d2vgla_ 584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 3e-27
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 2e-08
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-24
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 3e-08
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-04

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.96
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.94
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 98.83
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.19
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.01
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.0
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.9
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.59
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.52
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.39
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.35
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.32
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.23
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.17
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.08
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 96.85
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.85
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 96.85
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.7
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 96.6
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.65
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 95.63
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 95.56
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 95.35
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 93.86
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 93.76
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 92.0
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 90.13
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 86.31
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 83.78
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure