Psyllid ID: psy11102


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MTTLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVVQDKPS
cHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHccccc
ccHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHccccc
MTTLVSQAREYYEKCHCYEKLISVYTELGDFEALEScarklpdsspllkpmgEIFVKYGLCEQAVYVfdknkhkssqwltvvqdkps
MTTLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKnkhkssqwltvvqdkps
MTTLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVVQDKPS
*******AREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTV******
****VSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVVQ****
MTTLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVVQDKPS
*TTLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVVQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVVQDKPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q8BND3 1181 WD repeat-containing prot yes N/A 0.735 0.054 0.421 3e-07
A6N6J5 1170 WD repeat-containing prot no N/A 0.735 0.054 0.421 3e-07
Q9P2L0 1181 WD repeat-containing prot yes N/A 0.735 0.054 0.406 1e-06
>sp|Q8BND3|WDR35_MOUSE WD repeat-containing protein 35 OS=Mus musculus GN=Wdr35 PE=2 SV=3 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%)

Query: 7   QAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVY 66
            A +YY K    E+L   Y  L D+E LE+ A  LP++  LL  + ++FV+ G+CEQAV 
Sbjct: 818 NAVQYYVKGRNQERLAECYYMLEDYEGLETLANSLPENHKLLPEIAQMFVRVGMCEQAVS 877

Query: 67  VFDK 70
            F K
Sbjct: 878 AFLK 881




May promote CASP3 activation and TNF-stimulated apoptosis (By similarity). Required for ciliogenesis.
Mus musculus (taxid: 10090)
>sp|A6N6J5|WDR35_RAT WD repeat-containing protein 35 OS=Rattus norvegicus GN=Wdr35 PE=1 SV=1 Back     alignment and function description
>sp|Q9P2L0|WDR35_HUMAN WD repeat-containing protein 35 OS=Homo sapiens GN=WDR35 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
383864328 1183 PREDICTED: WD repeat-containing protein 0.724 0.053 0.476 4e-08
393906091 1130 WD repeat protein 35 [Loa loa] 0.712 0.054 0.467 1e-07
312087100 711 hypothetical protein LOAG_09759 [Loa loa 0.712 0.087 0.467 1e-07
195403421 1190 GJ16079 [Drosophila virilis] gi|19414062 0.724 0.052 0.444 2e-07
66515913 1185 PREDICTED: WD repeat-containing protein 0.724 0.053 0.460 2e-07
380012543 1185 PREDICTED: WD repeat-containing protein 0.724 0.053 0.460 2e-07
324511121 433 WD repeat-containing protein 35 [Ascaris 0.724 0.145 0.476 3e-07
340503426 1187 WD repeat protein [Ichthyophthirius mult 0.735 0.053 0.468 4e-07
195428849 1224 GK17561 [Drosophila willistoni] gi|19415 0.724 0.051 0.412 4e-07
290992023 1186 hypothetical protein NAEGRDRAFT_32701 [N 0.643 0.047 0.446 7e-07
>gi|383864328|ref|XP_003707631.1| PREDICTED: WD repeat-containing protein 35-like [Megachile rotundata] Back     alignment and taxonomy information
 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 37/63 (58%)

Query: 8   AREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYV 67
           AREYYEK    EKLI  Y +L DF  L    ++LPD SPLLK +  +    G+C QAV  
Sbjct: 816 AREYYEKSRNLEKLIDCYYKLEDFVQLAGTVQQLPDKSPLLKTVARMLASVGMCSQAVAA 875

