Psyllid ID: psy11037
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| 242016312 | 451 | synaptotagmin-4, putative [Pediculus hum | 0.937 | 0.268 | 0.722 | 4e-47 | |
| 91091970 | 440 | PREDICTED: similar to AGAP001800-PA [Tri | 0.937 | 0.275 | 0.722 | 1e-46 | |
| 357621416 | 433 | hypothetical protein KGM_04783 [Danaus p | 0.829 | 0.247 | 0.8 | 5e-45 | |
| 322785952 | 387 | hypothetical protein SINV_16571 [Solenop | 0.829 | 0.276 | 0.788 | 1e-44 | |
| 195344195 | 470 | GM10947 [Drosophila sechellia] gi|194133 | 0.829 | 0.227 | 0.741 | 1e-44 | |
| 17946418 | 474 | RE67111p [Drosophila melanogaster] | 0.829 | 0.225 | 0.741 | 2e-44 | |
| 347966627 | 473 | AGAP001800-PB [Anopheles gambiae str. PE | 0.922 | 0.251 | 0.679 | 2e-44 | |
| 194899247 | 474 | GG13974 [Drosophila erecta] gi|190650875 | 0.829 | 0.225 | 0.741 | 2e-44 | |
| 17137726 | 474 | synaptotagmin 4 [Drosophila melanogaster | 0.829 | 0.225 | 0.741 | 2e-44 | |
| 443685622 | 416 | synaptotagmin 4, partial [Capitella tele | 0.813 | 0.252 | 0.785 | 2e-44 |
| >gi|242016312|ref|XP_002428773.1| synaptotagmin-4, putative [Pediculus humanus corporis] gi|212513458|gb|EEB16035.1| synaptotagmin-4, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 192 bits (487), Expect = 4e-47, Method: Compositional matrix adjust.
Identities = 91/126 (72%), Positives = 107/126 (84%), Gaps = 5/126 (3%)
Query: 8 SSFQNQSFHNSTDI---SSEIKSQGRGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGL 64
+ F+NQ +I S +I+SQGRGEIL+SLCWQPAANR T+V+LKARNLPKMDVTGL
Sbjct: 287 TQFENQQLALCREIQPRSIKIRSQGRGEILISLCWQPAANRLTVVILKARNLPKMDVTGL 346
Query: 65 ADPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVP--ADNLDSVSLELLLLDWD 122
ADPYVK+YLL QR+AKKKTHVKKRTLNPV+NESF+FE+P A+ LD++SLE LLLDWD
Sbjct: 347 ADPYVKMYLLCNNQRIAKKKTHVKKRTLNPVFNESFIFEIPAGAEKLDNISLEFLLLDWD 406
Query: 123 RVTKNE 128
RVTKNE
Sbjct: 407 RVTKNE 412
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91091970|ref|XP_968583.1| PREDICTED: similar to AGAP001800-PA [Tribolium castaneum] gi|270001306|gb|EEZ97753.1| synaptotagmin IV [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357621416|gb|EHJ73260.1| hypothetical protein KGM_04783 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|322785952|gb|EFZ12569.1| hypothetical protein SINV_16571 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|195344195|ref|XP_002038674.1| GM10947 [Drosophila sechellia] gi|194133695|gb|EDW55211.1| GM10947 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|17946418|gb|AAL49242.1| RE67111p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|347966627|ref|XP_003435948.1| AGAP001800-PB [Anopheles gambiae str. PEST] gi|333469973|gb|EGK97465.1| AGAP001800-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|194899247|ref|XP_001979172.1| GG13974 [Drosophila erecta] gi|190650875|gb|EDV48130.1| GG13974 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|17137726|ref|NP_477464.1| synaptotagmin 4 [Drosophila melanogaster] gi|195568936|ref|XP_002102468.1| GD19926 [Drosophila simulans] gi|5823558|gb|AAD53186.1|AF181098_1 synaptotagmin IV [Drosophila melanogaster] gi|10727109|gb|AAF54037.2| synaptotagmin 4 [Drosophila melanogaster] gi|194198395|gb|EDX11971.1| GD19926 [Drosophila simulans] gi|374858082|gb|AEZ68798.1| FI18813p1 [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|443685622|gb|ELT89176.1| synaptotagmin 4, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| FB|FBgn0028400 | 474 | Syt4 "Synaptotagmin 4" [Drosop | 0.829 | 0.225 | 0.642 | 1.3e-34 | |
| UNIPROTKB|H9L0N3 | 418 | SYT11 "Uncharacterized protein | 0.798 | 0.246 | 0.553 | 6.6e-26 | |
| UNIPROTKB|Q505J5 | 429 | Syt11 "Synaptotagmin XI" [Ratt | 0.798 | 0.240 | 0.543 | 8.4e-26 | |
| UNIPROTKB|E2RTB2 | 470 | SYT11 "Uncharacterized protein | 0.806 | 0.221 | 0.552 | 2e-24 | |
| MGI|MGI:1859547 | 430 | Syt11 "synaptotagmin XI" [Mus | 0.798 | 0.239 | 0.538 | 3.1e-24 | |
| UNIPROTKB|A6H7H8 | 431 | SYT11 "SYT11 protein" [Bos tau | 0.798 | 0.238 | 0.538 | 3.1e-24 | |
| RGD|62042 | 430 | Syt11 "synaptotagmin XI" [Ratt | 0.798 | 0.239 | 0.528 | 4.1e-24 | |
| UNIPROTKB|Q9BT88 | 431 | SYT11 "Synaptotagmin-11" [Homo | 0.798 | 0.238 | 0.528 | 4.2e-24 | |
| UNIPROTKB|B4DEU3 | 407 | SYT4 "cDNA FLJ51713, highly si | 0.798 | 0.253 | 0.524 | 7.1e-24 | |
| UNIPROTKB|F1PH85 | 425 | SYT4 "Uncharacterized protein" | 0.798 | 0.242 | 0.524 | 8.3e-24 |
| FB|FBgn0028400 Syt4 "Synaptotagmin 4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 375 (137.1 bits), Expect = 1.3e-34, P = 1.3e-34
Identities = 72/112 (64%), Positives = 86/112 (76%)
Query: 22 SSEIKSQGRGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVA 81
S +I++QGRGE+L+SLCWQPAA R T+V+LKARNLP+MDVTGLADPYVK+YLLY GQR+A
Sbjct: 324 SLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIA 383
Query: 82 KKKTHVKKRTLNPVYNESFVFEVPAXXXXXXXXXXXXXXXX-----RVTKNE 128
KKKTHVKKRTL+PV+NESF F++PA RVTKNE
Sbjct: 384 KKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNE 435
|
|
| UNIPROTKB|H9L0N3 SYT11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q505J5 Syt11 "Synaptotagmin XI" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RTB2 SYT11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1859547 Syt11 "synaptotagmin XI" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H7H8 SYT11 "SYT11 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|62042 Syt11 "synaptotagmin XI" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BT88 SYT11 "Synaptotagmin-11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DEU3 SYT4 "cDNA FLJ51713, highly similar to Synaptotagmin-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PH85 SYT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| cd08404 | 136 | cd08404, C2B_Synaptotagmin-4, C2 domain second rep | 3e-64 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 2e-46 | |
| cd08405 | 136 | cd08405, C2B_Synaptotagmin-7, C2 domain second rep | 5e-46 | |
| cd08403 | 134 | cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s | 1e-42 | |
| cd08402 | 136 | cd08402, C2B_Synaptotagmin-1, C2 domain second rep | 1e-41 | |
| cd04026 | 131 | cd04026, C2_PKC_alpha_gamma, C2 domain in Protein | 7e-30 | |
| cd08406 | 136 | cd08406, C2B_Synaptotagmin-12, C2 domain second re | 2e-28 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 9e-28 | |
| cd04030 | 127 | cd04030, C2C_KIAA1228, C2 domain third repeat pres | 3e-24 | |
| cd08385 | 124 | cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain | 5e-23 | |
| cd08387 | 124 | cd08387, C2A_Synaptotagmin-8, C2A domain first rep | 6e-23 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 7e-23 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 4e-22 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 8e-22 | |
| cd08409 | 137 | cd08409, C2B_Synaptotagmin-15, C2 domain second re | 8e-22 | |
| cd08410 | 135 | cd08410, C2B_Synaptotagmin-17, C2 domain second re | 2e-21 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 5e-21 | |
| cd08390 | 123 | cd08390, C2A_Synaptotagmin-15-17, C2A domain first | 3e-20 | |
| cd04009 | 133 | cd04009, C2B_Munc13-like, C2 domain second repeat | 4e-20 | |
| cd04031 | 125 | cd04031, C2A_RIM1alpha, C2 domain first repeat con | 8e-20 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 6e-19 | |
| cd04020 | 162 | cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat | 7e-19 | |
| cd08521 | 123 | cd08521, C2A_SLP, C2 domain first repeat present i | 1e-18 | |
| cd04035 | 123 | cd04035, C2A_Rabphilin_Doc2, C2 domain first repea | 1e-18 | |
| cd08407 | 138 | cd08407, C2B_Synaptotagmin-13, C2 domain second re | 1e-17 | |
| cd08393 | 125 | cd08393, C2A_SLP-1_2, C2 domain first repeat prese | 1e-16 | |
| cd08381 | 122 | cd08381, C2B_PI3K_class_II, C2 domain second repea | 5e-16 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 7e-15 | |
| cd08408 | 138 | cd08408, C2B_Synaptotagmin-14_16, C2 domain second | 3e-14 | |
| cd04029 | 125 | cd04029, C2A_SLP-4_5, C2 domain first repeat prese | 4e-14 | |
| cd04037 | 124 | cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer | 4e-14 | |
| cd08688 | 110 | cd08688, C2_KIAA0528-like, C2 domain found in the | 6e-14 | |
| cd04028 | 146 | cd04028, C2B_RIM1alpha, C2 domain second repeat co | 2e-13 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 3e-12 | |
| cd04033 | 133 | cd04033, C2_NEDD4_NEDD4L, C2 domain present in the | 5e-12 | |
| cd04025 | 123 | cd04025, C2B_RasA1_RasA4, C2 domain second repeat | 2e-11 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 6e-11 | |
| cd04043 | 126 | cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma | 2e-10 | |
| cd04017 | 135 | cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe | 2e-10 | |
| cd08392 | 128 | cd08392, C2A_SLP-3, C2 domain first repeat present | 4e-10 | |
| cd08389 | 124 | cd08389, C2A_Synaptotagmin-14_16, C2A domain first | 5e-10 | |
| cd04036 | 119 | cd04036, C2_cPLA2, C2 domain present in cytosolic | 2e-09 | |
| cd08391 | 121 | cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir | 2e-09 | |
| cd04039 | 108 | cd04039, C2_PSD, C2 domain present in Phosphatidyl | 2e-09 | |
| cd04018 | 151 | cd04018, C2C_Ferlin, C2 domain third repeat in Fer | 7e-09 | |
| cd04010 | 148 | cd04010, C2B_RasA3, C2 domain second repeat presen | 1e-08 | |
| cd08675 | 137 | cd08675, C2B_RasGAP, C2 domain second repeat of Ra | 2e-08 | |
| cd00275 | 128 | cd00275, C2_PLC_like, C2 domain present in Phospho | 2e-08 | |
| cd04011 | 111 | cd04011, C2B_Ferlin, C2 domain second repeat in Fe | 4e-08 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 5e-08 | |
| cd08676 | 153 | cd08676, C2A_Munc13-like, C2 domain first repeat i | 5e-08 | |
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 9e-08 | |
| cd08383 | 117 | cd08383, C2A_RasGAP, C2 domain (first repeat) of R | 9e-08 | |
| cd04027 | 127 | cd04027, C2B_Munc13, C2 domain second repeat in Mu | 2e-07 | |
| cd04042 | 121 | cd04042, C2A_MCTP_PRT, C2 domain first repeat foun | 2e-07 | |
| cd08373 | 127 | cd08373, C2A_Ferlin, C2 domain first repeat in Fer | 3e-07 | |
| cd04047 | 110 | cd04047, C2B_Copine, C2 domain second repeat in Co | 3e-07 | |
| cd08685 | 119 | cd08685, C2_RGS-like, C2 domain of the Regulator O | 7e-07 | |
| cd08377 | 119 | cd08377, C2C_MCTP_PRT, C2 domain third repeat foun | 1e-06 | |
| cd04041 | 111 | cd04041, C2A_fungal, C2 domain first repeat; funga | 1e-06 | |
| cd04046 | 126 | cd04046, C2_Calpain, C2 domain present in Calpain | 1e-06 | |
| cd08681 | 118 | cd08681, C2_fungal_Inn1p-like, C2 domain found in | 2e-06 | |
| cd04048 | 120 | cd04048, C2A_Copine, C2 domain first repeat in Cop | 5e-06 | |
| cd04050 | 105 | cd04050, C2B_Synaptotagmin-like, C2 domain second | 4e-05 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 5e-05 | |
| cd08692 | 135 | cd08692, C2B_Tac2-N, C2 domain second repeat found | 1e-04 | |
| cd08690 | 155 | cd08690, C2_Freud-1, C2 domain found in 5' repress | 1e-04 | |
| cd08382 | 123 | cd08382, C2_Smurf-like, C2 domain present in Smad | 2e-04 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 4e-04 | |
| cd08378 | 121 | cd08378, C2B_MCTP_PRT_plant, C2 domain second repe | 4e-04 | |
| cd04045 | 120 | cd04045, C2C_Tricalbin-like, C2 domain third repea | 6e-04 | |
| cd04014 | 132 | cd04014, C2_PKC_epsilon, C2 domain in Protein Kina | 7e-04 | |
| cd08375 | 136 | cd08375, C2_Intersectin, C2 domain present in Inte | 7e-04 | |
| cd04054 | 121 | cd04054, C2A_Rasal1_RasA4, C2 domain first repeat | 0.001 | |
| cd04052 | 111 | cd04052, C2B_Tricalbin-like, C2 domain second repe | 0.001 | |
| cd08395 | 120 | cd08395, C2C_Munc13, C2 domain third repeat in Mun | 0.002 |
| >gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
Score = 191 bits (487), Expect = 3e-64
Identities = 70/99 (70%), Positives = 87/99 (87%)
Query: 30 RGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVAKKKTHVKK 89
RGE+LLSLC+QP NR T+VVLKAR+LPKMDV+GLADPYVKV L Y +R++KKKTHVKK
Sbjct: 1 RGELLLSLCYQPTTNRLTVVVLKARHLPKMDVSGLADPYVKVNLYYGKKRISKKKTHVKK 60
Query: 90 RTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVTKNE 128
TLNPV+NESFVF++P++ L+ +S+E L+LD DRVTKNE
Sbjct: 61 CTLNPVFNESFVFDIPSEELEDISVEFLVLDSDRVTKNE 99
|
Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 4, a member of class 4 synaptotagmins, is located in the brain. It functions are unknown. It, like synaptotagmin-11, has an Asp to Ser substitution in its C2A domain. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the second C2 repeat, C2B, and has a type-I topology. Length = 136 |
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176052 cd08407, C2B_Synaptotagmin-13, C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >gnl|CDD|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176038 cd08392, C2A_SLP-3, C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176074 cd08692, C2B_Tac2-N, C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >gnl|CDD|176072 cd08690, C2_Freud-1, C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.94 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.94 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.93 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.93 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.93 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.92 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.92 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.92 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.9 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.9 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.9 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.9 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.9 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.9 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.89 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.89 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.89 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.89 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.89 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.89 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.89 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.89 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.89 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.88 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.88 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.88 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.87 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.87 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.86 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.86 | |
| KOG0696|consensus | 683 | 99.86 | ||
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.85 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.84 | |
| KOG1028|consensus | 421 | 99.83 | ||
| KOG1028|consensus | 421 | 99.82 | ||
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.81 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.8 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.76 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.74 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.73 | |
| KOG1030|consensus | 168 | 99.73 | ||
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.73 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.73 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.71 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.7 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.7 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.68 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.68 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.68 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.67 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.67 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.67 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.66 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.66 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.65 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.65 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.65 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.65 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.64 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.64 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.64 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.63 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.63 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.63 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.63 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.62 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.62 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.62 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.61 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.6 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.6 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.6 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.59 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.58 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.58 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.57 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.57 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.56 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.56 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.56 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.56 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.56 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 99.55 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.55 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.54 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.53 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.53 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.52 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.52 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.51 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.51 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.5 | |
| KOG1013|consensus | 362 | 99.47 | ||
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 99.46 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.46 | |
| KOG1328|consensus | 1103 | 99.45 | ||
| KOG0905|consensus | 1639 | 99.36 | ||
| PLN02223 | 537 | phosphoinositide phospholipase C | 99.3 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 99.26 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.25 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 99.19 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 99.19 | |
| PLN03008 | 868 | Phospholipase D delta | 99.17 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.14 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 99.13 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 99.08 | |
| KOG0169|consensus | 746 | 99.08 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.06 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 99.05 | |
| KOG1011|consensus | 1283 | 99.03 | ||
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.0 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 98.91 | |
| KOG1264|consensus | 1267 | 98.84 | ||
| KOG1013|consensus | 362 | 98.74 | ||
| KOG2059|consensus | 800 | 98.73 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 98.62 | |
| KOG2059|consensus | 800 | 98.57 | ||
| KOG1011|consensus | 1283 | 98.5 | ||
| KOG2060|consensus | 405 | 98.36 | ||
| KOG1031|consensus | 1169 | 98.34 | ||
| KOG1326|consensus | 1105 | 98.31 | ||
| KOG1327|consensus | 529 | 98.3 | ||
| PLN02270 | 808 | phospholipase D alpha | 98.19 | |
| KOG1328|consensus | 1103 | 98.09 | ||
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 97.89 | |
| KOG1326|consensus | 1105 | 97.78 | ||
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.3 | |
| KOG1265|consensus | 1189 | 97.1 | ||
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 96.45 | |
| PLN02352 | 758 | phospholipase D epsilon | 96.41 | |
| KOG3837|consensus | 523 | 96.31 | ||
| cd08399 | 178 | C2_PI3K_class_I_gamma C2 domain present in class I | 96.14 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 96.05 | |
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 95.9 | |
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 95.61 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 95.28 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 94.66 | |
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 94.38 | |
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 93.94 | |
| KOG1452|consensus | 442 | 93.86 | ||
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 93.62 | |
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 91.43 | |
| KOG1327|consensus | 529 | 91.26 | ||
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 90.95 | |
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 89.87 | |
| cd08687 | 98 | C2_PKN-like C2 domain in Protein kinase C-like (PK | 83.38 | |
| cd08696 | 179 | C2_Dock-C C2 domains found in Dedicator Of CytoKin | 81.82 | |
| cd08697 | 185 | C2_Dock-D C2 domains found in Dedicator Of CytoKin | 80.07 |
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.5e-26 Score=141.36 Aligned_cols=95 Identities=20% Similarity=0.324 Sum_probs=85.9
Q ss_pred eEEEEEEEEeCCCCEEEEEEEEEeCCCCCCCCCCCCcEEEEEEEeCCeEeeEEeeeeccCCCCCccCcEEEEEecCCCCC
Q psy11037 31 GEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLD 110 (129)
Q Consensus 31 G~l~~~~~~~~~~~~L~v~i~~a~~l~~~~~~~~~~pyv~~~l~~~~~~~~~~~T~~~~~~~~P~~~e~~~f~i~~~~~~ 110 (129)
|+|++++.|++..+.|.|.|++|++|+ . .+.+||||++++.++.. ..+.+|+++++++||.|||+|.|+++.+++.
T Consensus 1 ~~l~fsL~Y~~~~~~L~V~vikA~~L~-~--~g~sDPYVKv~L~~~~k-~~k~kT~v~rktlnPvfnE~f~F~v~~~~l~ 76 (118)
T cd08677 1 PKLHYSLSYDKQKAELHVNILEAENIS-V--DAGCECYISGCVSVSEG-QKEAQTALKKLALHTQWEEELVFPLPEEESL 76 (118)
T ss_pred CeEEEEEEEcCcCCEEEEEEEEecCCC-C--CCCCCeEEEEEEcCCcC-ccEEEcceecCCCCCccccEEEEeCCHHHhC
Confidence 689999999999999999999999998 3 35699999999986543 3567899999999999999999999999999
Q ss_pred ccEEEEEEEEcCCCCCCCC
Q psy11037 111 SVSLELLLLDWDRVTKNEA 129 (129)
Q Consensus 111 ~~~l~i~v~d~~~~~~~d~ 129 (129)
...|.|+|||+|+++++|+
T Consensus 77 ~~tL~~~V~d~Drfs~~d~ 95 (118)
T cd08677 77 DGTLTLTLRCCDRFSRHST 95 (118)
T ss_pred CcEEEEEEEeCCCCCCCce
Confidence 9999999999999999874
|
Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain. It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domain |
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >KOG2060|consensus | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG1265|consensus | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >KOG3837|consensus | Back alignment and domain information |
|---|
| >cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >KOG1452|consensus | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins | Back alignment and domain information |
|---|
| >cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 129 | ||||
| 1w15_A | 153 | Rat Synaptotagmin 4 C2b Domain In The Presence Of C | 6e-24 | ||
| 3n5a_A | 138 | Synaptotagmin-7, C2b-Domain, Calcium Bound Length = | 1e-20 | ||
| 1dqv_A | 296 | Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt | 4e-19 | ||
| 3hn8_A | 296 | Crystal Structure Of Synaptotagmin Length = 296 | 4e-19 | ||
| 2r83_A | 284 | Crystal Structure Analysis Of Human Synaptotagmin 1 | 5e-17 | ||
| 1tjm_A | 159 | Crystallographic Identification Of Sr2+ Coordinatio | 8e-17 | ||
| 1k5w_A | 152 | Three-Dimensional Structure Of The Synaptotagmin 1 | 9e-17 | ||
| 2lha_A | 151 | Solution Structure Of C2b With Ip6 Length = 151 | 9e-17 | ||
| 2uzp_A | 144 | Crystal Structure Of The C2 Domain Of Human Protein | 6e-12 | ||
| 2dmg_A | 142 | Solution Structure Of The Third C2 Domain Of Kiaa12 | 2e-11 | ||
| 3f00_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Wit | 2e-11 | ||
| 3f04_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Len | 2e-11 | ||
| 1rsy_A | 152 | Structure Of The First C2-domain Of Synaptotagmin I | 2e-11 | ||
| 2cm6_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin3a | 2e-11 | ||
| 1byn_A | 128 | Solution Structure Of The Calcium-Bound First C2-Do | 2e-11 | ||
| 3rpb_A | 140 | The C2b-Domain Of Rabphilin: Structural Variations | 3e-11 | ||
| 2cm5_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin Le | 1e-10 | ||
| 2d8k_A | 141 | Solution Structure Of The First C2 Domain Of Synapt | 3e-10 | ||
| 3gpe_A | 137 | Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain | 6e-09 | ||
| 1dsy_A | 139 | C2 Domain From Protein Kinase C (Alpha) Complexed W | 6e-09 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 1e-08 | ||
| 4dnl_A | 140 | Crystal Structure Of A C2 Domain Of A Protein Kinas | 1e-08 | ||
| 2chd_A | 142 | Crystal Structure Of The C2a Domain Of Rabphilin-3a | 3e-08 | ||
| 2k3h_A | 140 | Structural Determinants For Ca2+ And Pip2 Binding B | 3e-08 | ||
| 1a25_A | 149 | C2 Domain From Protein Kinase C (Beta) Length = 149 | 6e-08 | ||
| 2q3x_A | 171 | The Rim1alpha C2b Domain Length = 171 | 7e-08 | ||
| 3fdw_A | 148 | Crystal Structure Of A C2 Domain From Human Synapto | 2e-07 | ||
| 1ugk_A | 138 | Solution Structure Of The First C2 Domain Of Synapt | 5e-06 | ||
| 2bwq_A | 129 | Crystal Structure Of The Rim2 C2a-Domain At 1.4 Ang | 6e-06 | ||
| 1rh8_A | 142 | Three-Dimensional Structure Of The Calcium-Free Pic | 8e-06 | ||
| 2nsq_A | 155 | Crystal Structure Of The C2 Domain Of The Human E3 | 9e-06 | ||
| 1v27_A | 141 | Solution Structure Of The First C2 Domain Of Rim2 L | 2e-05 | ||
| 2b3r_A | 134 | Crystal Structure Of The C2 Domain Of Class Ii Phos | 3e-05 | ||
| 2enp_A | 147 | Solution Structure Of The First C2 Domain From Huma | 7e-05 | ||
| 3kwt_A | 148 | Munc13-1 C2b-Domain, Calcium-Free Length = 148 | 6e-04 |
| >pdb|1W15|A Chain A, Rat Synaptotagmin 4 C2b Domain In The Presence Of Calcium Length = 153 | Back alignment and structure |
|
| >pdb|3N5A|A Chain A, Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 138 | Back alignment and structure |
| >pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 | Back alignment and structure |
| >pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 | Back alignment and structure |
| >pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 | Back alignment and structure |
| >pdb|1TJM|A Chain A, Crystallographic Identification Of Sr2+ Coordination Site In Synaptotagmin I C2b Domain Length = 159 | Back alignment and structure |
| >pdb|1K5W|A Chain A, Three-Dimensional Structure Of The Synaptotagmin 1 C2b- Domain: Synaptotagmin 1 As A Phospholipid Binding Machine Length = 152 | Back alignment and structure |
| >pdb|2LHA|A Chain A, Solution Structure Of C2b With Ip6 Length = 151 | Back alignment and structure |
| >pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 | Back alignment and structure |
| >pdb|2DMG|A Chain A, Solution Structure Of The Third C2 Domain Of Kiaa1228 Protein Length = 142 | Back alignment and structure |
| >pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 | Back alignment and structure |
| >pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 | Back alignment and structure |
| >pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 | Back alignment and structure |
| >pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 | Back alignment and structure |
| >pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 | Back alignment and structure |
| >pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 | Back alignment and structure |
| >pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 | Back alignment and structure |
| >pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 | Back alignment and structure |
| >pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 | Back alignment and structure |
| >pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 | Back alignment and structure |
| >pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 | Back alignment and structure |
| >pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 | Back alignment and structure |
| >pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 | Back alignment and structure |
| >pdb|2Q3X|A Chain A, The Rim1alpha C2b Domain Length = 171 | Back alignment and structure |
| >pdb|3FDW|A Chain A, Crystal Structure Of A C2 Domain From Human Synaptotagmin- Like Protein 4 Length = 148 | Back alignment and structure |
| >pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 | Back alignment and structure |
| >pdb|2BWQ|A Chain A, Crystal Structure Of The Rim2 C2a-Domain At 1.4 Angstrom Resolution Length = 129 | Back alignment and structure |
| >pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 | Back alignment and structure |
| >pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 | Back alignment and structure |
| >pdb|1V27|A Chain A, Solution Structure Of The First C2 Domain Of Rim2 Length = 141 | Back alignment and structure |
| >pdb|2B3R|A Chain A, Crystal Structure Of The C2 Domain Of Class Ii Phosphatidylinositide 3-Kinase C2 Length = 134 | Back alignment and structure |
| >pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 | Back alignment and structure |
| >pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 4e-53 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 2e-52 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 3e-52 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 2e-50 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 2e-45 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 3e-34 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 3e-45 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 9e-36 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 2e-41 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 6e-41 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 1e-40 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 1e-40 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 2e-40 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 2e-40 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 4e-40 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 4e-39 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 9e-39 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 3e-38 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 8e-38 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 7e-37 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 2e-35 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 5e-35 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 1e-34 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 1e-34 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 2e-34 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 3e-34 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 7e-30 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 2e-28 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 9e-28 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 1e-04 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 6e-27 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 4e-25 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 1e-23 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 2e-22 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 2e-22 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 1e-20 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 5e-19 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 6e-19 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 5e-18 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 3e-09 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 2e-07 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 1e-06 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 3e-06 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 4e-06 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 3e-05 |
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
Score = 163 bits (414), Expect = 4e-53
Identities = 58/102 (56%), Positives = 81/102 (79%)
Query: 27 SQGRGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVAKKKTH 86
GRGE+L+SLC+Q N T+VVLKAR+LPK DV+GL+DPYVKV L + +R++KKKTH
Sbjct: 13 PSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTH 72
Query: 87 VKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVTKNE 128
VKK T N V+NE FVF++P ++L+ +S+E L+LD +R ++NE
Sbjct: 73 VKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNE 114
|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.91 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.91 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.91 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.9 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.9 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.9 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.89 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.89 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.89 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.89 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.88 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.88 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.88 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.88 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.88 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.88 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.88 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.87 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.86 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.85 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.85 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.84 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.84 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.83 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.83 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.81 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.73 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.73 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.72 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.7 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.7 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.68 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.67 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.67 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.66 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.66 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.66 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.63 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.54 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.54 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.53 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.49 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.44 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.42 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.38 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.12 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.08 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.07 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 98.98 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 98.02 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 97.8 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 91.77 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 91.56 | |
| 1e7u_A | 961 | Phosphatidylinositol 3-kinase catalytic subunit; p | 90.62 | |
| 3hhm_A | 1091 | Phosphatidylinositol-4,5-bisphosphate 3-kinase cat | 86.58 | |
| 2y3a_A | 1092 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 85.45 |
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
Probab=99.91 E-value=2e-23 Score=130.53 Aligned_cols=101 Identities=50% Similarity=0.943 Sum_probs=91.9
Q ss_pred cceEEEEEEEEeCCCCEEEEEEEEEeCCCCCCCCCCCCcEEEEEEEeCCeEeeEEeeeeccCCCCCccCcEEEEEecCCC
Q psy11037 29 GRGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADN 108 (129)
Q Consensus 29 ~~G~l~~~~~~~~~~~~L~v~i~~a~~l~~~~~~~~~~pyv~~~l~~~~~~~~~~~T~~~~~~~~P~~~e~~~f~i~~~~ 108 (129)
++|+|.+++.|.+..+.|.|.|++|++|...+..+.+||||++++.+.+....+.+|+++++++||.|||+|.|.+....
T Consensus 1 s~G~l~~sl~y~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~~~~~~kT~~~~~t~nP~wne~f~f~v~~~~ 80 (138)
T 3n5a_A 1 SRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEK 80 (138)
T ss_dssp CCCEEEEEEEEETTTTEEEEEEEEEESCCCCBTTTBCCEEEEEEEEETTEEEEEEECCCCSSCSSCEEEEEEEEECCGGG
T ss_pred CCcEEEEEEEEcCCCCeEEEEEEEeeCCCCcCCCCCcCeEEEEEEEeCCCccceEeCccccCCCCCcCcceEEEECChhh
Confidence 47999999999999999999999999999999888999999999988776667889999999999999999999998877
Q ss_pred CCccEEEEEEEEcCCCCCCCC
Q psy11037 109 LDSVSLELLLLDWDRVTKNEA 129 (129)
Q Consensus 109 ~~~~~l~i~v~d~~~~~~~d~ 129 (129)
+....|.|+|||+|.+++++|
T Consensus 81 l~~~~l~~~V~d~~~~~~~~~ 101 (138)
T 3n5a_A 81 LRETTIIITVMDKDKLSRNDV 101 (138)
T ss_dssp GGGEEEEEEEEECCSSSCCEE
T ss_pred cCceEEEEEEEECCCCCCCcE
Confidence 766689999999999888764
|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
| >3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A | Back alignment and structure |
|---|
| >2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 129 | ||||
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 9e-35 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 4e-30 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 3e-28 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 5e-28 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 2e-27 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 9e-26 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 6e-24 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 1e-21 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 8e-21 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 6e-18 | |
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 2e-17 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 1e-15 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 1e-13 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 1e-13 | |
| d1bdya_ | 123 | b.7.1.1 (A:) Domain from protein kinase C delta {R | 4e-11 | |
| d2zkmx2 | 122 | b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human | 6e-11 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 4e-09 | |
| d1gmia_ | 136 | b.7.1.1 (A:) Domain from protein kinase C epsilon | 2e-08 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 3e-08 | |
| d2cjta1 | 128 | b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no | 5e-06 |
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: Synaptotagmin IV species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 115 bits (288), Expect = 9e-35
Identities = 57/99 (57%), Positives = 80/99 (80%)
Query: 30 RGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVAKKKTHVKK 89
RGE+L+SLC+Q N T+VVLKAR+LPK DV+GL+DPYVKV L + +R++KKKTHVKK
Sbjct: 1 RGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKK 60
Query: 90 RTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVTKNE 128
T N V+NE FVF++P ++L+ +S+E L+LD +R ++NE
Sbjct: 61 CTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNE 99
|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.92 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.91 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.91 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.9 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.89 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.89 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.89 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.89 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.87 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.87 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.82 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.74 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.7 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.68 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.67 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.59 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.58 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.41 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.39 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.29 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 96.06 |
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: Synaptotagmin IV species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.92 E-value=4.1e-24 Score=132.69 Aligned_cols=100 Identities=57% Similarity=0.941 Sum_probs=86.9
Q ss_pred ceEEEEEEEEeCCCCEEEEEEEEEeCCCCCCCCCCCCcEEEEEEEeCCeEeeEEeeeeccCCCCCccCcEEEEEecCCCC
Q psy11037 30 RGEILLSLCWQPAANRFTIVVLKARNLPKMDVTGLADPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNL 109 (129)
Q Consensus 30 ~G~l~~~~~~~~~~~~L~v~i~~a~~l~~~~~~~~~~pyv~~~l~~~~~~~~~~~T~~~~~~~~P~~~e~~~f~i~~~~~ 109 (129)
+|+|+++++|.+..++|.|.|++|++|+..+..+.+||||++++.+++....+++|++++++.+|.|||+|.|.+...++
T Consensus 1 rG~l~~sl~Y~~~~~~L~V~v~~a~~L~~~~~~~~~dpyvkv~l~~~~~~~~~~kT~~~~~t~~P~wne~f~F~v~~~~~ 80 (138)
T d1w15a_ 1 RGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESL 80 (138)
T ss_dssp CCEEEEEEEEETTTTEEEEEEEEEESCC------CCCEEEEEEEEETTEEEEEEECCCCCSCSSEEEEEEEEEECCSSSS
T ss_pred CcEEEEEEEEcCCCCEEEEEEEEeECCCCCCCCCCcCEEEEEEEeCCcccCccccceeECCCCCCeECcEEEEEecHHHh
Confidence 69999999999999999999999999999988888999999999988877778899999999999999999999988888
Q ss_pred CccEEEEEEEEcCCCCCCCC
Q psy11037 110 DSVSLELLLLDWDRVTKNEA 129 (129)
Q Consensus 110 ~~~~l~i~v~d~~~~~~~d~ 129 (129)
....|.|+|||++.++++++
T Consensus 81 ~~~~l~i~v~d~~~~~~~~~ 100 (138)
T d1w15a_ 81 EEISVEFLVLDSERGSRNEV 100 (138)
T ss_dssp TTEEEEEEEEECCTTSCCEE
T ss_pred CccEEEEEEEeCCCCCCCCE
Confidence 77789999999999887753
|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|