Psyllid ID: psy11102
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| 383864328 | 1183 | PREDICTED: WD repeat-containing protein | 0.724 | 0.053 | 0.476 | 4e-08 | |
| 393906091 | 1130 | WD repeat protein 35 [Loa loa] | 0.712 | 0.054 | 0.467 | 1e-07 | |
| 312087100 | 711 | hypothetical protein LOAG_09759 [Loa loa | 0.712 | 0.087 | 0.467 | 1e-07 | |
| 195403421 | 1190 | GJ16079 [Drosophila virilis] gi|19414062 | 0.724 | 0.052 | 0.444 | 2e-07 | |
| 66515913 | 1185 | PREDICTED: WD repeat-containing protein | 0.724 | 0.053 | 0.460 | 2e-07 | |
| 380012543 | 1185 | PREDICTED: WD repeat-containing protein | 0.724 | 0.053 | 0.460 | 2e-07 | |
| 324511121 | 433 | WD repeat-containing protein 35 [Ascaris | 0.724 | 0.145 | 0.476 | 3e-07 | |
| 340503426 | 1187 | WD repeat protein [Ichthyophthirius mult | 0.735 | 0.053 | 0.468 | 4e-07 | |
| 195428849 | 1224 | GK17561 [Drosophila willistoni] gi|19415 | 0.724 | 0.051 | 0.412 | 4e-07 | |
| 290992023 | 1186 | hypothetical protein NAEGRDRAFT_32701 [N | 0.643 | 0.047 | 0.446 | 7e-07 |
| >gi|383864328|ref|XP_003707631.1| PREDICTED: WD repeat-containing protein 35-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 62.0 bits (149), Expect = 4e-08, Method: Composition-based stats.
Identities = 30/63 (47%), Positives = 37/63 (58%)
Query: 8 AREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYV 67
AREYYEK EKLI Y +L DF L ++LPD SPLLK + + G+C QAV
Sbjct: 816 AREYYEKSRNLEKLIDCYYKLEDFVQLAGTVQQLPDKSPLLKTVARMLASVGMCSQAVAA 875
Query: 68 FDK 70
+ K
Sbjct: 876 YIK 878
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|393906091|gb|EJD74175.1| WD repeat protein 35 [Loa loa] | Back alignment and taxonomy information |
|---|
| >gi|312087100|ref|XP_003145337.1| hypothetical protein LOAG_09759 [Loa loa] | Back alignment and taxonomy information |
|---|
| >gi|195403421|ref|XP_002060288.1| GJ16079 [Drosophila virilis] gi|194140627|gb|EDW57101.1| GJ16079 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|66515913|ref|XP_394812.2| PREDICTED: WD repeat-containing protein 35-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380012543|ref|XP_003690339.1| PREDICTED: WD repeat-containing protein 35-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|324511121|gb|ADY44640.1| WD repeat-containing protein 35 [Ascaris suum] | Back alignment and taxonomy information |
|---|
| >gi|340503426|gb|EGR30016.1| WD repeat protein [Ichthyophthirius multifiliis] | Back alignment and taxonomy information |
|---|
| >gi|195428849|ref|XP_002062478.1| GK17561 [Drosophila willistoni] gi|194158563|gb|EDW73464.1| GK17561 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|290992023|ref|XP_002678634.1| hypothetical protein NAEGRDRAFT_32701 [Naegleria gruberi] gi|284092247|gb|EFC45890.1| hypothetical protein NAEGRDRAFT_32701 [Naegleria gruberi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| FB|FBgn0035264 | 1205 | Oseg4 "Oseg4" [Drosophila mela | 0.666 | 0.048 | 0.431 | 1.4e-07 | |
| RGD|1564116 | 1170 | Wdr35 "WD repeat domain 35" [R | 0.793 | 0.058 | 0.414 | 3.7e-07 | |
| MGI|MGI:1921932 | 1181 | Wdr35 "WD repeat domain 35" [M | 0.793 | 0.058 | 0.414 | 3.7e-07 | |
| UNIPROTKB|F1SCU2 | 1186 | WDR35 "Uncharacterized protein | 0.793 | 0.058 | 0.4 | 7.8e-07 | |
| UNIPROTKB|E1BWD7 | 1180 | WDR35 "Uncharacterized protein | 0.793 | 0.058 | 0.385 | 2.1e-06 | |
| ZFIN|ZDB-GENE-060810-148 | 1203 | wdr35 "WD repeat domain 35" [D | 0.793 | 0.057 | 0.4 | 2.1e-06 | |
| UNIPROTKB|Q9P2L0 | 1181 | WDR35 "WD repeat-containing pr | 0.724 | 0.053 | 0.412 | 4.3e-06 |
| FB|FBgn0035264 Oseg4 "Oseg4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 134 (52.2 bits), Expect = 1.4e-07, P = 1.4e-07
Identities = 25/58 (43%), Positives = 33/58 (56%)
Query: 8 AREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAV 65
AREYYEK H E + L F+ LE C +LP+ SPLL + E+ G+C +AV
Sbjct: 832 AREYYEKSHYLEGYMEALYHLEQFDDLEKCVERLPEKSPLLPKLAEMLASVGMCSEAV 889
|
|
| RGD|1564116 Wdr35 "WD repeat domain 35" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921932 Wdr35 "WD repeat domain 35" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCU2 WDR35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWD7 WDR35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060810-148 wdr35 "WD repeat domain 35" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P2L0 WDR35 "WD repeat-containing protein 35" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| KOG2041|consensus | 1189 | 99.94 | ||
| KOG3617|consensus | 1416 | 98.95 | ||
| KOG1538|consensus | 1081 | 98.32 | ||
| KOG1920|consensus | 1265 | 97.93 | ||
| KOG1538|consensus | 1081 | 97.44 | ||
| KOG3616|consensus | 1636 | 97.41 | ||
| KOG3616|consensus | 1636 | 97.4 | ||
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 97.28 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.25 | |
| KOG3617|consensus | 1416 | 96.91 | ||
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 96.89 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.62 | |
| KOG0276|consensus | 794 | 96.52 | ||
| KOG2041|consensus | 1189 | 96.5 | ||
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 96.41 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.2 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.08 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 96.04 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 95.94 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 95.82 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 95.64 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 95.36 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.34 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 95.31 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 95.22 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.2 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 95.19 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.16 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 95.12 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 95.0 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.97 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 94.83 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 94.82 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 94.78 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 94.76 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 94.68 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 94.56 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 94.35 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 94.34 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 93.82 | |
| KOG0553|consensus | 304 | 93.79 | ||
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 93.37 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 93.21 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 92.95 | |
| KOG1920|consensus | 1265 | 92.71 | ||
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 92.71 | |
| KOG2280|consensus | 829 | 92.47 | ||
| KOG0548|consensus | 539 | 92.2 | ||
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 92.14 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 91.85 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 91.7 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 91.7 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 91.68 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 91.67 | |
| KOG2003|consensus | 840 | 91.62 | ||
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 91.61 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 91.59 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 91.44 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 91.39 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 91.31 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 90.93 | |
| KOG2076|consensus | 895 | 90.92 | ||
| KOG4626|consensus | 966 | 90.71 | ||
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 90.67 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 90.55 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 90.34 | |
| KOG3060|consensus | 289 | 90.28 | ||
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 90.26 | |
| KOG1586|consensus | 288 | 90.19 | ||
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 89.95 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 89.88 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 89.86 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 89.84 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 89.66 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 88.8 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 88.67 | |
| KOG1585|consensus | 308 | 88.66 | ||
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 88.36 | |
| KOG1586|consensus | 288 | 88.23 | ||
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 87.84 | |
| PF09145 | 46 | Ubiq-assoc: Ubiquitin-associated; InterPro: IPR015 | 87.77 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 87.47 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 87.38 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 87.06 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 87.03 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 85.51 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 85.5 | |
| PF04097 | 613 | Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 | 85.47 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 85.19 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 85.18 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 84.84 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 84.69 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 84.52 | |
| KOG1155|consensus | 559 | 84.3 | ||
| PF12931 | 284 | Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_ | 83.77 | |
| KOG0547|consensus | 606 | 83.57 | ||
| KOG1125|consensus | 579 | 83.15 | ||
| KOG0543|consensus | 397 | 82.6 | ||
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 82.39 | |
| PF12854 | 34 | PPR_1: PPR repeat | 82.28 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 81.72 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 80.82 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 80.62 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 80.35 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 80.21 |
| >KOG2041|consensus | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.3e-27 Score=193.97 Aligned_cols=83 Identities=31% Similarity=0.447 Sum_probs=82.0
Q ss_pred hhHHHHHHHHHHhccHHHHHHHHHHhCCHHHHHHHHhhCCCCCchHHHHHHHHHhCCChHHHHHHHHhcCCHHHHHHHHh
Q psy11102 3 TLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVV 82 (87)
Q Consensus 3 ~~w~~A~~yY~~~~n~~k~ie~~~~~ed~d~L~~l~~~L~~~~~lL~~ia~~F~~~G~~~~Av~aylk~gd~k~ai~~cv 82 (87)
+.|++|++||+++||.+..|||||++++|++||.+++.||++|++|+.+|+||+++|||+|||+||+|++++|+|+.+||
T Consensus 810 ~~We~A~~yY~~~~~~e~~~ecly~le~f~~LE~la~~Lpe~s~llp~~a~mf~svGMC~qAV~a~Lr~s~pkaAv~tCv 889 (1189)
T KOG2041|consen 810 MEWEEAAKYYSYCGDTENQIECLYRLELFGELEVLARTLPEDSELLPVMADMFTSVGMCDQAVEAYLRRSLPKAAVHTCV 889 (1189)
T ss_pred HHHHHHHHHHHhccchHhHHHHHHHHHhhhhHHHHHHhcCcccchHHHHHHHHHhhchHHHHHHHHHhccCcHHHHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcC
Q psy11102 83 QDK 85 (87)
Q Consensus 83 ~~~ 85 (87)
++|
T Consensus 890 ~Ln 892 (1189)
T KOG2041|consen 890 ELN 892 (1189)
T ss_pred HHH
Confidence 987
|
|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG1920|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG3616|consensus | Back alignment and domain information |
|---|
| >KOG3616|consensus | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG2041|consensus | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG0553|consensus | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG1920|consensus | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG2280|consensus | Back alignment and domain information |
|---|
| >KOG0548|consensus | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG2003|consensus | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG2076|consensus | Back alignment and domain information |
|---|
| >KOG4626|consensus | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG3060|consensus | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1586|consensus | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG1585|consensus | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1586|consensus | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF09145 Ubiq-assoc: Ubiquitin-associated; InterPro: IPR015228 Ubiquitin-associated domains contain approximately 40 residues and bind ubiquitin noncovalently | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1155|consensus | Back alignment and domain information |
|---|
| >PF12931 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_C | Back alignment and domain information |
|---|
| >KOG0547|consensus | Back alignment and domain information |
|---|
| >KOG1125|consensus | Back alignment and domain information |
|---|
| >KOG0543|consensus | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.22 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.48 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.47 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.71 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.51 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.47 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.44 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.36 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.35 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.26 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.22 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.2 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.18 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.08 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.07 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.06 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.02 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.0 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.0 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.98 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.98 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.95 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.95 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.93 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.89 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 96.88 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.87 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.76 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.75 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.73 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.72 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.68 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 96.63 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 96.59 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.56 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.53 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 96.51 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 96.49 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.48 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 96.48 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.47 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.44 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.42 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 96.41 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 96.39 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 96.36 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 96.35 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.35 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.33 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.33 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 96.33 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.32 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 96.31 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.3 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.22 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.22 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 96.19 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.14 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.13 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 96.1 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.04 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 96.03 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.92 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 95.91 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 95.9 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 95.84 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 95.78 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 95.78 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 95.77 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 95.76 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.71 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 95.7 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.7 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.7 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.69 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 95.68 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.67 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 95.66 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.66 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 95.65 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 95.64 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 95.64 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.61 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 95.44 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 95.44 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.35 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 95.35 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 95.34 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 95.16 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 95.07 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 95.07 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.03 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 94.99 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 94.99 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 94.93 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 94.9 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.88 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 94.87 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 94.84 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 94.73 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 94.71 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 94.71 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 94.64 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 94.61 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 94.56 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 94.5 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 94.49 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 94.49 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 94.39 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 94.37 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 94.32 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 94.23 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 94.21 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 94.19 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 94.17 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 94.11 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 94.08 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 94.01 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 93.97 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 93.9 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 93.9 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.83 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 93.68 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 93.61 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 93.54 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 93.5 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 93.48 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 93.29 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 93.26 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.25 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 93.2 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 93.19 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 93.17 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 93.11 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 92.98 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 92.96 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 92.95 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 92.94 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 92.9 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 92.82 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 92.69 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 92.68 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 92.65 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 92.62 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 92.48 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 92.29 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 92.1 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.07 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 92.04 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 91.97 | |
| 1pgy_A | 47 | SWA2P; UBA, ubiquitin, auxilin, ubiquitin-associat | 91.88 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 91.82 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 91.7 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 91.66 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 91.44 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 91.37 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 91.31 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 91.25 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 90.97 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 90.62 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 90.33 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 89.97 | |
| 2qx5_A | 661 | Nucleoporin NIC96; mRNA transport, nuclear pore co | 89.93 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 89.26 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 89.22 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 89.05 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 88.88 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 88.77 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 88.68 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 88.27 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 88.02 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 87.62 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 87.45 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 87.31 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 87.06 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 86.98 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 86.15 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 86.07 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 85.91 | |
| 2pm7_A | 399 | Protein WEB1, protein transport protein SEC31; bet | 85.22 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 85.06 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 84.34 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 84.07 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 83.38 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 83.03 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 82.64 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 81.82 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 80.87 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 80.6 | |
| 2vvy_A | 169 | Protein B15, B14; IKK, IKK beta, BCL-2 family, ear | 80.16 |
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
Probab=99.22 E-value=8.3e-11 Score=90.42 Aligned_cols=82 Identities=10% Similarity=0.010 Sum_probs=76.4
Q ss_pred hhHHHHHHHHHHhccHHHHHHHHHHhCCHHHHHHHHhhCCCCCchHHHHHHHHHhCCChHHHHHHHHhcCCHHHHHHHHh
Q psy11102 3 TLVSQAREYYEKCHCYEKLISVYTELGDFEALESCARKLPDSSPLLKPMGEIFVKYGLCEQAVYVFDKNKHKSSQWLTVV 82 (87)
Q Consensus 3 ~~w~~A~~yY~~~~n~~k~ie~~~~~ed~d~L~~l~~~L~~~~~lL~~ia~~F~~~G~~~~Av~aylk~gd~k~ai~~cv 82 (87)
..|+++++++.+.||++.|++||.+.+||++|..|...+ .+.+.+.+++..+...|+++.|+.+|+++||+++|+++|+
T Consensus 682 ~~W~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~-~~~~~~~~~~~~a~~~~~~~~A~~~~~~~g~~~~a~~~~~ 760 (814)
T 3mkq_A 682 MKWRALGDASLQRFNFKLAIEAFTNAHDLESLFLLHSSF-NNKEGLVTLAKDAETTGKFNLAFNAYWIAGDIQGAKDLLI 760 (814)
T ss_dssp HHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHH
T ss_pred hHHHHHHHHHHHcCCHHHHHHHHHHccChhhhHHHHHHc-CCHHHHHHHHHHHHHcCchHHHHHHHHHcCCHHHHHHHHH
Confidence 579999999999999999999999999999999998883 3557789999999999999999999999999999999999
Q ss_pred hcC
Q psy11102 83 QDK 85 (87)
Q Consensus 83 ~~~ 85 (87)
+++
T Consensus 761 ~~~ 763 (814)
T 3mkq_A 761 KSQ 763 (814)
T ss_dssp HTT
T ss_pred HcC
Confidence 875
|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1pgy_A SWA2P; UBA, ubiquitin, auxilin, ubiquitin-associated domain, protein binding; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2vvy_A Protein B15, B14; IKK, IKK beta, BCL-2 family, early protein, HOST-virus interaction, viral protein, immunomodulator, NF-KB activation; 2.69A {Vaccinia virus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.47 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.13 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.09 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.95 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.94 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.92 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 96.77 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.74 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.57 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 96.49 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.42 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.42 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.31 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.19 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.19 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.16 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.09 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.81 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.68 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.43 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.34 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.24 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.08 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.94 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.01 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 93.38 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 92.99 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 92.38 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 91.57 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 91.16 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 90.16 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 90.1 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 89.5 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 87.24 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 86.64 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 84.25 | |
| d1wy6a1 | 161 | Hypothetical protein ST1625 {Archaeon Sulfolobus t | 81.01 |
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: FKBP52 (FKBP4), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.47 E-value=0.00026 Score=44.83 Aligned_cols=70 Identities=23% Similarity=0.135 Sum_probs=57.9
Q ss_pred chhHHHHHHHHHHhccH-----------------------HHHHHHHHHhCCHHHHHHHHhhC----CCCCchHHHHHHH
Q psy11102 2 TTLVSQAREYYEKCHCY-----------------------EKLISVYTELGDFEALESCARKL----PDSSPLLKPMGEI 54 (87)
Q Consensus 2 ~~~w~~A~~yY~~~~n~-----------------------~k~ie~~~~~ed~d~L~~l~~~L----~~~~~lL~~ia~~ 54 (87)
.++|+.|+++|.++=.+ ..++.||+++|+|+.-....+.. |.+...+..+|..
T Consensus 26 ~~~~~~Ai~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~y~k~~~~~~A~~~~~~al~~~p~~~~a~~~~g~~ 105 (170)
T d1p5qa1 26 EGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEA 105 (170)
T ss_dssp HTCHHHHHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred cCCHHHHHHHHHHHHHHhhhccccchHHHhhhchhHHHHHHHHHHHHHhhhhcccccchhhhhhhccccchhhhHHHHHH
Confidence 47899999999877433 34788999999999887766553 5567889999999
Q ss_pred HHhCCChHHHHHHHHhc
Q psy11102 55 FVKYGLCEQAVYVFDKN 71 (87)
Q Consensus 55 F~~~G~~~~Av~aylk~ 71 (87)
+...|.+++|+..|.++
T Consensus 106 ~~~~g~~~~A~~~~~~a 122 (170)
T d1p5qa1 106 HLAVNDFELARADFQKV 122 (170)
T ss_dssp HHHTTCHHHHHHHHHHH
T ss_pred HHHhhhHHHHHHHHHHH
Confidence 99999999999999886
|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|