Psyllid ID: psy11028
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 383849410 | 1200 | PREDICTED: AP-3 complex subunit delta-1- | 0.882 | 0.1 | 0.933 | 1e-59 | |
| 307189900 | 1111 | AP-3 complex subunit delta-1 [Camponotus | 0.882 | 0.108 | 0.933 | 1e-59 | |
| 340711936 | 1189 | PREDICTED: AP-3 complex subunit delta-1- | 0.882 | 0.100 | 0.933 | 2e-59 | |
| 350402396 | 1189 | PREDICTED: AP-3 complex subunit delta-1- | 0.882 | 0.100 | 0.933 | 2e-59 | |
| 307204535 | 1197 | AP-3 complex subunit delta-1 [Harpegnath | 0.882 | 0.100 | 0.933 | 2e-59 | |
| 328790270 | 1189 | PREDICTED: AP-3 complex subunit delta-1 | 0.882 | 0.100 | 0.933 | 2e-59 | |
| 380025614 | 1189 | PREDICTED: LOW QUALITY PROTEIN: AP-3 com | 0.882 | 0.100 | 0.933 | 2e-59 | |
| 345494024 | 1174 | PREDICTED: AP-3 complex subunit delta-1- | 0.882 | 0.102 | 0.933 | 3e-59 | |
| 322785824 | 1147 | hypothetical protein SINV_04691 [Solenop | 0.882 | 0.104 | 0.925 | 3e-59 | |
| 332025161 | 1198 | AP-3 complex subunit delta-1 [Acromyrmex | 0.882 | 0.100 | 0.925 | 4e-59 |
| >gi|383849410|ref|XP_003700338.1| PREDICTED: AP-3 complex subunit delta-1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 234 bits (596), Expect = 1e-59, Method: Composition-based stats.
Identities = 112/120 (93%), Positives = 117/120 (97%)
Query: 8 LTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKN 67
LTSTKPYLRKKAVLMMYKVFL+FP+ALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKN
Sbjct: 155 LTSTKPYLRKKAVLMMYKVFLRFPEALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKN 214
Query: 68 PKNYLSLAPVFFKLMTTSSNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHRIISLS 127
PKNYLSLAPVFFKLMTTS+NNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIH ++S
Sbjct: 215 PKNYLSLAPVFFKLMTTSTNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMS 274
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307189900|gb|EFN74144.1| AP-3 complex subunit delta-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340711936|ref|XP_003394522.1| PREDICTED: AP-3 complex subunit delta-1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350402396|ref|XP_003486469.1| PREDICTED: AP-3 complex subunit delta-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307204535|gb|EFN83215.1| AP-3 complex subunit delta-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328790270|ref|XP_395563.4| PREDICTED: AP-3 complex subunit delta-1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380025614|ref|XP_003696565.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345494024|ref|XP_001605245.2| PREDICTED: AP-3 complex subunit delta-1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|322785824|gb|EFZ12443.1| hypothetical protein SINV_04691 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332025161|gb|EGI65341.1| AP-3 complex subunit delta-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| FB|FBgn0001087 | 1034 | g "garnet" [Drosophila melanog | 0.882 | 0.116 | 0.858 | 1.2e-51 | |
| UNIPROTKB|E1BWK3 | 1153 | AP3D1 "Uncharacterized protein | 0.882 | 0.104 | 0.833 | 1.9e-50 | |
| UNIPROTKB|O14617 | 1153 | AP3D1 "AP-3 complex subunit de | 0.882 | 0.104 | 0.833 | 1.9e-50 | |
| MGI|MGI:107734 | 1199 | Ap3d1 "adaptor-related protein | 0.882 | 0.100 | 0.833 | 2.1e-50 | |
| UNIPROTKB|Q865S1 | 1207 | AP3D1 "AP-3 complex subunit de | 0.882 | 0.099 | 0.833 | 2.2e-50 | |
| UNIPROTKB|E1C262 | 1208 | AP3D1 "Uncharacterized protein | 0.882 | 0.099 | 0.833 | 2.2e-50 | |
| UNIPROTKB|E2QXV5 | 1216 | AP3D1 "Uncharacterized protein | 0.882 | 0.098 | 0.833 | 2.2e-50 | |
| ZFIN|ZDB-GENE-050208-437 | 1247 | ap3d1 "adaptor-related protein | 0.882 | 0.096 | 0.833 | 2.3e-50 | |
| WB|WBGene00000162 | 1251 | apd-3 [Caenorhabditis elegans | 0.882 | 0.095 | 0.8 | 6.8e-48 | |
| DICTYBASE|DDB_G0279537 | 1143 | ap3d1 "delta adaptin" [Dictyos | 0.882 | 0.104 | 0.611 | 2.2e-37 |
| FB|FBgn0001087 g "garnet" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 545 (196.9 bits), Expect = 1.2e-51, P = 1.2e-51
Identities = 103/120 (85%), Positives = 114/120 (95%)
Query: 8 LTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKN 67
++STKPYLR KAVLMMYKVFL++P+ALRPAFP+LKEKLEDPD GVQSAAVNV+CELARKN
Sbjct: 156 MSSTKPYLRMKAVLMMYKVFLRYPEALRPAFPKLKEKLEDPDPGVQSAAVNVICELARKN 215
Query: 68 PKNYLSLAPVFFKLMTTSSNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHRIISLS 127
PKNYL LAP+FFKLMTTS+NNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIH ++S
Sbjct: 216 PKNYLPLAPIFFKLMTTSTNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMS 275
|
|
| UNIPROTKB|E1BWK3 AP3D1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O14617 AP3D1 "AP-3 complex subunit delta-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107734 Ap3d1 "adaptor-related protein complex 3, delta 1 subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q865S1 AP3D1 "AP-3 complex subunit delta-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C262 AP3D1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QXV5 AP3D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-437 ap3d1 "adaptor-related protein complex 3, delta 1 subunit" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000162 apd-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279537 ap3d1 "delta adaptin" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| pfam01602 | 522 | pfam01602, Adaptin_N, Adaptin N terminal region | 2e-31 |
| >gnl|CDD|216598 pfam01602, Adaptin_N, Adaptin N terminal region | Back alignment and domain information |
|---|
Score = 116 bits (292), Expect = 2e-31
Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 6/119 (5%)
Query: 8 LTSTKPYLRKKAVLMMYKVFLKFPDALRPA-FPRLKEKLEDPDSGVQSAAVNVVCELARK 66
L PY+RKKA L + K++ K PD +R P LKE L D D GV SAAV ++ E+ RK
Sbjct: 122 LVDRDPYVRKKAALAILKLYRKDPDLVRDFLVPELKELLSDKDPGVVSAAVALLYEI-RK 180
Query: 67 NPKNY-LSLAPVFFKLMT---TSSNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIH 121
N + Y L P+ + + T N W+ +KI++L P +PR K+L+E + NL+
Sbjct: 181 NDRLYLNKLLPLLVRRLCNLLTVCNPWLQVKILRLLTRYAPQDPREPKELLEDILNLLQ 239
|
This family consists of the N terminal region of various alpha, beta and gamma subunits of the AP-1, AP-2 and AP-3 adaptor protein complexes. The adaptor protein (AP) complexes are involved in the formation of clathrin-coated pits and vesicles. The N-terminal region of the various adaptor proteins (APs) is constant by comparison to the C-terminal which is variable within members of the AP-2 family; and it has been proposed that this constant region interacts with another uniform component of the coated vesicles. Length = 522 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| KOG1059|consensus | 877 | 100.0 | ||
| KOG1062|consensus | 866 | 99.96 | ||
| KOG1077|consensus | 938 | 99.9 | ||
| PTZ00429 | 746 | beta-adaptin; Provisional | 99.88 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 99.87 | |
| KOG1061|consensus | 734 | 99.7 | ||
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 99.39 | |
| KOG1060|consensus | 968 | 99.31 | ||
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 98.79 | |
| KOG1058|consensus | 948 | 98.19 | ||
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 98.06 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 97.84 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 97.8 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 97.14 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 97.09 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 96.84 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 96.76 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 96.72 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.49 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 96.45 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 96.43 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.32 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 96.32 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 96.23 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 96.23 | |
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 95.89 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 95.77 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 95.53 | |
| PF12830 | 187 | Nipped-B_C: Sister chromatid cohesion C-terminus | 95.41 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 95.34 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 95.26 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 95.19 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 95.19 | |
| KOG2160|consensus | 342 | 95.12 | ||
| KOG1059|consensus | 877 | 94.92 | ||
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 94.69 | |
| PF12719 | 298 | Cnd3: Nuclear condensing complex subunits, C-term | 94.66 | |
| KOG0414|consensus | 1251 | 94.61 | ||
| KOG1062|consensus | 866 | 94.31 | ||
| PF10521 | 282 | DUF2454: Protein of unknown function (DUF2454); In | 94.31 | |
| PF11935 | 239 | DUF3453: Domain of unknown function (DUF3453); Int | 94.06 | |
| KOG1060|consensus | 968 | 94.02 | ||
| KOG1020|consensus | 1692 | 93.95 | ||
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 93.87 | |
| PF08623 | 169 | TIP120: TATA-binding protein interacting (TIP20); | 93.23 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 93.02 | |
| cd03561 | 133 | VHS VHS domain family; The VHS domain is present i | 92.55 | |
| KOG0166|consensus | 514 | 92.5 | ||
| KOG0213|consensus | 1172 | 92.45 | ||
| cd03568 | 144 | VHS_STAM VHS domain family, STAM subfamily; member | 92.45 | |
| cd06561 | 197 | AlkD_like A new structural DNA glycosylase. This d | 92.08 | |
| KOG2171|consensus | 1075 | 92.07 | ||
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 92.06 | |
| PF08167 | 165 | RIX1: rRNA processing/ribosome biogenesis | 91.55 | |
| PF08713 | 213 | DNA_alkylation: DNA alkylation repair enzyme; Inte | 91.47 | |
| KOG2171|consensus | 1075 | 91.15 | ||
| PF08167 | 165 | RIX1: rRNA processing/ribosome biogenesis | 91.02 | |
| COG5181 | 975 | HSH155 U2 snRNP spliceosome subunit [RNA processin | 90.89 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 90.69 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 90.1 | |
| KOG0166|consensus | 514 | 89.72 | ||
| smart00288 | 133 | VHS Domain present in VPS-27, Hrs and STAM. Unpubl | 89.64 | |
| PF12765 | 42 | Cohesin_HEAT: HEAT repeat associated with sister c | 89.34 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 89.2 | |
| cd03567 | 139 | VHS_GGA VHS domain family, GGA subfamily; GGA (Gol | 89.2 | |
| COG5098 | 1128 | Chromosome condensation complex Condensin, subunit | 89.17 | |
| PF13251 | 182 | DUF4042: Domain of unknown function (DUF4042) | 89.01 | |
| PF08389 | 148 | Xpo1: Exportin 1-like protein; InterPro: IPR013598 | 88.99 | |
| PF11841 | 160 | DUF3361: Domain of unknown function (DUF3361) | 88.77 | |
| KOG1824|consensus | 1233 | 88.74 | ||
| KOG2259|consensus | 823 | 88.72 | ||
| KOG1020|consensus | 1692 | 88.67 | ||
| cd03569 | 142 | VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s | 88.51 | |
| KOG1078|consensus | 865 | 88.46 | ||
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 87.64 | |
| PF00790 | 140 | VHS: VHS domain; InterPro: IPR002014 The VHS domai | 87.46 | |
| PF12830 | 187 | Nipped-B_C: Sister chromatid cohesion C-terminus | 86.82 | |
| PF07539 | 141 | DRIM: Down-regulated in metastasis; InterPro: IPR0 | 86.76 | |
| PF14500 | 262 | MMS19_N: Dos2-interacting transcription regulator | 85.93 | |
| PF12530 | 234 | DUF3730: Protein of unknown function (DUF3730) ; I | 85.92 | |
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 85.73 | |
| KOG2023|consensus | 885 | 85.25 | ||
| PF12460 | 415 | MMS19_C: RNAPII transcription regulator C-terminal | 85.02 | |
| KOG2023|consensus | 885 | 84.99 | ||
| KOG0414|consensus | 1251 | 84.47 | ||
| PF11701 | 157 | UNC45-central: Myosin-binding striated muscle asse | 84.25 | |
| KOG1240|consensus | 1431 | 84.15 | ||
| KOG2956|consensus | 516 | 84.06 | ||
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 83.21 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 83.12 | |
| KOG3723|consensus | 851 | 83.09 | ||
| COG5098 | 1128 | Chromosome condensation complex Condensin, subunit | 82.46 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 82.38 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 82.36 | |
| KOG1991|consensus | 1010 | 82.15 | ||
| KOG0168|consensus | 1051 | 81.85 | ||
| KOG1242|consensus | 569 | 81.46 | ||
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 81.05 | |
| cd00197 | 115 | VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil | 80.98 | |
| KOG2274|consensus | 1005 | 80.95 | ||
| KOG2149|consensus | 393 | 80.95 | ||
| KOG1824|consensus | 1233 | 80.24 | ||
| KOG0212|consensus | 675 | 80.09 |
| >KOG1059|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-33 Score=245.27 Aligned_cols=131 Identities=66% Similarity=1.115 Sum_probs=129.2
Q ss_pred hhhhhhcCCCChHHHHHHHHHHHHHHhHCCCCchhhHHHHHhhcCCCChhHHHHHHHHHHHHHhcCCcchhhhHHHHHHH
Q psy11028 2 LGYFIYLTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAPVFFKL 81 (136)
Q Consensus 2 ~~V~klL~~s~~~VRKKA~l~~~rl~~~~P~~v~~~~~~l~~lL~D~d~~V~~aal~l~~~l~~~~p~~~~~lvp~lv~i 81 (136)
.||+.||+|++|||||||++.+||+|.+|||.+.+.++++++.|+|+||||++||++++||++++||+.|.+++|.|+++
T Consensus 147 ~Dv~tLL~sskpYvRKkAIl~lykvFLkYPeAlr~~FprL~EkLeDpDp~V~SAAV~VICELArKnPknyL~LAP~ffkl 226 (877)
T KOG1059|consen 147 DDVFTLLNSSKPYVRKKAILLLYKVFLKYPEALRPCFPRLVEKLEDPDPSVVSAAVSVICELARKNPQNYLQLAPLFYKL 226 (877)
T ss_pred HHHHHHHhcCchHHHHHHHHHHHHHHHhhhHhHhhhHHHHHHhccCCCchHHHHHHHHHHHHHhhCCcccccccHHHHHH
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hccCCChhHHHHHHHHhhhcCCCChHHHhhhHHHHHHHHhccchhhhhhhc
Q psy11028 82 MTTSSNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHRIISLSCWTGI 132 (136)
Q Consensus 82 L~~v~~pWlqikiLk~L~~l~~~e~~~~~~l~e~l~~iL~~~~s~sv~~~~ 132 (136)
|.++.|+|+.|||+|+|+.|.|.|||+.+|++|++.+++++|.|+|+++++
T Consensus 227 lttSsNNWmLIKiiKLF~aLtplEPRLgKKLieplt~li~sT~AmSLlYEC 277 (877)
T KOG1059|consen 227 LVTSSNNWVLIKLLKLFAALTPLEPRLGKKLIEPITELMESTVAMSLLYEC 277 (877)
T ss_pred HhccCCCeehHHHHHHHhhccccCchhhhhhhhHHHHHHHhhHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999875
|
|
| >KOG1062|consensus | Back alignment and domain information |
|---|
| >KOG1077|consensus | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1061|consensus | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1060|consensus | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG1058|consensus | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >KOG2160|consensus | Back alignment and domain information |
|---|
| >KOG1059|consensus | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain | Back alignment and domain information |
|---|
| >KOG0414|consensus | Back alignment and domain information |
|---|
| >KOG1062|consensus | Back alignment and domain information |
|---|
| >PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] | Back alignment and domain information |
|---|
| >PF11935 DUF3453: Domain of unknown function (DUF3453); InterPro: IPR021850 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1060|consensus | Back alignment and domain information |
|---|
| >KOG1020|consensus | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >KOG0213|consensus | Back alignment and domain information |
|---|
| >cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) | Back alignment and domain information |
|---|
| >cd06561 AlkD_like A new structural DNA glycosylase | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >PF08167 RIX1: rRNA processing/ribosome biogenesis | Back alignment and domain information |
|---|
| >PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >PF08167 RIX1: rRNA processing/ribosome biogenesis | Back alignment and domain information |
|---|
| >COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >smart00288 VHS Domain present in VPS-27, Hrs and STAM | Back alignment and domain information |
|---|
| >PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins | Back alignment and domain information |
|---|
| >COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13251 DUF4042: Domain of unknown function (DUF4042) | Back alignment and domain information |
|---|
| >PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane | Back alignment and domain information |
|---|
| >PF11841 DUF3361: Domain of unknown function (DUF3361) | Back alignment and domain information |
|---|
| >KOG1824|consensus | Back alignment and domain information |
|---|
| >KOG2259|consensus | Back alignment and domain information |
|---|
| >KOG1020|consensus | Back alignment and domain information |
|---|
| >cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) | Back alignment and domain information |
|---|
| >KOG1078|consensus | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM | Back alignment and domain information |
|---|
| >PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus | Back alignment and domain information |
|---|
| >PF07539 DRIM: Down-regulated in metastasis; InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [] | Back alignment and domain information |
|---|
| >PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II | Back alignment and domain information |
|---|
| >PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >KOG2023|consensus | Back alignment and domain information |
|---|
| >PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins | Back alignment and domain information |
|---|
| >KOG2023|consensus | Back alignment and domain information |
|---|
| >KOG0414|consensus | Back alignment and domain information |
|---|
| >PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG2956|consensus | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG1991|consensus | Back alignment and domain information |
|---|
| >KOG0168|consensus | Back alignment and domain information |
|---|
| >KOG1242|consensus | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain | Back alignment and domain information |
|---|
| >KOG2274|consensus | Back alignment and domain information |
|---|
| >KOG2149|consensus | Back alignment and domain information |
|---|
| >KOG1824|consensus | Back alignment and domain information |
|---|
| >KOG0212|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 4e-29 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 2e-24 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 4e-04 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 6e-24 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 5e-22 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 7e-08 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 3e-17 |
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 | Back alignment and structure |
|---|
Score = 109 bits (274), Expect = 4e-29
Identities = 26/137 (18%), Positives = 57/137 (41%), Gaps = 17/137 (12%)
Query: 8 LTSTKPYLRKKAVLMMYKVFLKFPDALRPAFPRLKEKLEDPDSGVQSAAVNVVCELARKN 67
L ++ YLRKKA L V K P+ + P K L + + GV +V ++ E+ ++
Sbjct: 151 LKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERS 210
Query: 68 P---KNYLSLAPVFFKLM--------------TTSSNNWMLIKIIKLFGALTPLEPRLGK 110
P ++ L P +++ + S+ ++ ++I++L L + +
Sbjct: 211 PDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSE 270
Query: 111 KLIEPLTNLIHRIISLS 127
+ + L + +
Sbjct: 271 AMNDILAQVATNTETSK 287
|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Length = 621 | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Length = 355 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 99.9 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 99.87 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 99.86 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 99.81 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 98.44 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 98.34 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 98.33 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 98.32 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 98.26 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 98.17 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 98.14 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 97.97 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.94 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.93 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 97.9 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.87 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.86 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 97.84 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.83 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.83 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 97.83 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.79 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 97.77 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.75 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 97.75 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.75 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.71 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 97.67 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.67 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.67 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 97.39 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 97.34 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 97.34 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 97.27 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 97.17 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 97.16 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 97.16 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 97.14 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 97.13 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 97.07 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 97.06 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 97.06 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 97.03 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 96.98 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 96.97 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 96.94 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 96.88 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 96.76 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 96.73 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 96.72 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 96.71 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 96.67 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 96.44 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 96.41 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 96.32 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 96.3 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 96.3 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 96.02 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 95.94 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 95.85 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 95.66 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 95.65 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 95.62 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 95.6 | |
| 3u0r_A | 507 | Apoptosis inhibitor 5; heat repeat, armadillo repe | 95.52 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 95.45 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 95.36 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 95.3 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 95.21 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 94.81 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 94.63 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 94.62 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 94.55 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 94.47 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 94.45 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 93.94 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 93.84 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 93.75 | |
| 3u0r_A | 507 | Apoptosis inhibitor 5; heat repeat, armadillo repe | 93.71 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 93.27 | |
| 1x5b_A | 163 | Signal transducing adaptor molecule 2; VHS domain, | 93.07 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 92.7 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 91.84 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 91.82 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 91.71 | |
| 4hat_C | 1023 | Exportin-1; heat repeat, nuclear export, RAN-ranbp | 91.52 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 91.48 | |
| 1mhq_A | 148 | ADP-ribosylation factor binding protein GGA2; supe | 91.39 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 91.3 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 91.19 | |
| 3ldz_A | 140 | STAM-1, signal transducing adapter molecule 1; ubi | 91.06 | |
| 3a6p_A | 1204 | Exportin-5; exportin-5, RANGTP, nuclearexport, imp | 91.01 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 90.96 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 90.52 | |
| 3ibv_A | 980 | Exportin-T; karyopherin, heat repeat, cytoplasm, n | 90.14 | |
| 3o2t_A | 386 | Symplekin; heat repeat, scaffold, protein binding; | 89.52 | |
| 3gs3_A | 257 | Symplekin, LD45768P; helix-turn-helix heat repeat | 89.45 | |
| 3g2s_A | 149 | C-terminal fragment of sortilin-related receptor; | 89.42 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 88.66 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 87.45 | |
| 3o2t_A | 386 | Symplekin; heat repeat, scaffold, protein binding; | 86.67 | |
| 3gs3_A | 257 | Symplekin, LD45768P; helix-turn-helix heat repeat | 86.55 | |
| 1juq_A | 171 | ADP-ribosylation factor binding protein GGA3; prot | 84.81 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 84.26 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 82.95 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 82.41 | |
| 1elk_A | 157 | Target of MYB1; superhelix of helices, endocytosis | 82.1 |
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
Probab=99.90 E-value=1.1e-23 Score=182.36 Aligned_cols=122 Identities=21% Similarity=0.396 Sum_probs=112.0
Q ss_pred Chhhhhhc--CCCChHHHHHHHHHHHHHHhHCCCCch--hhHHHHHhhcCCCChhHHHHHHHHHHHHHhcCCcchhhhHH
Q psy11028 1 MLGYFIYL--TSTKPYLRKKAVLMMYKVFLKFPDALR--PAFPRLKEKLEDPDSGVQSAAVNVVCELARKNPKNYLSLAP 76 (136)
Q Consensus 1 ~~~V~klL--~~s~~~VRKKA~l~~~rl~~~~P~~v~--~~~~~l~~lL~D~d~~V~~aal~l~~~l~~~~p~~~~~lvp 76 (136)
.++|.++| .|++|||||||++|++|+|+++||.++ +|.+++.++|+|+|+||+.+|++++++++..+|+.|..++|
T Consensus 148 ~~~v~~~l~~~d~~~~VRK~A~~al~kl~~~~p~~~~~~~~~~~l~~lL~d~d~~V~~~a~~~l~~i~~~~~~~~~~~~~ 227 (621)
T 2vgl_A 148 AGEIPKILVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVS 227 (621)
T ss_dssp TTHHHHHHHCSSSCHHHHHHHHHHHHHHHHHCGGGCCCCSCHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCHHHHTTHHH
T ss_pred HHHHHHHHhCCCCCHHHHHHHHHHHHHHHHhChhhcCchhHHHHHHHHhCCCCccHHHHHHHHHHHHHHhChHHHHHHHH
Confidence 36789999 999999999999999999999999999 79999999999999999999999999999999999999999
Q ss_pred HHHHHhcc------C----------CChhHHHHHHHHhhhcCCC-ChHHHhhhHHHHHHHHhc
Q psy11028 77 VFFKLMTT------S----------SNNWMLIKIIKLFGALTPL-EPRLGKKLIEPLTNLIHR 122 (136)
Q Consensus 77 ~lv~iL~~------v----------~~pWlqikiLk~L~~l~~~-e~~~~~~l~e~l~~iL~~ 122 (136)
.++++|++ . ++||+|+++|++|+.+++. +++..+++.+.+..++++
T Consensus 228 ~~~~~L~~ll~~~~~~~~~~~~~~~~~~w~qi~il~ll~~~~~~~d~~~~~~l~~~L~~il~~ 290 (621)
T 2vgl_A 228 LAVSRLSRIVTSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDPAVRGRLTECLETILNK 290 (621)
T ss_dssp HHHHHHHHHHHCCSSSCSTTEETTEESHHHHHHHHHHGGGSSSCSSHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhCCCCCccchhhcCCCCchHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHh
Confidence 99988863 2 3899999999999999985 588889999988888854
|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 | Back alignment and structure |
|---|
| >3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* | Back alignment and structure |
|---|
| >3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* | Back alignment and structure |
|---|
| >3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* | Back alignment and structure |
|---|
| >3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d2vgla_ | 584 | a.118.1.10 (A:) Adaptin alpha C subunit N-terminal | 4e-17 | |
| d2vgla_ | 584 | a.118.1.10 (A:) Adaptin alpha C subunit N-terminal | 2e-04 | |
| d2vglb_ | 579 | a.118.1.10 (B:) Adaptin beta subunit N-terminal fr | 3e-14 | |
| d2vglb_ | 579 | a.118.1.10 (B:) Adaptin beta subunit N-terminal fr | 5e-07 | |
| d2vglb_ | 579 | a.118.1.10 (B:) Adaptin beta subunit N-terminal fr | 0.003 | |
| d1u6gc_ | 1207 | a.118.1.2 (C:) Cullin-associated NEDD8-dissociated | 8e-04 |
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 99.81 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 99.76 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.16 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 98.15 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.1 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 97.95 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 97.77 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.71 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 97.57 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.41 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 97.3 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 97.24 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 97.23 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 97.17 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 97.04 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 97.02 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 96.91 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 96.45 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.31 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 96.19 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.17 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 96.06 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 96.02 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 95.86 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 95.23 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 95.21 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 94.52 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 93.63 | |
| d1ujka_ | 145 | ADP-ribosylation factor binding protein Gga1 {Huma | 91.45 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 91.06 | |
| d1dvpa1 | 145 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 90.98 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 89.87 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 88.37 | |
| d1mhqa_ | 143 | ADP-ribosylation factor binding protein Gga2 {Huma | 85.79 | |
| d1juqa_ | 151 | ADP-ribosylation factor binding protein Gga3 {Huma | 84.32 | |
| d1t06a_ | 235 | Hypothetical protein BC3264 {Bacillus cereus (stra | 82.8 |
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t06a_ a.118.1.17 (A:) Hypothetical protein BC3264 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|