Query: 68  FDK 70
           + K
Sbjct: 876 YIK 878




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|393906091|gb|EJD74175.1| WD repeat protein 35 [Loa loa] Back     alignment and taxonomy information
>gi|312087100|ref|XP_003145337.1| hypothetical protein LOAG_09759 [Loa loa] Back     alignment and taxonomy information
>gi|195403421|ref|XP_002060288.1| GJ16079 [Drosophila virilis] gi|194140627|gb|EDW57101.1| GJ16079 [Drosophila virilis] Back     alignment and taxonomy information
>gi|66515913|ref|XP_394812.2| PREDICTED: WD repeat-containing protein 35-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380012543|ref|XP_003690339.1| PREDICTED: WD repeat-containing protein 35-like [Apis florea] Back     alignment and taxonomy information
>gi|324511121|gb|ADY44640.1| WD repeat-containing protein 35 [Ascaris suum] Back     alignment and taxonomy information
>gi|340503426|gb|EGR30016.1| WD repeat protein [Ichthyophthirius multifiliis] Back     alignment and taxonomy information
>gi|195428849|ref|XP_002062478.1| GK17561 [Drosophila willistoni] gi|194158563|gb|EDW73464.1| GK17561 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|290992023|ref|XP_002678634.1| hypothetical protein NAEGRDRAFT_32701 [Naegleria gruberi] gi|284092247|gb|EFC45890.1| hypothetical protein NAEGRDRAFT_32701 [Naegleria gruberi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
FB|FBgn0035264 1205 Oseg4 "Oseg4" [Drosophila mela 0.666 0.048 0.431 1.4e-07
RGD|1564116 1170 Wdr35 "WD repeat domain 35" [R 0.793 0.058 0.414 3.7e-07
MGI|MGI:1921932 1181 Wdr35 "WD repeat domain 35" [M 0.793 0.058 0.414 3.7e-07
UNIPROTKB|F1SCU2 1186 WDR35 "Uncharacterized protein 0.793 0.058 0.4 7.8e-07
UNIPROTKB|E1BWD7 1180 WDR35 "Uncharacterized protein 0.793 0.058 0.385 2.1e-06
ZFIN|ZDB-GENE-060810-148 1203 wdr35 "WD repeat domain 35" [D 0.793 0.057 0.4 2.1e-06
UNIPROTKB|Q9P2L0 1181 WDR35 "WD repeat-containing pr 0.724 0.053 0.412 4.3e-06
FB|FBgn0035264 Oseg4 "Oseg4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 134 (52.2 bits), Expect = 1.4e-07, P = 1.4e-07
 Identities = 25/58 (43%), Positives = 33/58 (56%)

Query:     8 AREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAV 65
             AREYYEK H  E  +     L  F+ LE C  +LP+ SPLL  + E+    G+C +AV
Sbjct:   832 AREYYEKSHYLEGYMEALYHLEQFDDLEKCVERLPEKSPLLPKLAEMLASVGMCSEAV 889




GO:0003674 "molecular_function" evidence=ND
GO:0042384 "cilium assembly" evidence=ISM;IEP
GO:0035058 "nonmotile primary cilium assembly" evidence=ISS
GO:0031513 "nonmotile primary cilium" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
RGD|1564116 Wdr35 "WD repeat domain 35" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1921932 Wdr35 "WD repeat domain 35" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCU2 WDR35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWD7 WDR35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060810-148 wdr35 "WD repeat domain 35" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2L0 WDR35 "WD repeat-containing protein 35" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
KOG2041|consensus 1189 99.94
KOG3617|consensus 1416 98.95
KOG1538|consensus 1081 98.32
KOG1920|consensus 1265 97.93
KOG1538|consensus 1081 97.44
KOG3616|consensus 1636 97.41
KOG3616|consensus 1636 97.4
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 97.28
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.25
KOG3617|consensus 1416 96.91
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.89
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.62
KOG0276|consensus794 96.52
KOG2041|consensus 1189 96.5
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.41
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.2
PF14938 282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.08
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.04
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 95.94
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 95.82
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.64
PLN03077 857 Protein ECB2; Provisional 95.36
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.22
PF1337173 TPR_9: Tetratricopeptide repeat 95.2
smart00299140 CLH Clathrin heavy chain repeat homology. 95.19
PRK15359144 type III secretion system chaperone protein SscB; 95.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.12
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.0
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.97
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.83
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.82
PRK11788389 tetratricopeptide repeat protein; Provisional 94.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 94.76
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.68
smart00299140 CLH Clathrin heavy chain repeat homology. 94.56
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 94.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 94.34
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 93.82
KOG0553|consensus 304 93.79
cd00189100 TPR Tetratricopeptide repeat domain; typically con 93.37
PRK11788 389 tetratricopeptide repeat protein; Provisional 93.21
PF14938 282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.95
KOG1920|consensus 1265 92.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 92.71
KOG2280|consensus829 92.47
KOG0548|consensus 539 92.2
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 92.14
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 91.85
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 91.7
PRK10803263 tol-pal system protein YbgF; Provisional 91.7
PRK02603172 photosystem I assembly protein Ycf3; Provisional 91.68
PF12688120 TPR_5: Tetratrico peptide repeat 91.67
KOG2003|consensus 840 91.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 91.61
PRK10370198 formate-dependent nitrite reductase complex subuni 91.59
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 91.44
PLN03077 857 Protein ECB2; Provisional 91.39
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 91.31
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.93
KOG2076|consensus 895 90.92
KOG4626|consensus 966 90.71
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 90.67
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 90.55
PLN03218 1060 maturation of RBCL 1; Provisional 90.34
KOG3060|consensus289 90.28
PLN03218 1060 maturation of RBCL 1; Provisional 90.26
KOG1586|consensus 288 90.19
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 89.95
PRK11189 296 lipoprotein NlpI; Provisional 89.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 89.86
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 89.84
PRK12370553 invasion protein regulator; Provisional 89.66
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 88.8
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 88.67
KOG1585|consensus 308 88.66
PRK15359144 type III secretion system chaperone protein SscB; 88.36
KOG1586|consensus 288 88.23
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 87.84
PF0914546 Ubiq-assoc: Ubiquitin-associated; InterPro: IPR015 87.77
PRK02603172 photosystem I assembly protein Ycf3; Provisional 87.47
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 87.38
PRK10370198 formate-dependent nitrite reductase complex subuni 87.06
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 87.03
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 85.51
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.5
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.47
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 85.19
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 85.18
PRK10747398 putative protoheme IX biogenesis protein; Provisio 84.84
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 84.69
PRK12370 553 invasion protein regulator; Provisional 84.52
KOG1155|consensus559 84.3
PF12931 284 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_ 83.77
KOG0547|consensus606 83.57
KOG1125|consensus579 83.15
KOG0543|consensus397 82.6
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 82.39
PF1285434 PPR_1: PPR repeat 82.28
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.72
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 80.82
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 80.62
PRK14574 822 hmsH outer membrane protein; Provisional 80.35
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 80.21
>KOG2041|consensus Back     alignment and domain information
Probab=99.94  E-value=1.3e-27  Score=193.97  Aligned_cols=83  Identities=31%  Similarity=0.447  Sum_probs=82.0

Q ss_pred             hhHHHHHHHHHHhccHHHHHHHHHHhCCHHHHHHHHhhCCCCCchHHHHHHHHHhCCChHHHHHHHHhcCCHHHHHHHHh
Q psy11102          3 TLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVV   82 (87)
Q Consensus         3 ~~w~~A~~yY~~~~n~~k~ie~~~~~ed~d~L~~l~~~L~~~~~lL~~ia~~F~~~G~~~~Av~aylk~gd~k~ai~~cv   82 (87)
                      +.|++|++||+++||.+..|||||++++|++||.+++.||++|++|+.+|+||+++|||+|||+||+|++++|+|+.+||
T Consensus       810 ~~We~A~~yY~~~~~~e~~~ecly~le~f~~LE~la~~Lpe~s~llp~~a~mf~svGMC~qAV~a~Lr~s~pkaAv~tCv  889 (1189)
T KOG2041|consen  810 MEWEEAAKYYSYCGDTENQIECLYRLELFGELEVLARTLPEDSELLPVMADMFTSVGMCDQAVEAYLRRSLPKAAVHTCV  889 (1189)
T ss_pred             HHHHHHHHHHHhccchHhHHHHHHHHHhhhhHHHHHHhcCcccchHHHHHHHHHhhchHHHHHHHHHhccCcHHHHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcC
Q psy11102         83 QDK   85 (87)
Q Consensus        83 ~~~   85 (87)
                      ++|
T Consensus       890 ~Ln  892 (1189)
T KOG2041|consen  890 ELN  892 (1189)
T ss_pred             HHH
Confidence            987



>KOG3617|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF09145 Ubiq-assoc: Ubiquitin-associated; InterPro: IPR015228 Ubiquitin-associated domains contain approximately 40 residues and bind ubiquitin noncovalently Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF12931 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_C Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.22
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.48
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.47
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.71
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.51
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.47
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.44
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.36
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.35
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.26
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.2
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.18
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.07
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.06
3k9i_A117 BH0479 protein; putative protein binding protein, 97.02
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.0
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.0
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.98
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.95
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.95
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.93
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.88
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.87
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.76
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.75
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.73
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.72
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.68
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.63
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.59
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.56
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.53
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.51
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.49
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.48
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.48
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.47
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.44
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 96.42
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.41
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.39
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.36
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.35
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.33
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.32
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.31
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.22
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 96.22
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.19
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 96.14
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.1
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.04
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 96.04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.03
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.92
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.91
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 95.9
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 95.84
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 95.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 95.78
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.77
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 95.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.71
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 95.7
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.7
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 95.7
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.69
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 95.68
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 95.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.66
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.66
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.65
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.64
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 95.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 95.61
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 95.44
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.35
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.35
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 95.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.16
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.03
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 94.99
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.99
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 94.93
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.9
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 94.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 94.87
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.84
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 94.73
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 94.71
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 94.71
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 94.64
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 94.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 94.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.5
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.49
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 94.49
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 94.39
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 94.37
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.32
3q49_B137 STIP1 homology and U box-containing protein 1; E3 94.23
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.21
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 94.11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 94.08
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.01
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 93.97
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.9
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 93.9
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 93.68
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 93.61
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 93.54
2gw1_A514 Mitochondrial precursor proteins import receptor; 93.5
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.48
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 93.29
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 93.26
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 93.25
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 93.2
3q15_A378 PSP28, response regulator aspartate phosphatase H; 93.19
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 93.17
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 93.11
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 92.98
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 92.96
3u3w_A293 Transcriptional activator PLCR protein; ternary co 92.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 92.94
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 92.9
4g1t_A 472 Interferon-induced protein with tetratricopeptide 92.82
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 92.69
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 92.68
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 92.65
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 92.62
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 92.48
3mkr_A 291 Coatomer subunit epsilon; tetratricopeptide repeat 92.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 92.1
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 92.07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 92.04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 91.97
1pgy_A47 SWA2P; UBA, ubiquitin, auxilin, ubiquitin-associat 91.88
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 91.82
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 91.7
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 91.66
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.44
3q15_A378 PSP28, response regulator aspartate phosphatase H; 91.37
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 91.31
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 91.25
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 90.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 90.62
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 90.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 89.97
2qx5_A 661 Nucleoporin NIC96; mRNA transport, nuclear pore co 89.93
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 89.26
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 89.22
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 89.05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 88.88
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 88.77
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 88.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 88.27
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 88.02
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 87.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 87.45
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 87.31
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 87.06
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 86.98
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 86.15
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 86.07
2kat_A115 Uncharacterized protein; NESG, structure, structur 85.91
2pm7_A 399 Protein WEB1, protein transport protein SEC31; bet 85.22
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 85.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 84.34
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 84.07
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.38
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 83.03
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 82.64
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 81.82
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 80.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 80.6
2vvy_A169 Protein B15, B14; IKK, IKK beta, BCL-2 family, ear 80.16
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
Probab=99.22  E-value=8.3e-11  Score=90.42  Aligned_cols=82  Identities=10%  Similarity=0.010  Sum_probs=76.4

Q ss_pred             hhHHHHHHHHHHhccHHHHHHHHHHhCCHHHHHHHHhhCCCCCchHHHHHHHHHhCCChHHHHHHHHhcCCHHHHHHHHh
Q psy11102          3 TLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVV   82 (87)
Q Consensus         3 ~~w~~A~~yY~~~~n~~k~ie~~~~~ed~d~L~~l~~~L~~~~~lL~~ia~~F~~~G~~~~Av~aylk~gd~k~ai~~cv   82 (87)
                      ..|+++++++.+.||++.|++||.+.+||++|..|...+ .+.+.+.+++..+...|+++.|+.+|+++||+++|+++|+
T Consensus       682 ~~W~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~-~~~~~~~~~~~~a~~~~~~~~A~~~~~~~g~~~~a~~~~~  760 (814)
T 3mkq_A          682 MKWRALGDASLQRFNFKLAIEAFTNAHDLESLFLLHSSF-NNKEGLVTLAKDAETTGKFNLAFNAYWIAGDIQGAKDLLI  760 (814)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHH
T ss_pred             hHHHHHHHHHHHcCCHHHHHHHHHHccChhhhHHHHHHc-CCHHHHHHHHHHHHHcCchHHHHHHHHHcCCHHHHHHHHH
Confidence            579999999999999999999999999999999998883 3557789999999999999999999999999999999999


Q ss_pred             hcC
Q psy11102         83 QDK   85 (87)
Q Consensus        83 ~~~   85 (87)
                      +++
T Consensus       761 ~~~  763 (814)
T 3mkq_A          761 KSQ  763 (814)
T ss_dssp             HTT
T ss_pred             HcC
Confidence            875



>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1pgy_A SWA2P; UBA, ubiquitin, auxilin, ubiquitin-associated domain, protein binding; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2vvy_A Protein B15, B14; IKK, IKK beta, BCL-2 family, early protein, HOST-virus interaction, viral protein, immunomodulator, NF-KB activation; 2.69A {Vaccinia virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.47
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.33
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.09
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.95
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.94
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.92
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.77
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.74
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 96.57
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.42
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.42
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.31
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.19
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.19
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 96.16
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.09
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.81
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.68
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.43
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.24
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 95.08
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.94
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 94.01
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.38
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.99
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 92.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 91.57
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.16
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 90.16
d1hz4a_366 Transcription factor MalT domain III {Escherichia 90.1
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 89.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 87.24
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 86.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 84.25
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 81.01
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP52 (FKBP4), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.47  E-value=0.00026  Score=44.83  Aligned_cols=70  Identities=23%  Similarity=0.135  Sum_probs=57.9

Q ss_pred             chhHHHHHHHHHHhccH-----------------------HHHHHHHHHhCCHHHHHHHHhhC----CCCCchHHHHHHH
Q psy11102          2 TTLVSQAREYYEKCHCY-----------------------EKLISVYTELGDFEALESCARKL----PDSSPLLKPMGEI   54 (87)
Q Consensus         2 ~~~w~~A~~yY~~~~n~-----------------------~k~ie~~~~~ed~d~L~~l~~~L----~~~~~lL~~ia~~   54 (87)
                      .++|+.|+++|.++=.+                       ..++.||+++|+|+.-....+..    |.+...+..+|..
T Consensus        26 ~~~~~~Ai~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~y~k~~~~~~A~~~~~~al~~~p~~~~a~~~~g~~  105 (170)
T d1p5qa1          26 EGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEA  105 (170)
T ss_dssp             HTCHHHHHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHHhhhccccchHHHhhhchhHHHHHHHHHHHHHhhhhcccccchhhhhhhccccchhhhHHHHHH
Confidence            47899999999877433                       34788999999999887766553    5567889999999


Q ss_pred             HHhCCChHHHHHHHHhc
Q psy11102         55 FVKYGLCEQAVYVFDKN   71 (87)
Q Consensus        55 F~~~G~~~~Av~aylk~   71 (87)
                      +...|.+++|+..|.++
T Consensus       106 ~~~~g~~~~A~~~~~~a  122 (170)
T d1p5qa1         106 HLAVNDFELARADFQKV  122 (170)
T ss_dssp             HHHTTCHHHHHHHHHHH
T ss_pred             HHHhhhHHHHHHHHHHH
Confidence            99999999999999886



>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure