Psyllid ID: psy11101

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MMDVARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKDT
cccccccccccccccccccccccccEEEEEccccccccccccccEEEEEEEccEEEEEEEEccccccccccEEEEEccccccccccccccccccccEEEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccc
cccEcccccccccEEcccEEEEcccEEEEccccccccccccccccHEEEEEEEEEEEEcHcccccccccccEEEEEEEEEEEEEccccccccccccEEEEEEccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
mmdvarlkgfdgkitaqgkllmrgplyctetsvasssssnsrgKELQVFLFEQSMIFSEAVGKKTQFSVNKMsveekvpeeltpagsggsrgglSAYFLLksidpkkpaltflcqapteesRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKDT
mmdvarlkgfdgkitaqgkllmrGPLYCTETsvasssssnsRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVpeeltpagsggsrGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQspiayqkelskdt
MMDVARLKGFDGKITAQGKLLMRGPLYCTETsvasssssnsRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAgsggsrgglsAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKDT
*********FDGKITAQGKLLMRGPLYCT****************LQVFLFEQSMIFSEAV********************************LSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIA*********
**DVARLKGFDGKITAQGKLLMRGPLYCTETSV**********KELQVFLFEQSMIF***************SVEEKVPEELTPAGSG*SRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQ*************
MMDVARLKGFDGKITAQGKLLMRGPLYCT**************KELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKDT
***VARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAY********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDVARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKDT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q86VW2580 Rho guanine nucleotide ex yes N/A 0.968 0.262 0.393 8e-20
Q9CWR0618 Rho guanine nucleotide ex yes N/A 0.968 0.245 0.393 3e-18
P97924 2959 Kalirin OS=Rattus norvegi yes N/A 0.828 0.043 0.372 5e-17
A2CG49 2964 Kalirin OS=Mus musculus G no N/A 0.828 0.043 0.372 6e-17
O75962 3097 Triple functional domain no N/A 0.847 0.042 0.345 6e-17
O60229 2985 Kalirin OS=Homo sapiens G no N/A 0.828 0.043 0.372 7e-17
Q0KL02 3102 Triple functional domain no N/A 0.847 0.042 0.358 8e-17
Q1LUA6 3028 Triple functional domain no N/A 0.923 0.047 0.364 5e-16
Q6P720579 Rho guanine nucleotide ex no N/A 0.751 0.203 0.367 2e-15
>sp|Q86VW2|ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens GN=ARHGEF25 PE=1 SV=2 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 87/155 (56%), Gaps = 3/155 (1%)

Query: 1   MMDVARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEA 60
           MM + RL+GF+GK+TAQGKLL +   + TE       SS  RG+E +VFLFEQ +IFSEA
Sbjct: 336 MMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSS--RGRERRVFLFEQIIIFSEA 393

Query: 61  VGKKTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEE 120
           +G   +       V  K   +++  G  G+  G    F L S  P+     ++ QA    
Sbjct: 394 LGGGVRGGTQPGYVY-KNSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQRYVLQAADPA 452

Query: 121 SRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSK 155
               W++ +  IL++QRDFL A+QSPI YQ+  S+
Sbjct: 453 ISQAWIKHVAQILESQRDFLNALQSPIEYQRRESQ 487
May play a role in actin cytoskeleton reorganization in different tissues since its activation induces formation of actin stress fibers. It works as a guanine nucleotide exchange factor for Rho family of small GTPases. Links specifically G alpha q/11-coupled receptors to RHOA activation. May be an important regulator of processes involved in axon and dendrite formation. In neurons seems to be an exchange factor primarily for RAC1. Involved in skeletal myogenesis.
Homo sapiens (taxid: 9606)
>sp|Q9CWR0|ARHGP_MOUSE Rho guanine nucleotide exchange factor 25 OS=Mus musculus GN=Arhgef25 PE=1 SV=1 Back     alignment and function description
>sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 Back     alignment and function description
>sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 Back     alignment and function description
>sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 Back     alignment and function description
>sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 Back     alignment and function description
>sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 Back     alignment and function description
>sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 Back     alignment and function description
>sp|Q6P720|ARHGP_RAT Rho guanine nucleotide exchange factor 25 OS=Rattus norvegicus GN=Arhgef25 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
157118318 518 triple functional domain, trio [Aedes ae 0.910 0.276 0.540 2e-39
380019501 2872 PREDICTED: triple functional domain prot 0.878 0.048 0.550 2e-38
328789247 3087 PREDICTED: triple functional domain prot 0.878 0.044 0.550 2e-38
158295353 2302 AGAP006107-PA [Anopheles gambiae str. PE 0.910 0.062 0.517 1e-37
270003787 2475 hypothetical protein TcasGA2_TC003063 [T 0.859 0.054 0.526 1e-37
312377863 644 hypothetical protein AND_10702 [Anophele 0.910 0.222 0.511 1e-37
158295355 744 AGAP006107-PB [Anopheles gambiae str. PE 0.910 0.192 0.517 2e-37
158295357 585 AGAP006107-PC [Anopheles gambiae str. PE 0.910 0.244 0.517 2e-37
307204441 3432 Triple functional domain protein [Harpeg 0.872 0.039 0.538 4e-37
189235151 1387 PREDICTED: similar to AGAP006107-PB [Tri 0.859 0.097 0.526 4e-37
>gi|157118318|ref|XP_001653168.1| triple functional domain, trio [Aedes aegypti] gi|108883291|gb|EAT47516.1| AAEL001393-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 117/172 (68%), Gaps = 29/172 (16%)

Query: 1   MMDVARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNS----RGKELQVFLFEQSMI 56
           MMDV RL+ F+GKITAQGKLL+ GPLYC E   ASSS  NS    + KEL VFLFEQ++I
Sbjct: 361 MMDVGRLQKFEGKITAQGKLLLHGPLYCVEG--ASSSDKNSYNAQKPKELHVFLFEQNII 418

Query: 57  FSEAVGKKTQFS-----------VNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDP 105
           F+E VGKKTQF+           VNKM++++   +      + G+R      F L SIDP
Sbjct: 419 FAEIVGKKTQFTSPSYIYKAHIQVNKMTLQDLSDQ------TNGNR------FSLCSIDP 466

Query: 106 KKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKDT 157
           ++ +L+F+C APT E  +EWL  +  ILQTQ DFLKAIQSPIAYQKEL+KD+
Sbjct: 467 QRSSLSFICTAPTIELHNEWLNTIRNILQTQNDFLKAIQSPIAYQKELTKDS 518

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380019501|ref|XP_003693643.1| PREDICTED: triple functional domain protein-like [Apis florea] Back     alignment and taxonomy information
>gi|328789247|ref|XP_003251251.1| PREDICTED: triple functional domain protein [Apis mellifera] Back     alignment and taxonomy information
>gi|158295353|ref|XP_316167.4| AGAP006107-PA [Anopheles gambiae str. PEST] gi|157015996|gb|EAA11276.4| AGAP006107-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|270003787|gb|EFA00235.1| hypothetical protein TcasGA2_TC003063 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312377863|gb|EFR24593.1| hypothetical protein AND_10702 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158295355|ref|XP_001688787.1| AGAP006107-PB [Anopheles gambiae str. PEST] gi|157015997|gb|EDO63793.1| AGAP006107-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158295357|ref|XP_001237770.2| AGAP006107-PC [Anopheles gambiae str. PEST] gi|157015998|gb|EAU76556.2| AGAP006107-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307204441|gb|EFN83148.1| Triple functional domain protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|189235151|ref|XP_968430.2| PREDICTED: similar to AGAP006107-PB [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
UNIPROTKB|F1MWU7619 ARHGEF25 "Uncharacterized prot 0.968 0.245 0.361 1.5e-16
UNIPROTKB|Q86VW2580 ARHGEF25 "Rho guanine nucleoti 0.968 0.262 0.361 1.7e-16
UNIPROTKB|F8W7Z4619 ARHGEF25 "Rho guanine nucleoti 0.968 0.245 0.361 2e-16
RGD|735210579 Arhgef25 "Rho guanine nucleoti 0.382 0.103 0.516 4.1e-16
UNIPROTKB|Q6P720579 Arhgef25 "Rho guanine nucleoti 0.382 0.103 0.516 4.1e-16
UNIPROTKB|F1SKH7622 LOC100517400 "Uncharacterized 0.968 0.244 0.354 4.2e-16
MGI|MGI:1277173618 Arhgef25 "Rho guanine nucleoti 0.968 0.245 0.361 5.3e-16
UNIPROTKB|F1PA09619 ARHGEF25 "Uncharacterized prot 0.968 0.245 0.354 5.3e-16
UNIPROTKB|F1NPK0 2952 KALRN "Uncharacterized protein 0.853 0.045 0.368 3e-14
UNIPROTKB|F1SRN4 1370 F1SRN4 "Uncharacterized protei 0.936 0.107 0.357 3.2e-14
UNIPROTKB|F1MWU7 ARHGEF25 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.5e-16, P = 1.5e-16
 Identities = 56/155 (36%), Positives = 81/155 (52%)

Query:     1 MMDVARLKGFDGKITAQGKLLMRGPLYCTETXXXXXXXXXXRGKELQVFLFEQSMIFSEA 60
             MM + RL+GF+GK+TAQGKLL +   + TE           RG+E +VFLFEQ +IFSEA
Sbjct:   375 MMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSS--RGRERRVFLFEQIIIFSEA 432

Query:    61 VGKKTQFSVNKMSVEEKVPEELTPAXXXXXXXXXXAYFLLKSIDPKKPALTFLCQAPTEE 120
             +G   +       V  K   +++              F L S  P+     ++ QA    
Sbjct:   433 LGGGVRGGAQPGYVY-KNSIKVSCLGLEANLQGDPCRFALTSRGPEGGIQRYVLQAADPA 491

Query:   121 SRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSK 155
                 W++ +  IL++QRDFL A+QSPI YQ+  S+
Sbjct:   492 ISQAWIKQVAQILESQRDFLNALQSPIEYQRRESQ 526
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=IEA
UNIPROTKB|Q86VW2 ARHGEF25 "Rho guanine nucleotide exchange factor 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8W7Z4 ARHGEF25 "Rho guanine nucleotide exchange factor 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|735210 Arhgef25 "Rho guanine nucleotide exchange factor (GEF) 25" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P720 Arhgef25 "Rho guanine nucleotide exchange factor 25" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKH7 LOC100517400 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1277173 Arhgef25 "Rho guanine nucleotide exchange factor (GEF) 25" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PA09 ARHGEF25 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPK0 KALRN "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRN4 F1SRN4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
cd13241140 cd13241, PH2_Kalirin_Trio_p63RhoGEF, p63RhoGEF ple 5e-59
cd13240123 cd13240, PH1_Kalirin_Trio_like, Triple functional 1e-04
smart00233102 smart00233, PH, Pleckstrin homology domain 4e-04
cd10572143 cd10572, PH_RhoGEF3_XPLN, Rho guanine nucleotide e 0.001
>gnl|CDD|241395 cd13241, PH2_Kalirin_Trio_p63RhoGEF, p63RhoGEF pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information 
 Score =  179 bits (456), Expect = 5e-59
 Identities = 77/157 (49%), Positives = 96/157 (61%), Gaps = 28/157 (17%)

Query: 4   VARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGK 63
           V RL+GFDGKITAQGKLL++  L  +E      +  +S+GKE +VFLFEQ +IFSE +GK
Sbjct: 1   VGRLQGFDGKITAQGKLLLQDTLLVSEPE----AGLSSKGKERRVFLFEQIIIFSEILGK 56

Query: 64  KTQFS-----------VNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKPALTF 112
           KTQFS           VNKMS+EE V  +                F L+S DP KP  +F
Sbjct: 57  KTQFSNPGYIYKNSIKVNKMSLEENVDGDPCR-------------FALRSRDPNKPGESF 103

Query: 113 LCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAY 149
           + QAP+ E R EW+  +  IL TQRDFL A+QSPIAY
Sbjct: 104 VLQAPSPEIRQEWVDTINQILDTQRDFLNALQSPIAY 140

The guanine nucleotide exchange factor p63RhoGEF is an effector of the heterotrimeric G protein, Galphaq and linking Galphaq-coupled receptors (GPCRs) to the activation of RhoA. The Dbl(DH) and PH domains of p63RhoGEF interact with the effector-binding site and the C-terminal region of Galphaq and appear to relieve autoinhibition of the catalytic DH domain by the PH domain. Trio, Duet, and p63RhoGEF are shown to constitute a family of Galphaq effectors that appear to activate RhoA both in vitro and in intact cells. Dbs is a guanine nucleotide exchange factor (GEF), which contains spectrin repeats, a rhoGEF (DH) domain and a PH domain. The Dbs PH domain participates in binding to both the Cdc42 and RhoA GTPases. Trio plays an essential role in regulating the actin cytoskeleton during axonal guidance and branching. Trio is a multidomain signaling protein that contains two RhoGEF(DH)-PH domains in tandem. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 140
>gnl|CDD|241394 cd13240, PH1_Kalirin_Trio_like, Triple functional domain pleckstrin homology pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241308 cd10572, PH_RhoGEF3_XPLN, Rho guanine nucleotide exchange factor 3 Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 100.0
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 100.0
KOG0689|consensus448 99.95
KOG4240|consensus1025 99.93
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 99.91
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 99.24
PF15411116 PH_10: Pleckstrin homology domain 99.22
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.19
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 99.15
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 99.12
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.05
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.01
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 98.6
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 98.39
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 98.18
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 98.12
KOG3518|consensus521 97.96
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.95
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 97.92
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 97.4
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 97.32
KOG4424|consensus 623 97.24
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 97.22
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 97.19
KOG2996|consensus 865 96.9
KOG3523|consensus695 96.71
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 96.59
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 95.86
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 95.63
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 95.26
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 95.15
KOG2070|consensus 661 94.61
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 94.58
KOG3521|consensus 846 94.52
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 94.47
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 94.35
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 94.14
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 94.13
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 93.93
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 93.91
KOG0931|consensus627 93.52
KOG3520|consensus 1167 93.26
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 93.06
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 92.7
PF1540989 PH_8: Pleckstrin homology domain 89.99
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 89.48
KOG0930|consensus395 88.92
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 87.6
PF15406112 PH_6: Pleckstrin homology domain 86.87
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 86.83
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 86.81
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 85.82
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 85.15
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 84.4
cd01229129 PH_etc2 Epithelial cell transforming 2 (ECT2) plec 84.14
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 83.99
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 81.31
PTZ00267478 NIMA-related protein kinase; Provisional 80.45
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information 
Probab=100.00  E-value=4.9e-38  Score=238.56  Aligned_cols=125  Identities=19%  Similarity=0.261  Sum_probs=96.8

Q ss_pred             cceeeeccEEEEECCCC-C--CCCcCCCCceeEEEeecceeEEEEeecCC-CCceeeeeeceecCCCCcCCCCCCCCCCC
Q psy11101         18 GKLLMRGPLYCTETSVA-S--SSSSNSRGKELQVFLFEQSMIFSEAVGKK-TQFSVNKMSVEEKVPEELTPAGSGGSRGG   93 (157)
Q Consensus        18 G~LL~qd~f~V~e~~~~-~--~~~~~~k~keR~VFLFEq~lifsk~~~~k-~~~~~~~~~l~e~~~~~~~~~g~~~~~~g   93 (157)
                      |+||+||+|+||++.+. .  .+..+.|+++|||||||++|||||+.+++ .+|....+.++.+...  ..+|++|+++|
T Consensus         1 G~ll~Qd~f~Vw~~~~~~~~~k~~~r~K~~eRhVFLFE~~viF~K~~~~~~~~~~~p~Y~yK~~ikl--s~lglte~v~g   78 (133)
T cd01227           1 GKLLMQGSFSVWTDHKKGHTKKELARFKPMQRHIFLHEKAVLFCKKREENGEGEKAPSYSFKQSLKM--TAVGITENVKG   78 (133)
T ss_pred             CCceEecceEEEEccccccchhhhhccCCceeEEEEecceEEEEEEeccCCCCCcceeEEEeeeEEe--ecccccccCCC
Confidence            89999999999987421 1  12335689999999999999999998532 2222112222222221  34677777788


Q ss_pred             CccEEEEEecCCCCCCceEEEEcCChHHHHHHHHHHHHHHHHHHHHHHhccCch
Q psy11101         94 LSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPI  147 (157)
Q Consensus        94 d~~kF~iw~~~~~~~~~~~~LqA~s~e~K~~Wv~~I~~iL~~Q~~~l~al~~Pi  147 (157)
                      |+|||+||++++   .++|+|||+|+++|++|+++|++||++|+++|+|+++|-
T Consensus        79 d~~kFeiw~~~~---~~~yilqA~t~e~K~~Wv~~I~~iL~~Q~~~lk~~~~~~  129 (133)
T cd01227          79 DTKKFEIWYNAR---EEVYILQAPTPEIKAAWVNEIRKVLTSQLQACKEASQHR  129 (133)
T ss_pred             CccEEEEEeCCC---CcEEEEEcCCHHHHHHHHHHHHHHHHHHHHHHHhhcCcc
Confidence            999999999863   479999999999999999999999999999999999993

Dbs (DBL's big sister) pleckstrin homology (PH) domain. Dbs is a guanine nucleotide exchange factor (GEF), which contains spectrin repeats, a rhoGEF (DH) domain and a PH domain. The Dbs PH domain participates in binding to both the Cdc42 and RhoA GTPases. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3521|consensus Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0931|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01229 PH_etc2 Epithelial cell transforming 2 (ECT2) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2rgn_B354 Crystal Structure Of P63rhogef Complex With Galpha- 2e-18
>pdb|2RGN|B Chain B, Crystal Structure Of P63rhogef Complex With Galpha-Q And Rhoa Length = 354 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 3/155 (1%)
Query: 1   MMDVARLKGFDGKITAQGKLLMRGPLYCTETXXXXXXXXXXRGKELQVFLFEQSMIFSEA 60
           MM + RL+GF+GK+TAQGKLL +   + TE           RG+E +VFLFEQ +IFSEA
Sbjct: 188 MMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSS--RGRERRVFLFEQIIIFSEA 245
Query: 61  VGKKTQFSVNKMSVEEKVPEELTPAXXXXXXXXXXAYFLLKSIDPKKPALTFLCQAPTEE 120
           +G   +       V  K   +++              F L S  P+     ++ QA    
Sbjct: 246 LGGGVRGGTQPGYVY-KNSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQRYVLQAADPA 304
Query: 121 SRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSK 155
               W++ +  IL++QRDFL A+QSPI YQ+  S+
Sbjct: 305 ISQAWIKHVAQILESQRDFLNALQSPIEYQRRESQ 339

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 5e-27
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 3e-17
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 1e-16
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 5e-14
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 6e-14
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 4e-13
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 3e-11
1foe_A377 T-lymphoma invasion and metastasis inducing protei 2e-09
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 7e-09
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 2e-06
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 4e-06
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-05
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 6e-05
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 6e-05
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 3e-04
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 3e-04
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 4e-04
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
 Score =  102 bits (256), Expect = 5e-27
 Identities = 58/168 (34%), Positives = 85/168 (50%), Gaps = 27/168 (16%)

Query: 1   MMDVARLKGFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEA 60
           MM + RL+GF+GK+TAQGKLL +   + TE         +SRG+E +VFLFEQ +IFSEA
Sbjct: 188 MMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEA--GGLLSSRGRERRVFLFEQIIIFSEA 245

Query: 61  VGK------------KTQFSVNKMSVEEKVPEELTPAGSGGSRGGLSAYFLLKSIDPKKP 108
           +G             K    V+ + +E  +  +                F L S  P+  
Sbjct: 246 LGGGVRGGTQPGYVYKNSIKVSCLGLEGNLQGD-------------PCRFALTSRGPEGG 292

Query: 109 ALTFLCQAPTEESRSEWLRCLGLILQTQRDFLKAIQSPIAYQKELSKD 156
              ++ QA        W++ +  IL++QRDFL A+QSPI YQ+  S+ 
Sbjct: 293 IQRYVLQAADPAISQAWIKHVAQILESQRDFLNALQSPIEYQRRESQT 340
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Length = 119 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Length = 185 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 99.97
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 99.93
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 99.81
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 99.81
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 99.51
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.5
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 99.49
1foe_A377 T-lymphoma invasion and metastasis inducing protei 99.48
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 99.46
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 99.44
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 99.43
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.42
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 99.36
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 99.36
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 99.26
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 99.22
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.17
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 99.16
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.1
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 98.99
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 98.85
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 98.78
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.48
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 97.01
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 96.88
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 96.86
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 96.67
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 96.61
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 96.48
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 96.46
2yry_A122 Pleckstrin homology domain-containing family A mem 96.45
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 96.35
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 96.33
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 96.3
2d9y_A117 Pleckstrin homology domain-containing protein fami 96.14
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 96.1
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 96.09
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 96.03
3rcp_A103 Pleckstrin homology domain-containing family A ME; 95.96
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 95.9
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 95.79
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 95.78
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 95.69
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 95.62
2dkp_A128 Pleckstrin homology domain-containing family A mem 95.6
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 95.51
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 95.37
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 95.34
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 95.32
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 95.19
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.18
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 95.03
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 94.87
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 94.86
3cxb_B112 Pleckstrin homology domain-containing family M mem 94.39
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 94.36
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 94.16
3aj4_A112 Pleckstrin homology domain-containing family B ME; 94.0
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 93.92
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 93.92
1v88_A130 Oxysterol binding protein-related protein 8; vesic 93.64
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 93.62
2d9v_A130 Pleckstrin homology domain-containing protein fami 93.39
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 93.39
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 93.23
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 93.23
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 93.17
1u5e_A211 SRC-associated adaptor protein; novel dimerization 92.89
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 92.84
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 92.83
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 92.77
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 92.51
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 90.91
1v5p_A126 Pleckstrin homology domain-containing, family A; T 89.35
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 88.31
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 87.34
1wi1_A126 Calcium-dependent activator protein for secretion, 86.51
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 84.22
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 84.08
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 82.98
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 82.92
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 82.6
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 81.13
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
Probab=99.97  E-value=2e-31  Score=197.78  Aligned_cols=99  Identities=17%  Similarity=0.268  Sum_probs=83.1

Q ss_pred             cChhcccceeeeccEEEEECCCCCCCCcCCCCceeEEEeecceeEEEEeecCC--CCce------eeeeeceecCCCCcC
Q psy11101         12 GKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKK--TQFS------VNKMSVEEKVPEELT   83 (157)
Q Consensus        12 g~l~~qG~LL~qd~f~V~e~~~~~~~~~~~k~keR~VFLFEq~lifsk~~~~k--~~~~------~~~~~l~e~~~~~~~   83 (157)
                      |||++||+||+||+|+||++.        +|+++|||||||++|||||+++..  ..|.      +++|++++++++   
T Consensus         2 G~L~~~G~Ll~q~~f~V~~~~--------~k~~eR~vFLFe~~ilf~K~~~~~~~~~Y~~K~~ikl~~~~lte~~~~---   70 (119)
T 1fho_A            2 GDTGKLGRIIRHDAFQVWEGD--------EPPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHTTD---   70 (119)
T ss_dssp             CSCCCCCCSSEEEEEEECSTT--------CSCEEEEEEEETTEEEEEEECCSSSSCCCSSCCEEESSSCEEEEECTT---
T ss_pred             CChHHcCCccccCceEEEeCC--------CCcceEEEEEecCcEEEEEEecCCCCCcEEEeeEEeeceeEEEecCCC---
Confidence            899999999999999999973        689999999999999999998432  2332      677777776541   


Q ss_pred             CCCCCCCCCCCccEEEEEecCCCCCCceEEE--EcCChH-HHHHHHHHHHHHH
Q psy11101         84 PAGSGGSRGGLSAYFLLKSIDPKKPALTFLC--QAPTEE-SRSEWLRCLGLIL  133 (157)
Q Consensus        84 ~~g~~~~~~gd~~kF~iw~~~~~~~~~~~~L--qA~s~e-~K~~Wv~~I~~iL  133 (157)
                               ||+|+|+||++++   .+.|++  ||+|++ +|++|+++|++++
T Consensus        71 ---------~d~~kFeiw~~~~---~~~~il~~qA~s~e~~K~~Wv~~I~~~~  111 (119)
T 1fho_A           71 ---------EDTIVLQPQEPGL---PSFRIKPKDFETSEYVRKAWLRDIAEEQ  111 (119)
T ss_dssp             ---------CCEEEEECCSTTC---CCBCCCCCSSSSCSHHHHHHHHHHHTCC
T ss_pred             ---------CCCcEEEEccCCC---CceEEEeeecCCcHHHHHHHHHHHHHHH
Confidence                     5899999999753   358999  999999 9999999999953
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1ntya2121 b.55.1.1 (A:1415-1535) Triple functional domain pr 2e-18
d1kz7a2147 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse 2e-15
d1fhoa_119 b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis ele 3e-09
d1xcga2140 b.55.1.1 (A:942-1081) Rho guanine nucleotide excha 6e-08
d1dbha2133 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H 1e-07
d2dfka2162 b.55.1.1 (A:240-401) Rho guanine nucleotide exchan 1e-06
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 1e-05
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 2e-05
d1txda2114 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exch 2e-04
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 0.003
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Triple functional domain protein TRIO
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.2 bits (182), Expect = 2e-18
 Identities = 28/129 (21%), Positives = 55/129 (42%), Gaps = 11/129 (8%)

Query: 9   GFDGKITAQGKLLMRGPLYCTETSVASSSSSNSRGKELQVFLFEQSMIFSEAVGKKTQFS 68
           GFD  I +QG+L+++         V    +   +G+E  +FLFE S++FS+ V   +  S
Sbjct: 2   GFDENIESQGELILQESF-----QVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRS 56

Query: 69  VNKMSVEEKVPE-ELTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLR 127
                 +    E  +T    G         F L            + +A + E++ +W++
Sbjct: 57  KYLYKSKLFTSELGVTEHVEGDPCK-----FALWVGRTPTSDNKIVLKASSIENKQDWIK 111

Query: 128 CLGLILQTQ 136
            +  ++Q +
Sbjct: 112 HIREVIQER 120
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 147 Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 119 Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 162 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.96
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 99.96
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 99.93
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 99.79
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.78
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 99.67
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 99.62
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 99.61
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 99.45
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 99.27
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 97.89
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 97.33
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 97.28
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 97.08
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 97.06
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 97.06
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 97.05
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 97.0
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 96.83
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 96.46
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 96.42
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 96.4
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 96.4
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 95.91
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 95.75
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 95.68
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 95.52
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 95.39
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 94.85
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 94.75
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 94.49
d1wi1a_126 Calcium-dependent activator protein for secretion, 94.29
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 94.27
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 94.24
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 93.84
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 93.62
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 93.29
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 93.13
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 92.37
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 92.18
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 91.86
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 89.98
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 89.89
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 89.42
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 88.94
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Dbl's big sister, Dbs
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=6e-30  Score=192.24  Aligned_cols=126  Identities=21%  Similarity=0.338  Sum_probs=91.6

Q ss_pred             hCCccChhcccceeeeccEEEEECCCCCC----CCcCCCCceeEEEeecceeEEEEeecCCCCc--eeeeeeceecCCCC
Q psy11101          8 KGFDGKITAQGKLLMRGPLYCTETSVASS----SSSNSRGKELQVFLFEQSMIFSEAVGKKTQF--SVNKMSVEEKVPEE   81 (157)
Q Consensus         8 ~g~dg~l~~qG~LL~qd~f~V~e~~~~~~----~~~~~k~keR~VFLFEq~lifsk~~~~k~~~--~~~~~~l~e~~~~~   81 (157)
                      +||||||+++|+||+||+|+||++.+...    .....|+++||||||+++|||||+...+...  ....+.+.+.... 
T Consensus         1 ~G~~g~l~~~G~Ll~qg~~~v~~~~~~~~~~~~~~~~~K~~~R~~FLF~~~Li~cK~~~~~~~~~~~~~~y~~k~~~~~-   79 (147)
T d1kz7a2           1 TGYDGNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNM-   79 (147)
T ss_dssp             ESCCSCGGGGCCEEEEEEEEEEECCCCC-----CCCSSSCEEEEEEEESSEEEEEEEECCCCSSCCCSCEEEEEEEEEG-
T ss_pred             CCCCCcHHHcCCEEEeeeEEEEecCccchhhhhhhhccCCceEEEEEecCcEEEEEecccCCcccccCceEEEeeEEec-
Confidence            59999999999999999999998853210    1234577899999999999999997643210  0111111111110 


Q ss_pred             cCCCCCCCCCCCCccEEEEEecCCCCCCceEEEEcCChHHHHHHHHHHHHHHHHHHH
Q psy11101         82 LTPAGSGGSRGGLSAYFLLKSIDPKKPALTFLCQAPTEESRSEWLRCLGLILQTQRD  138 (157)
Q Consensus        82 ~~~~g~~~~~~gd~~kF~iw~~~~~~~~~~~~LqA~s~e~K~~Wv~~I~~iL~~Q~~  138 (157)
                       +.++++++.++++++|.||.+++   ..+|+|+|+|++.|++|+++|+++|++|..
T Consensus        80 -~~~~v~~~~~~~~~~f~~~~~~~---~~~~~l~a~s~eeK~~W~~~I~~~l~~q~~  132 (147)
T d1kz7a2          80 -TAVGITENVKGDTKKFEIWYNAR---EEVYIIQAPTPEIKAAWVNAIRKVLTSQLQ  132 (147)
T ss_dssp             -GGEEEECCBTTBTTEEEEEETTT---TEEEEEECSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             -CCceeEecCCCCcceEEEEeCCC---CcEEEEEeCCHHHHHHHHHHHHHHHHHHHH
Confidence             12333444556899999999753   468999999999999999999999999853
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure