Psyllid ID: psy11166

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------
MSLADELLADMEDEEEDNEGGEEMAADGMETEPDDVKPDVHKIIEQDIKGVRCRLAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQLTLRRQKSRPEKLGPNTSPTPLDLYGLISEEETCVYPQGRDLFMTSNTPNTIRQDKTLNKLKIKFLKPCEEKPNANSPFSSNQMDPNALNITIILAEFSRSIEHSVTLMIRLLRQEILPAPDSPPRSSTPSNMFHSKHRSDSSLTPKRKYKSKPDLKVKCGACGLVGHMRTNKACPQYSLTGQMPMNVAMTEEQEEEYGKVIDCDEEALVNVEGTKVTLSGKLIKHAEEVKRKSLLLKVPKEALHAKKKRKANNPDNQLDYLKRHQKPANRRRTDPVVVLTSILEKILNEMRDMSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVTEKAEKLLEEAKLALEKYDDHLTQLEKTISQVRARAMEQADVDSFSTWTQDDDQFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEFSSEEERDDTISSNQAWTKKILNIRMLRFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEFSSEEERDDNDMEEVVDDDSQQAAEAMVQLGNITYYTDPNTEETSMDVDPNYDPSEFLLNRTEQPMVNKPSSGVMGNDGFILNPQQAMSSHDSEIKTEDDDLAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCSETHGSRNHREESTVSQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCGSSRSIEPNTRQSRNVWHGSGNLKTLTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGVREFSGPSSGSGSAHPMGMRSGNVLNRVGHQQDKWKRQVLEQRRNIYDKHTMLN
cccHHHHHHcccHHHHcccccEEEccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccHHHHHHHHHHHHcccccccccHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcHHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHcHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccEEcccccccEEEccccccccccccccccccccccEEEEcccccccccccccccccccccEEEEEEccccccEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccc
ccHHHHHHHccccccccccccHHHHccHHccccccccccHcccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccEEEEEccHHHHHHcccccccccccccccccccccEEcccccccEEcccccccHccccHHHHcEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccccccccccccccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHEcccccEEEccHHHHHcHHHHHHHcEEccccHHHccHHcccccccccccHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHccccccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccHccccccHHHHHHcccccccccccHHHHHccccccccccHHHHHHccccccccccccccccccccccccccccccccHHHcccccccHccccccEEEEccccccccccccccccccccccccHEEEEHHHHcccHHHEEEEEccccccccccEEEEEcccccHEEEcHHHHHHHHHHHHHHHHccccccccccccccEEEcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEccccEEEccccccEEEEEEcccHHHHHHHHccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccHccHHEHEHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHccHHHEEEEHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccccccHHHHHHcccccHHHHHHHHHHHHHHHHcccccccEEEEEEccHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccEEEEcHHHHHHHHHHHHccHccccccHHEEEHEcccHHHHHHHHHccccccEEEEEEcccccEEEEcccccEEEccccccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHccccc
MSLADELLAdmedeeedneggeemaadgmetepddvkpdVHKIIEQDIKGVRCRLAAKCALAARVDaahdsvdgaigrSFREDIEKKLdkltepppvkfvkplpkpieagrkkrggkrVRKMKERYAMTELRKQQNRlsfadieddayqedlgysrgtigktgagrirtpqvdektKVRISKTLQKNLQrqqvwggsttvkkqvsgttssiaftplqltlrrqksrpeklgpntsptpldlygliseeetcvypqgrdlfmtsntpntirqdkTLNKLKIKflkpceekpnanspfssnqmdpnaLNITIILAEFSRSIEHSVTLMIRLLRQeilpapdspprsstpsnmfhskhrsdssltpkrkykskpdlkvkcgacglvghmrtnkacpqysltgqmpmnvamteeqeeeygkvidcdeealvnVEGTKVTLSGKLIKHAEEVKRKSLLLKVPKEALHAKkkrkannpdnqLDYLKrhqkpanrrrtdPVVVLTSILEKILNEMRDmsqtepnvkqfsfpvnaklvpdyykivtrpMDLQTIRENLRSKKYQSREEFLADVNQIvenstlyngaKSILTDAARRMLTLCVELLGKKEELLMRLEKAInpllddndqvALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGkkaqshkyhsRYEFLADIELILSNsvlyngpgsqvTEKAEKLLEEAKLALEKYDDHLTQLEKTISQVRARAMEQadvdsfstwtqdddqfqsgldkedfeytdaegnikkendggllekdlefsseeerddtissNQAWTKKILNIRMLRfqsgldkedfeytdaegnikkendggllekdlefsseeerddndmeevvDDDSQQAAEAMVQLGNityytdpnteetsmdvdpnydpsefllnrteqpmvnkpssgvmgndgfilnpqqamsshdseiktedddlavshpcfwlcsfpdgcshnlgpishcwkdslwtprVIFWSLCMSIDsylclgiytapfseshsgwvqlanidlpvfrfNMSLADELLADMRLLQCcsethgsrnhreestvsqkpmdletigkkaqshkyhsRYEFLADIELILSNsvlyngpgsqVLINIWWHFIEIKssfktnnvqILSGGFhslcgssrsiepntrqsrnvwhgsgnlktlTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEKYQKsnqsqapivgpvesdpeyQLIVEANNLAVEIDTEIGLIHRFAVEKynkrfpeldtlvvsplEYLRTVRELGndldqtknNETLQQVLTQATIMVVSVTAsttqgqllsEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAgglsrlskmpgvagglsrlskmpacNILLQGAQKKLlsgfsqtsvlphtgFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDaahdsvdgaigrSFREDIEKKLdkltepppvkfvkplpkpieagrkkrggkrVRKMKERYAMTELRKQQNRlsfadieddayqedlgysrgtigktgagrirtpqvdektKVRISKTLQKNLQrqqvwggsttvkkqvsgttssiaftplqgleivnpqaaekssgetgakyfsntagfvrVNQTRLSSWAQVLEFESSVAPHLVVVVLtpwdetvivgpgigvrefsgpssgsgsahpmgmrsgnvlnrvghqqdKWKRQVLEQRRNIydkhtmln
msladellADMEDEEEDNEGGEEMAADgmetepddvkpDVHKIIEQDIKGVRCRLAAKCALAARvdaahdsvdgaigrsFREDIEKkldkltepppvkfvkplpkpieagrkkrggkrvrkmkeryamtelrkqqnrlsfaDIEDDayqedlgysrgtigktgagrirtpqvdektkvRISKTlqknlqrqqvwggsttvkkqvsgttssiaftplqltlrrqksrpeklgpntsptpLDLYGLISEEETCVYPQGRDlfmtsntpntirqdktlNKLKIKFLKPCEEKPnanspfssnqmdPNALNITIILAEFSRSIEHSVTLMIRLLRQEILpapdspprsstpsnmfhskhrsdssltpkrkykskpdlkVKCGACGLVGHMRTNKACPQYSLTGQMPMNVAMTEEQEEEYGKVIDCDEEALVNVEgtkvtlsgklikhaeevkrkslllkvpkealhakkkrkannpdnqldylkrhqkpanrrrtdpvvVLTSILEKILNEMRDMSQTepnvkqfsfpvnaklVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVnqivenstlynGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVTEKAEKLLEEAKLALEKYDDHLTQLEKTISQVRARAMEQAdvdsfstwtqddDQFQSGLDKEDFEYTDAegnikkendggllEKDLefsseeerddtissnqawtkKILNIRMLRFQSGLDKEDFEYTDAegnikkendggllekDLEFSseeerddndmeevVDDDSQQAAEAMVQLGNITYYTDPNTEETSMDVDPNYDPSEFLLNRTEQPMVNKPSSGVMGNDGFILNPQQAMSSHDSEIKTEDDDLAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCSEthgsrnhreestvsqkpmdlETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCGSSRSiepntrqsrnvwhgsgnlKTLTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELgndldqtkNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAArvdaahdsvdgaigrsFREDIEKkldkltepppvkfvkplpkpieagrkkrggkrvrkmkeryamtelrkqqnrlsfaDIEDDayqedlgysrgtigktgagrirtpqvdektkvRISKTlqknlqrqqvwggsttvkkqvsgttssiaftplqglEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGVREFSGPSSGSGSAHPMGMRSGNVLNRVghqqdkwkrqvleqrrniydkhtmln
MSladelladmedeeedneggeemaadgmeTEPDDVKPDVHKIIEQDIKGvrcrlaakcalaarvdaaHDSVDGAIGRSFREDIEKKLDKLTEpppvkfvkplpkpIEAgrkkrggkrvrkmkerYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQLTLRRQKSRPEKLGPNTSPTPLDLYGLISEEETCVYPQGRDLFMTSNTPNTIRQDKTLNKLKIKFLKPCEEKPNANSPFSSNQMDPNALNITIILAEFSRSIEHSVTLMIRLLRQEILPAPDSPPRSSTPSNMFHSKHRSDSSLTPKRKYKSKPDLKVKCGACGLVGHMRTNKACPQYSLTGQMPMNVAMTEEQEEEYGKVIDCDEEALVNVEGTKVTLSGKLIKHAEEVKRKSLLLKVPKEALHAKKKRKANNPDNQLDYLKRHQKPANRRRTDPVVVLTSILEKILNEMRDMSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVTekaeklleeaklalekYDDHLTQLEKTISQVRARAMEQADVDSFSTWTQDDDQFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEFSSEEERDDTISSNQAWTKKILNIRMLRFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEFSSeeerddndmeevvdddSQQAAEAMVQLGNITYYTDPNTEETSMDVDPNYDPSEFLLNRTEQPMVNKPSSGVMGNDGFILNPQQAMSSHDSEIKTEDDDLAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCSETHGSRNHREESTVSQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCGSSRSIEPNTRQSRNVWHGSGNLKTLTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQllseeelseVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMrrkaarlvaakcalaarvdaaHDSVDGAIGRSFREDIEKKLDKLTEpppvkfvkplpkpIEAgrkkrggkrvrkmkerYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGVREFsgpssgsgsAHPMGMRSGNVLNRVGHQQDKWKRQVLEQRRNIYDKHTMLN
***************************************VHKIIEQDIKGVRCRLAAKCALAARVDAAHDSVDGAIG***************************************************************************GY**************************************VW******************F*************************LDLYGLISEEETCVYPQGRDLFMTS**********TLNKLKIKFL*********************ALNITIILAEFSRSIEHSVTLMIRLLRQEI**************************************LKVKCGACGLVGHMRTNKACPQYSLTG***************YGKVIDCDEEALVNVEGTKVTLSGKLIKHAEEV****LL***************************************PVVVLTSILEKILNE**********VKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGP***************KLALEKYDDHLT*******************************************************************************AWTKKILNIRMLRFQSGLD******************************************************VQLGNITYY*****************************************************************LAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCS*******************************KYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCG*************NVWHGSGNLKTLTSTLFYFVFQAKSIHQIAKLR*********************************EYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAI****************************************************************************GY**************************************VWG**************SIAFTPLQGLEIV*************AKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGV*****************************************************
*********************EEMAADGMETEPDDVKPDVHKIIEQDIKGVRCRLAAKCALAARVDAAHD*****IGRSFREDIEKKLDKLTEPPP**************************KERYAMTELRKQQNRLSFADIEDDAYQEDLGY********************************************************IAFTPLQLT************************************GRDLFMTSNTP********************************************I**************************************************************KVKCGACGLVGHMRTNKACPQY**************************DEEALVNVEGTKVTLSGKLI*********************************************************SILEKILNEMRDMSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLC*****************************LSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVTEKAEKLLEEAK********************************************************************************************************************************GLL************************************************************************************************************VSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSE**S**VQLANIDLPVFRFNMSLADELLADMRLLQCCSETHGSRNHREESTVSQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSF*****************************************************************EQLQNVMTSIEKYQKSNQSQAP****VESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVV***********LSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGA****************TGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEK****************************************************************************************************************************IAFTPLQGL***********************A*************************HLVVVVLTPWDETVIVGPGIG********************SGNVLNRVGHQQDKWKRQVLEQRRNIY***TML*
MSLADELLAD************************DVKPDVHKIIEQDIKGVRCRLAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAG************KERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQLTLRRQKSRPEKLGPNTSPTPLDLYGLISEEETCVYPQGRDLFMTSNTPNTIRQDKTLNKLKIKFLKPCEEKPNANSPFSSNQMDPNALNITIILAEFSRSIEHSVTLMIRLLRQEILPAP*******************************KPDLKVKCGACGLVGHMRTNKACPQYSLTGQMPMNVAMTEEQEEEYGKVIDCDEEALVNVEGTKVTLSGKLIKHAEEVKRKSLLLKVPKEALHAKKKRKANNPDNQLDYLKRHQKPANRRRTDPVVVLTSILEKILNEMRDMSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETI********YHSRYEFLADIELILSNSVLYNGPGSQVTEKAEKLLEEAKLALEKYDDHLTQLEKTISQVRARAMEQADVDSFSTWTQDDDQFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLE************SNQAWTKKILNIRMLRFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEF*******************QQAAEAMVQLGNITYYTDPNTEETSMDVDPNYDPSEFLLNRTEQPMVNKPSSGVMGNDGFILNPQQ*************DDLAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCSET***************PMDLETI********YHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCGSSRSIEPNTRQSRNVWHGSGNLKTLTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEK**********IVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAG************KERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQ*********GAKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGVREFS**********PMGMRSGNVLNRVGHQQDKWKRQVLEQRRNIYDKHTMLN
*********D**********GEEMAADGMETEPDDVKPDVHKIIEQDIKGVRCRLAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIE*******GKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQ**************TTSSIAFTPLQLTLRRQKSR**********T*LD*YGLISEEETCVYPQGRDLFMTSNTPNTIRQDKTLNKLKIKFLKPCEEKPN**SP**SNQMDPNALNITIILAEFSRSIEHSVTLMIRLLRQEILPAP*****************************KSKPDLKVKCGACGLVGHMRTNKACPQYSLTGQMPMNVAMTEEQEEEYGKVIDCDEEALVNVEGTKVTLSGKLIKHAEEVKRKSLLLKVPKEALH**********DNQL************RRTDPVVVLTSILEKILNEMRDMSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVTEKAEKLLEEAKLALEKYDDHLTQLEKTISQVRARAME*******************************************************************************************************************************************LGNITYYTDPNTEETSMDVDPNYDPSEFLLNRT**************************************DLAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCSET*********STVSQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCGSSRSIEPNTRQSRNVWHGSGNLKTLTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAG***R*GKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQ***************TSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGVREF***********************VGHQQDKWKRQVLEQRRNIYDKH****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLxxxxxxxxxxxxxxxxxxxxxAADGMETEPDDVKPDVHKIIEQDIKGVRCRLAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQLTLRRQKSRPEKLGPNTSPTPLDLYGLISEEETCVYPQGRDLFMTSNTPNTIRQDKTLNKLKIKFLKPCEEKPNANSPFSSNQMDPNALNITIILAEFSRSIEHSVTLMIRLLRQEILPAPDSPPRSSTPSNMFHSKHRSDSSLTPKRKYKSKPDLKVKCGACGLVGHMRTNKACPQYSLTGQMPMNVAMTEEQEEEYGKVIDCDEEALVNVEGTKVTLSGKLIKHAEEVKRKSLLLKVPKEALHAKKKRKANNPDNQLDYLKRHQKPANRRRTDPVVVLTSILEKILNEMRDMSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVENSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDIVNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAMEQADVDSFSTWTQDDDQFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEFSSEEERDDTISSNQAWTKKILNIRMLRFQSGLDKEDFEYTDAEGNIKKENDGGLLEKDLEFSSEEERDDNDMEEVVDDDSQQAAEAMVQLGNITYYTDPNTEETSMDVDPNYDPSEFLLNRTEQPMVNKPSSGVMGNDGFILNPQQAMSSHDSEIKTEDDDLAVSHPCFWLCSFPDGCSHNLGPISHCWKDSLWTPRVIFWSLCMSIDSYLCLGIYTAPFSESHSGWVQLANIDLPVFRFNMSLADELLADMRLLQCCSETHGSRNHREESTVSQKPMDLETIGKKAQSHKYHSRYEFLADIELILSNSVLYNGPGSQVLINIWWHFIEIKSSFKTNNVQILSGGFHSLCGSSRSIEPNTRQSRNVWHGSGNLKTLTSTLFYFVFQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQTRLSSWAQVLEFESSVAPHLVVVVLTPWDETVIVGPGIGVREFSGPSSGSGSAHPMGMRSGNVLNRVGHQQDKWKRQVLEQRRNIYDKHTMLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1746 2.2.26 [Sep-21-2011]
Q6NVP6498 U4/U6 small nuclear ribon yes N/A 0.261 0.915 0.581 1e-157
Q7SXM7508 U4/U6 small nuclear ribon yes N/A 0.256 0.879 0.584 1e-156
Q5U5C5498 U4/U6 small nuclear ribon N/A N/A 0.261 0.915 0.577 1e-156
Q8CCF0499 U4/U6 small nuclear ribon yes N/A 0.253 0.885 0.596 1e-156
Q8WWY3499 U4/U6 small nuclear ribon yes N/A 0.253 0.885 0.598 1e-152
P511232129 Transcription initiation no N/A 0.238 0.195 0.513 1e-116
Q80UV91891 Transcription initiation no N/A 0.207 0.191 0.574 1e-108
P216751872 Transcription initiation no N/A 0.207 0.193 0.574 1e-108
Q605441865 Transcription initiation N/A N/A 0.207 0.194 0.571 1e-107
Q8IZX41826 Transcription initiation no N/A 0.207 0.198 0.555 1e-103
>sp|Q6NVP6|PRP31_XENTR U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus tropicalis GN=prpf31 PE=2 SV=1 Back     alignment and function desciption
 Score =  556 bits (1434), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 363/485 (74%), Gaps = 29/485 (5%)

Query: 1178 FQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVE 1237
              A+S+  IAKL +S+    ++  I+ Y K     + ++GPVE+ PEY++IV+ANNL VE
Sbjct: 42   LNAESVKSIAKLSDSKLFSEILLKIDGYIKKQPKASEVMGPVEAAPEYKVIVDANNLTVE 101

Query: 1238 IDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQA 1297
            I+ E+ +IH+F  +KY+KRFPEL++LV + L+Y+RTV+ELGN+LD+ KNNE LQQ+LT A
Sbjct: 102  IENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNNLDKCKNNENLQQILTNA 161

Query: 1298 TIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAI 1357
            TIMVVSVTASTTQGQ L++EEL  + +ACDMA ELNQ K  I+EYVESRM++IAPNLS I
Sbjct: 162  TIMVVSVTASTTQGQQLTDEELERIEEACDMALELNQSKHRIYEYVESRMSFIAPNLSII 221

Query: 1358 VGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLP 1417
            VGASTAAK+MG+AG             GL+ LSKMPACN++L GAQ+K LSGFS TSVLP
Sbjct: 222  VGASTAAKIMGIAG-------------GLTNLSKMPACNVMLLGAQRKTLSGFSSTSVLP 268

Query: 1418 HTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDG 1477
            HTG++Y+S +VQ  P D               + RKAARLV+AKC LAARVD+ H+S +G
Sbjct: 269  HTGYIYHSDIVQSLPPD---------------LHRKAARLVSAKCTLAARVDSFHESSEG 313

Query: 1478 AIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQ 1537
             +G   +E+IE+K DK  EPPPVK VKPLP P++  RKKRGG+R RKMKER  +TE+RKQ
Sbjct: 314  KVGYDLKEEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQ 373

Query: 1538 QNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQ-V 1596
             NR+SFA+IE+DAYQEDLG+S G +GK+G+GRIR  QV+E TK RISKTLQ+ LQ+Q  V
Sbjct: 374  ANRMSFAEIEEDAYQEDLGFSLGHLGKSGSGRIRQAQVNEATKARISKTLQRTLQKQSVV 433

Query: 1597 WGGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQTRL 1656
            +GG +T++ + SGT SS+AFTPLQGLEIVNPQAAEK   E   KYFS+ A F++V   + 
Sbjct: 434  YGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKSEKS 493

Query: 1657 SSWAQ 1661
             +  Q
Sbjct: 494  GTMTQ 498
Involved in pre-mRNA splicing. Required for U4/U6.U5 tri-snRNP formation.
Xenopus tropicalis (taxid: 8364)
>sp|Q7SXM7|PRP31_DANRE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Danio rerio GN=prpf31 PE=2 SV=1 Back     alignment and function description
>sp|Q5U5C5|PRP31_XENLA U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus laevis GN=prpf31 PE=2 SV=1 Back     alignment and function description
>sp|Q8CCF0|PRP31_MOUSE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Mus musculus GN=Prpf31 PE=2 SV=3 Back     alignment and function description
>sp|Q8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens GN=PRPF31 PE=1 SV=2 Back     alignment and function description
>sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 Back     alignment and function description
>sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=2 SV=2 Back     alignment and function description
>sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 Back     alignment and function description
>sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1746
383858826489 PREDICTED: U4/U6 small nuclear ribonucle 0.257 0.918 0.716 0.0
340729136489 PREDICTED: u4/U6 small nuclear ribonucle 0.257 0.918 0.716 0.0
48095215488 PREDICTED: u4/U6 small nuclear ribonucle 0.257 0.920 0.714 0.0
307211201489 U4/U6 small nuclear ribonucleoprotein Pr 0.257 0.918 0.708 0.0
332017446489 U4/U6 small nuclear ribonucleoprotein Pr 0.257 0.918 0.702 0.0
307178250489 U4/U6 small nuclear ribonucleoprotein Pr 0.257 0.918 0.708 0.0
91093746496 PREDICTED: similar to AGAP012142-PA [Tri 0.256 0.901 0.671 0.0
193599008495 PREDICTED: u4/U6 small nuclear ribonucle 0.256 0.903 0.684 0.0
156541324491 PREDICTED: U4/U6 small nuclear ribonucle 0.254 0.906 0.701 0.0
21357435501 Prp31 [Drosophila melanogaster] gi|72943 0.254 0.888 0.665 0.0
>gi|383858826|ref|XP_003704900.1| PREDICTED: U4/U6 small nuclear ribonucleoprotein Prp31-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/477 (71%), Positives = 388/477 (81%), Gaps = 28/477 (5%)

Query: 1178 FQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVE 1237
             +  S+ ++AKLR+SEQL+ VM+ IEKY K  +  A I+GPVESDPEYQLIVEANN+AV+
Sbjct: 41   IKVASVRELAKLRDSEQLRKVMSQIEKYSKVPRKSADIIGPVESDPEYQLIVEANNMAVD 100

Query: 1238 IDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQA 1297
            ID EI  IHRF  +KY+KRFPEL++LVV PLEY+ TVRELGNDLD+ KNNETLQQ LTQA
Sbjct: 101  IDDEIATIHRFTRDKYSKRFPELESLVVGPLEYVMTVRELGNDLDRAKNNETLQQFLTQA 160

Query: 1298 TIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAI 1357
            TIMVVSVTASTTQGQLL+EEE   + +ACDMA ELN  K  IFEYVESRM +IAPNLS I
Sbjct: 161  TIMVVSVTASTTQGQLLTEEEKEAICEACDMAVELNNCKLKIFEYVESRMAFIAPNLSII 220

Query: 1358 VGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLP 1417
            VGASTAAK+MGVAGGL++             LSKMPACN+L+ G+QK  LSGFSQ + LP
Sbjct: 221  VGASTAAKIMGVAGGLTK-------------LSKMPACNVLVLGSQKTTLSGFSQVATLP 267

Query: 1418 HTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDG 1477
            HTGF+YYS +VQD P D+R               RKAARLVAAK  LAARVDA H+S DG
Sbjct: 268  HTGFIYYSDIVQDTPPDLR---------------RKAARLVAAKSMLAARVDACHESTDG 312

Query: 1478 AIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQ 1537
             IG+ FRE+IEKKLDKL EPPPVKFVKPLPKPI+ GRKKRGGKRVRKMKERYA+TE RK 
Sbjct: 313  HIGQLFREEIEKKLDKLQEPPPVKFVKPLPKPIDPGRKKRGGKRVRKMKERYAITEFRKH 372

Query: 1538 QNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDEKTKVRISKTLQKNLQRQQVW 1597
             NR++FADIE+DAYQEDLGYSRGTIGK GAGRIR PQ+DEKTKVRISKTLQKNLQ+QQ W
Sbjct: 373  ANRMNFADIENDAYQEDLGYSRGTIGKAGAGRIRLPQIDEKTKVRISKTLQKNLQKQQQW 432

Query: 1598 GGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQT 1654
            GGSTTVKKQVSGT SS+AFTPLQGLEIVNPQAAEK   E  AKYFSNTAGF++V ++
Sbjct: 433  GGSTTVKKQVSGTASSVAFTPLQGLEIVNPQAAEKKVNEANAKYFSNTAGFLKVKKS 489

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340729136|ref|XP_003402864.1| PREDICTED: u4/U6 small nuclear ribonucleoprotein Prp31-like [Bombus terrestris] gi|350401578|ref|XP_003486196.1| PREDICTED: U4/U6 small nuclear ribonucleoprotein Prp31-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|48095215|ref|XP_394383.1| PREDICTED: u4/U6 small nuclear ribonucleoprotein Prp31-like isoform 1 [Apis mellifera] gi|380013847|ref|XP_003690957.1| PREDICTED: U4/U6 small nuclear ribonucleoprotein Prp31-like [Apis florea] Back     alignment and taxonomy information
>gi|307211201|gb|EFN87401.1| U4/U6 small nuclear ribonucleoprotein Prp31 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332017446|gb|EGI58169.1| U4/U6 small nuclear ribonucleoprotein Prp31 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307178250|gb|EFN67035.1| U4/U6 small nuclear ribonucleoprotein Prp31 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91093746|ref|XP_969081.1| PREDICTED: similar to AGAP012142-PA [Tribolium castaneum] gi|270012980|gb|EFA09428.1| hypothetical protein TcasGA2_TC010639 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193599008|ref|XP_001951872.1| PREDICTED: u4/U6 small nuclear ribonucleoprotein Prp31-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|156541324|ref|XP_001600101.1| PREDICTED: U4/U6 small nuclear ribonucleoprotein Prp31-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|21357435|ref|NP_648756.1| Prp31 [Drosophila melanogaster] gi|7294306|gb|AAF49655.1| Prp31 [Drosophila melanogaster] gi|15292167|gb|AAK93352.1| LD41209p [Drosophila melanogaster] gi|220946280|gb|ACL85683.1| CG6876-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1746
UNIPROTKB|E7EVX8493 PRPF31 "U4/U6 small nuclear ri 0.142 0.505 0.591 8.2e-118
FB|FBgn00103552129 Taf1 "TBP-associated factor 1" 0.254 0.208 0.487 7.5e-113
UNIPROTKB|F1P5U81851 TAF1 "Uncharacterized protein" 0.229 0.216 0.536 4.6e-105
UNIPROTKB|F1P5U71816 TAF1 "Uncharacterized protein" 0.229 0.220 0.536 1.5e-104
UNIPROTKB|J9NZ211926 TAF1 "Uncharacterized protein" 0.272 0.247 0.480 9.9e-104
MGI|MGI:13368781891 Taf1 "TAF1 RNA polymerase II, 0.229 0.211 0.544 1.2e-103
UNIPROTKB|P216751872 TAF1 "Transcription initiation 0.229 0.213 0.544 1.8e-103
UNIPROTKB|B1Q2X31895 N-TAF1 "TAF1 RNA polymerase II 0.229 0.211 0.544 2.1e-103
RGD|15620501902 Taf1 "TAF1 RNA polymerase II, 0.229 0.210 0.544 2.2e-103
UNIPROTKB|F1MF621882 TAF1 "Uncharacterized protein" 0.229 0.212 0.541 5.2e-102
UNIPROTKB|E7EVX8 PRPF31 "U4/U6 small nuclear ribonucleoprotein Prp31" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 769 (275.8 bits), Expect = 8.2e-118, Sum P(3) = 8.2e-118
 Identities = 155/262 (59%), Positives = 196/262 (74%)

Query:  1182 SIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTE 1241
             S+  IAKL +S+    +M  IE+Y       + ++GPVE+ PEY++IV+ANNL VEI+ E
Sbjct:    47 SVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENE 106

Query:  1242 IGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMV 1301
             + +IH+F  +KY+KRFPEL++LV + L+Y+RTV+ELGN LD+ KNNE LQQ+LT ATIMV
Sbjct:   107 LNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMV 166

Query:  1302 VSVTASTTQGQXXXXXXXXXVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGAS 1361
             VSVTASTTQGQ         + +ACDMA ELN  K  I+EYVESRM++IAPNLS I+GAS
Sbjct:   167 VSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGAS 226

Query:  1362 TAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGF 1421
             TAAK+MGVAGGL+ LSKMP             ACNI+L GAQ+K LSGFS TSVLPHTG+
Sbjct:   227 TAAKIMGVAGGLTNLSKMP-------------ACNIMLLGAQRKTLSGFSSTSVLPHTGY 273

Query:  1422 VYYSSLVQDYPADMRRKAARLV 1443
             +Y+S +VQ  P D+RRKAARLV
Sbjct:   274 IYHSDIVQSLPPDLRRKAARLV 295
GO:0000244 "assembly of spliceosomal tri-snRNP" evidence=IEA
GO:0046540 "U4/U6 x U5 tri-snRNP complex" evidence=IEA
FB|FBgn0010355 Taf1 "TBP-associated factor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5U8 TAF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5U7 TAF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ21 TAF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1336878 Taf1 "TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P21675 TAF1 "Transcription initiation factor TFIID subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1Q2X3 N-TAF1 "TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, neuron specific isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1562050 Taf1 "TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF62 TAF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7SXM7PRP31_DANRENo assigned EC number0.58400.25600.8799yesN/A
Q8CCF0PRP31_MOUSENo assigned EC number0.59660.25310.8857yesN/A
Q8WWY3PRP31_HUMANNo assigned EC number0.59870.25310.8857yesN/A
Q6NVP6PRP31_XENTRNo assigned EC number0.58140.26110.9156yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1746
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 5e-58
pfam09785124 pfam09785, Prp31_C, Prp31 C terminal domain 5e-50
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 4e-49
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 1e-45
pfam09785124 pfam09785, Prp31_C, Prp31 C terminal domain 5e-45
pfam01798149 pfam01798, Nop, Putative snoRNA binding domain 2e-39
smart00297107 smart00297, BROMO, bromo domain 2e-27
cd0436999 cd04369, Bromodomain, Bromodomain 6e-26
cd0436999 cd04369, Bromodomain, Bromodomain 7e-26
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 9e-26
smart00297107 smart00297, BROMO, bromo domain 2e-25
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 2e-25
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 1e-23
pfam0043984 pfam00439, Bromodomain, Bromodomain 3e-21
pfam0043984 pfam00439, Bromodomain, Bromodomain 4e-21
COG5076371 COG5076, COG5076, Transcription factor involved in 5e-20
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 6e-19
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 3e-17
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 2e-16
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 2e-16
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 3e-16
pfam0806052 pfam08060, NOSIC, NOSIC (NUC001) domain 3e-16
smart0093152 smart00931, NOSIC, NOSIC (NUC001) domain 5e-16
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 7e-16
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 1e-15
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 3e-15
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 3e-15
COG5076371 COG5076, COG5076, Transcription factor involved in 5e-15
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 1e-14
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-14
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 1e-14
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 1e-14
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 3e-14
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 3e-14
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 6e-14
pfam05434149 pfam05434, Tmemb_9, TMEM9 7e-14
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 1e-13
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 2e-13
smart00297107 smart00297, BROMO, bromo domain 3e-13
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 6e-13
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 8e-13
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 9e-13
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 1e-12
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-12
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 2e-12
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 3e-12
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 4e-12
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 5e-12
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 7e-12
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 7e-12
cd0436999 cd04369, Bromodomain, Bromodomain 9e-12
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-11
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 3e-11
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 6e-11
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 1e-10
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 2e-10
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 2e-10
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-10
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 3e-10
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 1e-09
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 2e-09
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 3e-09
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 4e-09
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 5e-09
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 9e-09
pfam01798149 pfam01798, Nop, Putative snoRNA binding domain 1e-08
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-08
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-08
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-08
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 2e-08
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 3e-08
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 3e-08
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 3e-08
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 4e-08
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 6e-08
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 6e-08
COG5076371 COG5076, COG5076, Transcription factor involved in 7e-08
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 7e-08
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 7e-08
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 2e-07
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 3e-07
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 4e-07
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 5e-07
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 2e-06
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 3e-06
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 4e-06
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 5e-06
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 6e-06
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 7e-06
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 1e-05
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 1e-05
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 1e-05
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 3e-05
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 3e-05
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 3e-05
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 3e-05
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 4e-05
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 4e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 7e-05
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 7e-05
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 9e-05
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 9e-05
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-04
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 1e-04
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 4e-04
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 4e-04
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 0.001
COG5179968 COG5179, TAF1, Transcription initiation factor TFI 0.001
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 0.003
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 0.004
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  206 bits (525), Expect = 5e-58
 Identities = 109/320 (34%), Positives = 161/320 (50%), Gaps = 34/320 (10%)

Query: 1220 ESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGN 1279
            E D E +LI++A     +ID EI L+     E Y   FPEL +LV    +Y + V  LGN
Sbjct: 110  EVDKEDKLIIQAIEALDDIDKEINLLAMRLREWYGWHFPELSSLVPDNEQYAKLVSALGN 169

Query: 1280 DLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSI 1339
              +  K +            + ++  A  + G  LSEE++  + +  ++  EL + +  +
Sbjct: 170  RENINKESLKDLGFALPDIAIKIAEAAKDSMGADLSEEDIDNIRELAEIILELYELREQL 229

Query: 1340 FEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILL 1399
             EY+ES+M+ IAPNL+A+VG    A+++  AGGL+R             L+KMPA  I +
Sbjct: 230  EEYIESKMSEIAPNLTALVGPVLGARLISHAGGLTR-------------LAKMPASTIQV 276

Query: 1400 QGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVA 1459
             GA+K L       +  P  G +Y S L+Q        K+       P   R K AR +A
Sbjct: 277  LGAEKALFRALKTGAKTPKYGVIYQSPLIQ--------KS-------PPWQRGKIARALA 321

Query: 1460 AKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEPPPVKFVKPLPKPIEAGRKKRGG 1519
            AK A+AAR+DA     D   G S RE++EK+++KL E PP     P     E  +K+R G
Sbjct: 322  AKLAIAARIDAFSGEPD---GISLREELEKRIEKLKEKPP---KPPTKAKPERDKKERPG 375

Query: 1520 KRVRKMKERYAMTELRKQQN 1539
            +  RK KE+ A +E R  QN
Sbjct: 376  RYRRKKKEKKAKSERRGLQN 395

Length = 395
>gnl|CDD|220400 pfam09785, Prp31_C, Prp31 C terminal domain Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|220400 pfam09785, Prp31_C, Prp31 C terminal domain Back     alignment and domain information
>gnl|CDD|216709 pfam01798, Nop, Putative snoRNA binding domain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|203845 pfam08060, NOSIC, NOSIC (NUC001) domain Back     alignment and domain information
>gnl|CDD|197999 smart00931, NOSIC, NOSIC (NUC001) domain Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|147559 pfam05434, Tmemb_9, TMEM9 Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|216709 pfam01798, Nop, Putative snoRNA binding domain Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|227506 COG5179, TAF1, Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1746
KOG2574|consensus492 100.0
COG1498395 SIK1 Protein implicated in ribosomal biogenesis, N 100.0
PRK14552414 C/D box methylation guide ribonucleoprotein comple 100.0
KOG2573|consensus498 100.0
KOG2574|consensus492 100.0
KOG2572|consensus498 100.0
KOG0008|consensus1563 100.0
PF01798150 Nop: Putative snoRNA binding domain; InterPro: IPR 100.0
PF09785124 Prp31_C: Prp31 C terminal domain; InterPro: IPR019 100.0
PF09785124 Prp31_C: Prp31 C terminal domain; InterPro: IPR019 100.0
KOG1474|consensus640 99.93
PF05434149 Tmemb_9: TMEM9; InterPro: IPR008853 This family co 99.87
COG5076371 Transcription factor involved in chromatin remodel 99.87
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.87
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.87
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.86
KOG4007|consensus229 99.86
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.86
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.85
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.85
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.85
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.85
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.85
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.84
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.84
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.84
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.84
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.84
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.84
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.83
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.83
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.83
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.83
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.83
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.83
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.82
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.82
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.82
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.82
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.82
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.82
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.82
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.81
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.81
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.81
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.81
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.81
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.81
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.8
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.8
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.8
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.8
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.8
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.8
KOG1472|consensus720 99.8
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.8
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.79
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.79
KOG1474|consensus640 99.79
smart00297107 BROMO bromo domain. 99.79
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.78
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.78
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.78
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.77
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.77
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.77
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.77
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.76
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.76
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.76
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.76
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.76
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.76
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.75
smart00297107 BROMO bromo domain. 99.75
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.75
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.74
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.74
PF0806053 NOSIC: NOSIC (NUC001) domain; InterPro: IPR012976 99.74
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.72
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.72
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.71
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.7
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.69
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.69
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.65
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.65
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.64
KOG0008|consensus1563 99.58
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.52
COG5076371 Transcription factor involved in chromatin remodel 99.52
KOG1245|consensus1404 99.48
KOG1245|consensus1404 99.42
KOG1828|consensus418 99.41
KOG1827|consensus629 99.26
KOG1472|consensus720 99.2
KOG1827|consensus629 99.1
PRK14552414 C/D box methylation guide ribonucleoprotein comple 98.92
COG1498395 SIK1 Protein implicated in ribosomal biogenesis, N 98.86
PF1528840 zf-CCHC_6: Zinc knuckle 98.84
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.83
KOG0386|consensus1157 98.8
PF01798150 Nop: Putative snoRNA binding domain; InterPro: IPR 98.79
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.71
KOG0955|consensus1051 98.58
KOG0955|consensus1051 98.51
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.48
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.47
KOG0386|consensus1157 98.4
COG5179968 TAF1 Transcription initiation factor TFIID, subuni 98.27
KOG1828|consensus418 97.43
KOG1832|consensus1516 95.75
KOG2573|consensus498 93.79
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 93.58
KOG2572|consensus498 93.38
KOG1832|consensus1516 92.71
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 92.41
KOG0732|consensus1080 91.05
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 89.93
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 89.49
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 88.79
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 87.58
KOG2038|consensus988 82.54
KOG0644|consensus1113 81.41
>KOG2574|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.4e-137  Score=1170.33  Aligned_cols=444  Identities=57%  Similarity=0.921  Sum_probs=435.3

Q ss_pred             cccccHHHHHhccCchhHHHHHHHHHHHHhccCCCCCccCCCCCCcchhHHHHHHHhHHHHHHHHHHHHHHHHHHhhccC
Q psy11166       1178 FQAKSIHQIAKLRNSEQLQNVMTSIEKYQKSNQSQAPIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRF 1257 (1746)
Q Consensus      1178 ~~~~~v~~iakL~~s~~~~~vm~~I~~~~~~~~~~~~~~g~~e~~pEy~lIVqan~L~~eID~EI~~ih~~lRe~Ys~rF 1257 (1746)
                      ..++||+.|+||++|.+|.++|+++++|++.+.....+.|++|++|||+|||.||+++++||+||+++|+||||||+.||
T Consensus        47 l~~dsv~~v~kL~~S~r~~~im~q~E~~l~k~~d~~~i~~~~E~dpeykLIVd~n~iavdI~nEI~ivH~FikdkY~~RF  126 (492)
T KOG2574|consen   47 LTYDSVESVSKLAKSSRYRDIMQQTEEYLGKQVDAKEILGPVEADPEYKLIVDCNQIAVDIENEIVIVHNFIKDKYSKRF  126 (492)
T ss_pred             hhhhhHHHHHHHHhccHHHHHHHHHHHHhcccchHHHhcCccccCcceeeeechhhhhhhhhhhHHHHHHHHHHHHHhhh
Confidence            44899999999999999999999999999998877889999999999999999999999999999999999999999999


Q ss_pred             ccchhccCChHHHHHHHHHHhCCcccCCCchHHHhhcchhhhhhhheeccccCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q psy11166       1258 PELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKT 1337 (1746)
Q Consensus      1258 PELesLV~~p~~Y~r~V~~igN~ld~~k~~e~L~~iL~~~timvVsv~AstS~G~~Lseedl~~I~~ac~~i~~L~~~r~ 1337 (1746)
                      |||++||++|++|++||+.|||++|..++++.++.+||++|||||+|||+||+|..|+++++.+|++||+++++|+.+|.
T Consensus       127 pELeSLVp~~ldY~~~Vk~LgNelD~~~~~l~~~~~L~~atIMVvsvTasTT~G~~Lp~d~~~~v~eAc~~a~~L~~~k~  206 (492)
T KOG2574|consen  127 PELESLVPNPLDYAKVVKELGNELDLKKVDLELQAILPSATIMVVSVTASTTQGNKLPEDELEQVLEACEMAEQLNKLKE  206 (492)
T ss_pred             hhhHhhccCHHHHHHHHHHHhhhHHHHHhhhhhhccCccceEEEEEEEeeeccCCCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999988999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhcccCCchhHHhchHHHHHHHHHhCCCccccCCCCcCCccccccCCCchhhhhhcccccccccccccCCCC
Q psy11166       1338 SIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLP 1417 (1746)
Q Consensus      1338 ~i~~YVesRM~~IAPNLsALVG~~vAArLI~~AGGL~~~~~~~~~~~~~~~LAkmPAcNIq~LGAeK~l~~glst~~~~p 1417 (1746)
                      .|.+||+|||++||||||+|||+.+||+||++||||             ++||+|||||||+||++|+++.||++.+..|
T Consensus       207 ki~eyVeSrms~IAPNLs~ivGs~taA~Lig~AGGl-------------s~Lsk~PaCNv~vlGk~kk~l~gfst~~~~~  273 (492)
T KOG2574|consen  207 KIYEYVESRMSFIAPNLSAIVGSTTAAKLIGIAGGL-------------SELSKMPACNVQVLGKQKKTLIGFSTTSSLP  273 (492)
T ss_pred             HHHHHHHHHhhhccchhHhhhcHHHHHHHHHhhcCc-------------hhhccCCcchhhhhhccchhccccccccccC
Confidence            999999999999999999999999999999999999             9999999999999999999999999999999


Q ss_pred             ceEEEecccccccCchhhHHHhhhhhcCCchhhHhHHHHHhhhhHHhhhhhcccCCCCCCcccHHHHHHHHHHHHHhcCC
Q psy11166       1418 HTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTEP 1497 (1746)
Q Consensus      1418 k~G~Iy~s~lVq~~P~~~~~~~~~~~~~~~~~~r~KaaR~lAaK~aLAARvD~~~~~~dg~~G~~lreeIe~kl~Kl~Ep 1497 (1746)
                      |+||||+|++||++||               ++|+||+|||||||+||||||++|++++|.+|.+||++|++||+||+||
T Consensus       274 ~~Gyly~s~ivQk~Pp---------------dl~~ka~Rl~aAKvtLAARVDa~he~~~g~~g~~~k~evekK~eKl~Ep  338 (492)
T KOG2574|consen  274 HTGYLYASDIVQKTPP---------------DLRKKAARLVAAKVTLAARVDAGHESPNGELGHEFKAEVEKKIEKLQEP  338 (492)
T ss_pred             ccceeeHHhHhhhcCc---------------cHHHHHHHHHHHHHHHHHHhhccccCCccHHHHHHHHHHHHHHHhhcCC
Confidence            9999999999999999               9999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCcCcCCCCCchhhhhhHHHhhhcHHHHHhhhccccccchhhhccccccccccCCCCCCcccccccccc
Q psy11166       1498 PPVKFVKPLPKPIEAGRKKRGGKRVRKMKERYAMTELRKQQNRLSFADIEDDAYQEDLGYSRGTIGKTGAGRIRTPQVDE 1577 (1746)
Q Consensus      1498 P~~k~~K~LP~P~d~~kkkRGGrR~RK~Ke~~~~telrk~~NRm~FG~~Eed~~~e~~G~~~Gmlg~~g~Grir~~~v~~ 1577 (1746)
                      ||++.+||||+|+|+|||||||||+|||||||+||||||+||||+||++|+|+|++++|+|+||+|++|+||||..+||+
T Consensus       339 Ppvk~~KaLP~P~d~pkKkRgGRR~RKmKEr~~lTe~RklaNRM~FG~~Ee~v~~~~~g~glGmlgksg~Grir~~~vd~  418 (492)
T KOG2574|consen  339 PPVKQTKALPIPLDGPKKKRGGRRFRKMKERYALTELRKLANRMAFGKIEEDVLQEDLGEGLGMLGKSGSGRIRGSSVDE  418 (492)
T ss_pred             CCCCcCCCCCCCCccchhhccchHHHHHHHHhhhHHHHHHHhhhccCChhhhhhccccccccccccccCCCceeeccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhccHHHHHHHhhhhccCCcccccccccccccccccCCCceeEEeCCchhhcccCccCCccccCCCCceeeccc
Q psy11166       1578 KTKVRISKTLQKNLQRQQVWGGSTTVKKQVSGTTSSIAFTPLQGLEIVNPQAAEKSSGETGAKYFSNTAGFVRVNQT 1654 (1746)
Q Consensus      1578 ktk~~~sk~~~~~l~~~~~~g~~~~~~~~~sGtaSSlaFTP~qGlElvnP~~~~~~~~~~~~kyFs~~~~F~~v~~~ 1654 (1746)
                      +||+||||+|+++|++|+++||.+     ++||+||++|||+||||||||++++....+++++|||++|+|++|++.
T Consensus       419 ~tkarisk~~~~~lq~~q~agg~t-----tsG~~ss~aftP~qglEivnp~~~~~~~~e~~~~yFS~~g~F~~i~~~  490 (492)
T KOG2574|consen  419 KTKARISKKMKKQLQEQQQAGGFT-----TSGTASSVAFTPIQGLEIVNPQAAEQQQPEENSKYFSSSGSFSKIKKD  490 (492)
T ss_pred             chhhhhhHHHHHHHHHHHhhCCcc-----ccccccccccCcccchhhcCHHHHhhcCcccccceecCCCceeecccc
Confidence            999999999999999999999965     579999999999999999999999988888999999999999999875

>COG1498 SIK1 Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14552 C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>KOG2573|consensus Back     alignment and domain information
>KOG2574|consensus Back     alignment and domain information
>KOG2572|consensus Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>PF01798 Nop: Putative snoRNA binding domain; InterPro: IPR002687 This domain is present in various pre-mRNA processing ribonucleoproteins Back     alignment and domain information
>PF09785 Prp31_C: Prp31 C terminal domain; InterPro: IPR019175 This is the C-terminal domain of the pre-mRNA processing factor Prp31 Back     alignment and domain information
>PF09785 Prp31_C: Prp31 C terminal domain; InterPro: IPR019175 This is the C-terminal domain of the pre-mRNA processing factor Prp31 Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>PF05434 Tmemb_9: TMEM9; InterPro: IPR008853 This family contains several eukaryotic transmembrane proteins which are homologous to Homo sapiens transmembrane protein 9 Q9P0T7 from SWISSPROT Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>KOG4007|consensus Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>PF08060 NOSIC: NOSIC (NUC001) domain; InterPro: IPR012976 This is the central domain in Nop56/SIK1-like proteins [] Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>PRK14552 C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>COG1498 SIK1 Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PF01798 Nop: Putative snoRNA binding domain; InterPro: IPR002687 This domain is present in various pre-mRNA processing ribonucleoproteins Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG5179 TAF1 Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2573|consensus Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>KOG2572|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>KOG2038|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1746
2ozb_B260 Structure Of A Human Prp31-15.5k-U4 Snrna Complex L 7e-84
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 3e-82
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 1e-08
3siu_B254 Structure Of A Hprp31-15.5k-U4atac 5' Stem Loop Com 1e-81
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 3e-77
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 1e-08
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-74
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-08
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 7e-29
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 2e-08
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 2e-26
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 7e-08
2nnw_A376 Alternative Conformations Of Nop56/58-fibrillarin C 1e-13
3nmu_A379 Crystal Structure Of Substrate-Bound Halfmer Box CD 1e-13
3nvk_A376 Structural Basis For Substrate Placement By An Arch 1e-13
3nvm_A371 Structural Basis For Substrate Placement By An Arch 9e-12
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 2e-10
3icx_A255 Crystal Structure Of Sulfolobus Solfataricus Nop5 ( 5e-10
3id5_A388 Crystal Structure Of Sulfolobus Solfataricus CD RNP 8e-10
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 3e-09
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 3e-06
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-09
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 5e-07
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 7e-09
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 7e-09
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 2e-08
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 3e-08
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 3e-08
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 3e-05
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 3e-08
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-07
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 4e-08
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 6e-07
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 4e-08
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 4e-08
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 5e-08
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 9e-08
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 1e-07
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 6e-07
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 1e-07
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 1e-07
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 2e-07
2e7n_A117 Solution Structure Of The Second Bromodomain From H 2e-07
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 2e-07
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 3e-07
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-06
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 4e-07
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 4e-07
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 4e-07
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 6e-07
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 5e-07
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 1e-04
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 5e-07
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 6e-07
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 6e-07
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 7e-07
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 8e-07
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 8e-07
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 9e-07
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 1e-06
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-06
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-06
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-05
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 2e-06
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 2e-06
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 3e-06
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 4e-06
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 4e-06
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 4e-06
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 4e-06
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 5e-06
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 1e-04
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 5e-06
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 6e-06
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 6e-06
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 2e-05
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 6e-06
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 3e-05
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 8e-06
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 2e-05
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 1e-05
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 2e-05
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 1e-05
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 2e-04
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 2e-05
3gqu_A169 Pyrococcus Horikoshii Nop5 Rna Binding Domain Lengt 2e-05
1nt2_B258 Crystal Structure Of FibrillarinNOP5P COMPLEX Lengt 2e-05
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 4e-05
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 4e-05
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 4e-05
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 7e-05
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 8e-05
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 8e-05
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 2e-04
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 8e-05
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 2e-04
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 2e-04
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 3e-04
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 4e-04
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 5e-04
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 5e-04
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 6e-04
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 6e-04
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 8e-04
>pdb|2OZB|B Chain B, Structure Of A Human Prp31-15.5k-U4 Snrna Complex Length = 260 Back     alignment and structure 
Iteration: 1

 Score =  309 bits (792), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 197/282 (69%), Gaps = 28/282 (9%)
Query: 1215 IVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTV 1274
            ++GPVE+ PEY++IV+ANNL VEI+ E+ +IH+F  +KY+KRFPEL++LV + L+Y+RTV
Sbjct: 7    VMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTV 66
Query: 1275 RELGNDLDQTKNNETLQQVLTQATIMVVSVTASTTQGQXXXXXXXXXVYQACDMAFELNQ 1334
            +ELGN LD+ KNNE LQQ+LT ATIMVVSVTASTTQGQ         + +ACDMA ELN 
Sbjct: 67   KELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNA 126
Query: 1335 FKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPA 1394
             K  I+EYVESRM++IAPNLS I+GASTAAK+MGVAG             GL+ LSKMPA
Sbjct: 127  SKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAG-------------GLTNLSKMPA 173
Query: 1395 CNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMXXXX 1454
            CNI+L GAQ+K LSGFS TSVLPHTG++Y+S +VQ  P D+RRKAARLV           
Sbjct: 174  CNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLV----------- 222
Query: 1455 XXXXXXXXXXXXXXXXXHDSVDGAIGRSFREDIEKKLDKLTE 1496
                             H+S +G +G   +++IE+K DK  E
Sbjct: 223  ----AAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQE 260
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3SIU|B Chain B, Structure Of A Hprp31-15.5k-U4atac 5' Stem Loop Complex, Monomeric Form Length = 254 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|2NNW|A Chain A, Alternative Conformations Of Nop56/58-fibrillarin Complex And Implication For Induced-fit Assenly Of Box C/d Rnps Length = 376 Back     alignment and structure
>pdb|3NMU|A Chain A, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 379 Back     alignment and structure
>pdb|3NVK|A Chain A, Structural Basis For Substrate Placement By An Archaeal Box CD Ribonucleoprotein Particle Length = 376 Back     alignment and structure
>pdb|3NVM|A Chain A, Structural Basis For Substrate Placement By An Archaeal Box CD Ribonucleoprotein Particle Length = 371 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3ICX|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Nop5 (135-380) Length = 255 Back     alignment and structure
>pdb|3ID5|A Chain A, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 388 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3GQU|A Chain A, Pyrococcus Horikoshii Nop5 Rna Binding Domain Length = 169 Back     alignment and structure
>pdb|1NT2|B Chain B, Crystal Structure Of FibrillarinNOP5P COMPLEX Length = 258 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1746
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-84
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-12
3aad_A292 Transcription initiation factor TFIID subunit 1; p 6e-09
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 4e-78
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-12
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 4e-09
2ozb_B260 U4/U6 small nuclear ribonucleoprotein PRP31; RNA-p 6e-78
2ozb_B260 U4/U6 small nuclear ribonucleoprotein PRP31; RNA-p 9e-08
3icx_A255 PRE mRNA splicing protein; C/D guide RNA, 2'-O-met 3e-66
3icx_A255 PRE mRNA splicing protein; C/D guide RNA, 2'-O-met 1e-07
2nnw_A376 NOP5/NOP56 related protein; box C/D; 2.70A {Pyroco 4e-64
2nnw_A376 NOP5/NOP56 related protein; box C/D; 2.70A {Pyroco 2e-06
3pla_A388 NOP5, PRE mRNA splicing protein; RNA-binding, SAM, 6e-63
3pla_A388 NOP5, PRE mRNA splicing protein; RNA-binding, SAM, 2e-08
2r0y_A311 Chromatin structure-remodeling complex protein RSC 9e-55
2r0y_A311 Chromatin structure-remodeling complex protein RSC 4e-21
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-20
2r0y_A311 Chromatin structure-remodeling complex protein RSC 7e-12
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-07
2r10_A361 Chromatin structure-remodeling complex protein RSC 2e-54
2r10_A361 Chromatin structure-remodeling complex protein RSC 5e-20
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-11
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-06
3gqu_A169 NOP5P protein; RNA binding domain, RNA binding pro 2e-49
3gqu_A169 NOP5P protein; RNA binding domain, RNA binding pro 2e-12
3uv4_A158 Second bromodomain of human transcription initiat 3e-44
3uv4_A158 Second bromodomain of human transcription initiat 2e-32
3uv4_A158 Second bromodomain of human transcription initiat 5e-13
1nt2_B258 Conserved hypothetical protein; adeMet, binding mo 6e-44
1nt2_B258 Conserved hypothetical protein; adeMet, binding mo 4e-04
3nxb_A116 CAT eye syndrome critical region protein 2; struct 2e-34
3nxb_A116 CAT eye syndrome critical region protein 2; struct 1e-27
3nxb_A116 CAT eye syndrome critical region protein 2; struct 2e-13
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 3e-34
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-29
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 9e-12
3rcw_A135 Bromodomain-containing protein 1; transcription, s 1e-33
3rcw_A135 Bromodomain-containing protein 1; transcription, s 6e-28
3rcw_A135 Bromodomain-containing protein 1; transcription, s 2e-11
2d9e_A121 Peregrin; four-helix bundle, transcription activat 8e-32
2d9e_A121 Peregrin; four-helix bundle, transcription activat 4e-31
2d9e_A121 Peregrin; four-helix bundle, transcription activat 3e-12
3id6_A268 NOP5, PRE mRNA splicing protein; C/D guide RNA, 2' 4e-31
3d7c_A112 General control of amino acid synthesis protein 5; 2e-30
3d7c_A112 General control of amino acid synthesis protein 5; 3e-29
3d7c_A112 General control of amino acid synthesis protein 5; 3e-13
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 6e-29
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 1e-28
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 8e-12
3dai_A130 ATPase family AAA domain-containing protein 2; anc 9e-29
3dai_A130 ATPase family AAA domain-containing protein 2; anc 6e-26
3dai_A130 ATPase family AAA domain-containing protein 2; anc 8e-12
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-28
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 6e-28
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 3e-12
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 2e-26
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 5e-22
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 5e-11
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 3e-26
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 1e-25
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 3e-12
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 5e-26
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-25
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-11
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 1e-25
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 2e-21
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 6e-12
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-25
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-22
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-11
2dat_A123 Possible global transcription activator SNF2L2; br 7e-25
2dat_A123 Possible global transcription activator SNF2L2; br 3e-21
2dat_A123 Possible global transcription activator SNF2L2; br 4e-11
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-25
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-22
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-11
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 9e-25
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 1e-21
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 1e-11
2grc_A129 Probable global transcription activator SNF2L4; br 1e-24
2grc_A129 Probable global transcription activator SNF2L4; br 2e-22
2grc_A129 Probable global transcription activator SNF2L4; br 6e-11
4alg_A154 Bromodomain-containing protein 2; signaling protei 2e-24
4alg_A154 Bromodomain-containing protein 2; signaling protei 2e-23
4alg_A154 Bromodomain-containing protein 2; signaling protei 4e-11
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 3e-24
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 1e-20
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 1e-11
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 4e-24
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 1e-20
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 2e-11
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-24
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-22
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-11
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-23
3fkm_X166 Signaling protein; bromodomain, malaria, structura 4e-23
3fkm_X166 Signaling protein; bromodomain, malaria, structura 6e-11
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 1e-23
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 6e-23
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 2e-11
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-23
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-21
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-11
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 2e-23
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 8e-21
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 2e-08
3p1f_A119 CREB-binding protein; structural genomics consorti 3e-23
3p1f_A119 CREB-binding protein; structural genomics consorti 2e-21
3p1f_A119 CREB-binding protein; structural genomics consorti 2e-11
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 7e-23
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 3e-22
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 2e-09
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 9e-22
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 4e-21
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 8e-10
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-20
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-18
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 4e-15
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 1e-11
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 2e-06
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-14
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-13
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-10
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 4e-11
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 4e-11
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-10
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 4e-06
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
 Score =  277 bits (710), Expect = 2e-84
 Identities = 162/295 (54%), Positives = 201/295 (68%), Gaps = 5/295 (1%)

Query: 451 SLLLKVPKEALHAKKKRKANNPDNQLDYLKRHQKPANRRRTDPVVVLTSILEKILNEMRD 510
            ++LK PK+ L  KKKR+        DYL R  K  +RRRTDP+V L+SILE I+N+MRD
Sbjct: 3   HMVLKFPKQQLPPKKKRRVGTT-VHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRD 61

Query: 511 MSQTEPNVKQFSFPVNAKLVPDYYKIVTRPMDLQTIRENLRSKKYQSREEFLADVNQIVE 570
           +  T P    F  PVNAK+V DYYKI+TRPMDLQT+REN+R + Y SREEF   +  IV+
Sbjct: 62  LPNTYP----FHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVK 117

Query: 571 NSTLYNGAKSILTDAARRMLTLCVELLGKKEELLMRLEKAINPLLDDNDQVALSFIFDDI 630
           NS  YNG K  LT  ++ ML LC E L +KE+ L RLEKAINPLLDD+DQVA SFI D+I
Sbjct: 118 NSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNI 177

Query: 631 VNNKLKNMADAWIFIKPVNKKFFKDYYSVVQKPMDLETIGKKAQSHKYHSRYEFLADIEL 690
           V  K+  + D+W F  PVNKKF  DYY V+  PMDLETI K    HKY SR  FL D+ L
Sbjct: 178 VTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNL 237

Query: 691 ILSNSVLYNGPGSQVTEKAEKLLEEAKLALEKYDDHLTQLEKTISQVRARAMEQA 745
           IL+NSV YNGP SQ T+ A++++      L +YD+HLTQLEK I   +  A+E+A
Sbjct: 238 ILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEA 292
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>2ozb_B U4/U6 small nuclear ribonucleoprotein PRP31; RNA-protein complex, ribonucleoprotein particle (RNP), PRE-M splicing, U4/U6 DI-snRNA, U4/U6 DI-snRNP; 2.60A {Homo sapiens} SCOP: a.183.1.1 PDB: 3siu_B 3siv_B Length = 260 Back     alignment and structure
>2ozb_B U4/U6 small nuclear ribonucleoprotein PRP31; RNA-protein complex, ribonucleoprotein particle (RNP), PRE-M splicing, U4/U6 DI-snRNA, U4/U6 DI-snRNP; 2.60A {Homo sapiens} SCOP: a.183.1.1 PDB: 3siu_B 3siv_B Length = 260 Back     alignment and structure
>3icx_A PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, RNA binding PR; 3.10A {Sulfolobus solfataricus} Length = 255 Back     alignment and structure
>3icx_A PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, RNA binding PR; 3.10A {Sulfolobus solfataricus} Length = 255 Back     alignment and structure
>2nnw_A NOP5/NOP56 related protein; box C/D; 2.70A {Pyrococcus furiosus} PDB: 3nvi_A 3nmu_A 3nvk_A* 3nvm_A Length = 376 Back     alignment and structure
>2nnw_A NOP5/NOP56 related protein; box C/D; 2.70A {Pyrococcus furiosus} PDB: 3nvi_A 3nmu_A 3nvk_A* 3nvm_A Length = 376 Back     alignment and structure
>3pla_A NOP5, PRE mRNA splicing protein; RNA-binding, SAM, box C/D RNA; HET: SAH; 3.15A {Sulfolobus solfataricus} PDB: 3id5_A* Length = 388 Back     alignment and structure
>3pla_A NOP5, PRE mRNA splicing protein; RNA-binding, SAM, box C/D RNA; HET: SAH; 3.15A {Sulfolobus solfataricus} PDB: 3id5_A* Length = 388 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3gqu_A NOP5P protein; RNA binding domain, RNA binding protein; 2.50A {Pyrococcus horikoshii} PDB: 3gqx_B Length = 169 Back     alignment and structure
>3gqu_A NOP5P protein; RNA binding domain, RNA binding protein; 2.50A {Pyrococcus horikoshii} PDB: 3gqx_B Length = 169 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>1nt2_B Conserved hypothetical protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: a.183.1.1 Length = 258 Back     alignment and structure
>1nt2_B Conserved hypothetical protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: a.183.1.1 Length = 258 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3id6_A NOP5, PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} Length = 268 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1746
2ozb_B260 U4/U6 small nuclear ribonucleoprotein PRP31; RNA-p 100.0
3icx_A255 PRE mRNA splicing protein; C/D guide RNA, 2'-O-met 100.0
3pla_A388 NOP5, PRE mRNA splicing protein; RNA-binding, SAM, 100.0
2nnw_A376 NOP5/NOP56 related protein; box C/D; 2.70A {Pyroco 100.0
3aad_A292 Transcription initiation factor TFIID subunit 1; p 100.0
1nt2_B258 Conserved hypothetical protein; adeMet, binding mo 100.0
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 100.0
3gqu_A169 NOP5P protein; RNA binding domain, RNA binding pro 100.0
2r10_A361 Chromatin structure-remodeling complex protein RSC 100.0
2r0y_A311 Chromatin structure-remodeling complex protein RSC 100.0
3id6_A268 NOP5, PRE mRNA splicing protein; C/D guide RNA, 2' 99.97
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.94
3uv4_A158 Second bromodomain of human transcription initiat 99.92
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.92
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.88
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.88
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.88
3uv4_A158 Second bromodomain of human transcription initiat 99.88
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.88
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.88
3d7c_A112 General control of amino acid synthesis protein 5; 99.88
2dat_A123 Possible global transcription activator SNF2L2; br 99.88
2grc_A129 Probable global transcription activator SNF2L4; br 99.87
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.87
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.87
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.86
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.86
3p1f_A119 CREB-binding protein; structural genomics consorti 99.86
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.86
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.86
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.86
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.86
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.85
3d7c_A112 General control of amino acid synthesis protein 5; 99.85
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.85
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.85
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.85
3p1f_A119 CREB-binding protein; structural genomics consorti 99.85
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.85
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.85
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.84
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.84
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.84
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.84
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.84
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.84
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.84
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.84
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.84
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.84
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.83
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.83
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.83
2grc_A129 Probable global transcription activator SNF2L4; br 99.83
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.83
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.83
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.83
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.83
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.83
2dat_A123 Possible global transcription activator SNF2L2; br 99.83
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.82
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.82
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.82
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.82
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.82
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.82
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.81
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.81
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.8
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.78
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.78
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.78
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.77
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.76
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.75
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.74
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.74
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.7
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.7
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.66
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.55
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.12
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.09
2ozb_B260 U4/U6 small nuclear ribonucleoprotein PRP31; RNA-p 98.67
3gqu_A169 NOP5P protein; RNA binding domain, RNA binding pro 98.37
3icx_A255 PRE mRNA splicing protein; C/D guide RNA, 2'-O-met 98.36
1nt2_B258 Conserved hypothetical protein; adeMet, binding mo 98.15
3pla_A388 NOP5, PRE mRNA splicing protein; RNA-binding, SAM, 98.09
2nnw_A376 NOP5/NOP56 related protein; box C/D; 2.70A {Pyroco 97.77
>2ozb_B U4/U6 small nuclear ribonucleoprotein PRP31; RNA-protein complex, ribonucleoprotein particle (RNP), PRE-M splicing, U4/U6 DI-snRNA, U4/U6 DI-snRNP; 2.60A {Homo sapiens} SCOP: a.183.1.1 PDB: 3siu_B 3siv_B Back     alignment and structure
Probab=100.00  E-value=6.2e-76  Score=656.64  Aligned_cols=255  Identities=67%  Similarity=1.051  Sum_probs=235.3

Q ss_pred             CccCCCCCCcchhHHHHHHHhHHHHHHHHHHHHHHHHHHhhccCccchhccCChHHHHHHHHHHhCCcccCCCchHHHhh
Q psy11166       1214 PIVGPVESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQV 1293 (1746)
Q Consensus      1214 ~~~g~~e~~pEy~lIVqan~L~~eID~EI~~ih~~lRe~Ys~rFPELesLV~~p~~Y~r~V~~igN~ld~~k~~e~L~~i 1293 (1746)
                      .+.|+++++|||++|||||+|+++||+|||.+||||||||+||||||++||+||++|+++|+.|||+.+.+++.++|.++
T Consensus         6 ~~~~~~e~~~eY~~Ivqa~~lld~idkein~~~~rlre~Y~~~FPEL~~lv~~~~~Y~~~V~~ig~~~~~~~~~~~L~~i   85 (260)
T 2ozb_B            6 EVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQI   85 (260)
T ss_dssp             ------CCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCTTHHHHCCSHHHHHHHHHHHTTCGGGCTTCTTGGGT
T ss_pred             cccCCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcCccHHHHhcCHHHHHHHHHHhCCchhhccchHHHHHH
Confidence            46799999999999999999999999999999999999999999999999999999999999999998877666679999


Q ss_pred             cchhhhhhhheeccccCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCchhHHhchHHHHHHHHHhCCC
Q psy11166       1294 LTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGL 1373 (1746)
Q Consensus      1294 L~~~timvVsv~AstS~G~~Lseedl~~I~~ac~~i~~L~~~r~~i~~YVesRM~~IAPNLsALVG~~vAArLI~~AGGL 1373 (1746)
                      |+++++|+|+++|++|+|.+||++|+.+|..+|+++++|+++|++|.+||++||..||||||+|||+.||||||++||||
T Consensus        86 L~~~~~~~i~~aA~~S~G~~ls~~dl~~i~~~~~~v~~L~~~r~~l~~yl~~rM~~iAPNLtaLvG~~vaArLI~~AGsL  165 (260)
T 2ozb_B           86 LTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGL  165 (260)
T ss_dssp             SCHHHHHHHHHHHHSCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHTSH
T ss_pred             cCHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHhCcHHHHHHHHHhCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCcCCccccccCCCchhhhhhcccccccccccccCCCCceEEEecccccccCchhhHHHhhhhhcCCchhhHhH
Q psy11166       1374 SRLSKMPGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRK 1453 (1746)
Q Consensus      1374 ~~~~~~~~~~~~~~~LAkmPAcNIq~LGAeK~l~~glst~~~~pk~G~Iy~s~lVq~~P~~~~~~~~~~~~~~~~~~r~K 1453 (1746)
                                   .+||||||||||+|||+|++|+||++++++|||||||||++||++|+               ++|||
T Consensus       166 -------------~~Lak~PastiqiLGaeKalf~~l~t~~~~pk~G~Iy~~~~V~~~p~---------------~~rgk  217 (260)
T 2ozb_B          166 -------------TNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPP---------------DLRRK  217 (260)
T ss_dssp             -------------HHHHTSCHHHHTTTTCC----------CCCTTCCTTTTSHHHHTSCG---------------GGHHH
T ss_pred             -------------HHHhhCCcHHHHHhcccHHHHHhhccCCCCCCeeeEeCCHHHhhCCH---------------HHHHH
Confidence                         99999999999999999999999999999999999999999999999               99999


Q ss_pred             HHHHhhhhHHhhhhhcccCCCCCCcccHHHHHHHHHHHHHhcC
Q psy11166       1454 AARLVAAKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTE 1496 (1746)
Q Consensus      1454 aaR~lAaK~aLAARvD~~~~~~dg~~G~~lreeIe~kl~Kl~E 1496 (1746)
                      |+|+||+||+||||||+|+++++|.+|.+||++|++||+||+|
T Consensus       218 ~~R~lA~K~alAaRiD~~~~~~~~~~G~~lr~~ie~rl~~~~e  260 (260)
T 2ozb_B          218 AARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQE  260 (260)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCSTTSHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCCccccHHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999987
>3icx_A PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, RNA binding PR; 3.10A {Sulfolobus solfataricus} Back     alignment and structure
>3pla_A NOP5, PRE mRNA splicing protein; RNA-binding, SAM, box C/D RNA; HET: SAH; 3.15A {Sulfolobus solfataricus} PDB: 3id5_A* Back     alignment and structure
>2nnw_A NOP5/NOP56 related protein; box C/D; 2.70A {Pyrococcus furiosus} PDB: 3nvi_A 3nmu_A 3nvk_A* 3nvm_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>1nt2_B Conserved hypothetical protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: a.183.1.1 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3gqu_A NOP5P protein; RNA binding domain, RNA binding protein; 2.50A {Pyrococcus horikoshii} PDB: 3gqx_B Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3id6_A NOP5, PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2ozb_B U4/U6 small nuclear ribonucleoprotein PRP31; RNA-protein complex, ribonucleoprotein particle (RNP), PRE-M splicing, U4/U6 DI-snRNA, U4/U6 DI-snRNP; 2.60A {Homo sapiens} SCOP: a.183.1.1 PDB: 3siu_B 3siv_B Back     alignment and structure
>3gqu_A NOP5P protein; RNA binding domain, RNA binding protein; 2.50A {Pyrococcus horikoshii} PDB: 3gqx_B Back     alignment and structure
>3icx_A PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, RNA binding PR; 3.10A {Sulfolobus solfataricus} Back     alignment and structure
>1nt2_B Conserved hypothetical protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: a.183.1.1 Back     alignment and structure
>3pla_A NOP5, PRE mRNA splicing protein; RNA-binding, SAM, box C/D RNA; HET: SAH; 3.15A {Sulfolobus solfataricus} PDB: 3id5_A* Back     alignment and structure
>2nnw_A NOP5/NOP56 related protein; box C/D; 2.70A {Pyrococcus furiosus} PDB: 3nvi_A 3nmu_A 3nvk_A* 3nvm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1746
d2ozbb1249 a.183.1.1 (B:85-333) U4/U6 small nuclear ribonucle 4e-87
d2ozbb1249 a.183.1.1 (B:85-333) U4/U6 small nuclear ribonucle 7e-11
d1nt2b_256 a.183.1.1 (B:) Nop5p {Archaeon Archaeoglobus fulgi 8e-42
d1nt2b_256 a.183.1.1 (B:) Nop5p {Archaeon Archaeoglobus fulgi 5e-06
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 8e-41
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 4e-29
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 7e-08
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 6e-40
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 4e-25
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 4e-07
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 4e-23
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 3e-20
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 1e-07
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 2e-21
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-19
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 6e-09
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 2e-19
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 5e-17
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 3e-07
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 7e-19
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 4e-18
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 6e-09
>d2ozbb1 a.183.1.1 (B:85-333) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure

class: All alpha proteins
fold: Nop domain
superfamily: Nop domain
family: Nop domain
domain: U4/U6 small nuclear ribonucleoprotein Prp31
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  282 bits (723), Expect = 4e-87
 Identities = 168/277 (60%), Positives = 209/277 (75%), Gaps = 28/277 (10%)

Query: 1220 ESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGN 1279
            E+ PEY++IV+ANNL VEI+ E+ +IH+F  +KY+KRFPEL++LV + L+Y+RTV+ELGN
Sbjct: 1    EAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN 60

Query: 1280 DLDQTKNNETLQQVLTQATIMVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSI 1339
             LD+ KNNE LQQ+LT ATIMVVSVTASTTQGQ LSEEEL  + +ACDMA ELN  K  I
Sbjct: 61   SLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRI 120

Query: 1340 FEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKMPGVAGGLSRLSKMPACNILL 1399
            +EYVESRM++IAPNLS I+GASTAAK+M             GVAGGL+ LSKMPACNI+L
Sbjct: 121  YEYVESRMSFIAPNLSIIIGASTAAKIM-------------GVAGGLTNLSKMPACNIML 167

Query: 1400 QGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVA 1459
             GAQ+K LSGFS TSVLPHTG++Y+S +VQ                 P D+RRKAARLVA
Sbjct: 168  LGAQRKTLSGFSSTSVLPHTGYIYHSDIVQ--------SL-------PPDLRRKAARLVA 212

Query: 1460 AKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTE 1496
            AKC LAARVD+ H+S +G +G   +++IE+K DK  E
Sbjct: 213  AKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQE 249
>d2ozbb1 a.183.1.1 (B:85-333) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1nt2b_ a.183.1.1 (B:) Nop5p {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 256 Back     information, alignment and structure
>d1nt2b_ a.183.1.1 (B:) Nop5p {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 256 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1746
d2ozbb1249 U4/U6 small nuclear ribonucleoprotein Prp31 {Human 100.0
d1nt2b_256 Nop5p {Archaeon Archaeoglobus fulgidus [TaxId: 223 100.0
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.94
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.92
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.87
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.86
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.86
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.86
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.84
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.84
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.83
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.83
d2ozbb1249 U4/U6 small nuclear ribonucleoprotein Prp31 {Human 98.79
d1nt2b_256 Nop5p {Archaeon Archaeoglobus fulgidus [TaxId: 223 97.51
>d2ozbb1 a.183.1.1 (B:85-333) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Nop domain
superfamily: Nop domain
family: Nop domain
domain: U4/U6 small nuclear ribonucleoprotein Prp31
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.2e-75  Score=643.59  Aligned_cols=249  Identities=67%  Similarity=1.047  Sum_probs=235.9

Q ss_pred             CCCcchhHHHHHHHhHHHHHHHHHHHHHHHHHHhhccCccchhccCChHHHHHHHHHHhCCcccCCCchHHHhhcchhhh
Q psy11166       1220 ESDPEYQLIVEANNLAVEIDTEIGLIHRFAVEKYNKRFPELDTLVVSPLEYLRTVRELGNDLDQTKNNETLQQVLTQATI 1299 (1746)
Q Consensus      1220 e~~pEy~lIVqan~L~~eID~EI~~ih~~lRe~Ys~rFPELesLV~~p~~Y~r~V~~igN~ld~~k~~e~L~~iL~~~ti 1299 (1746)
                      |++|||+||||||+++++||+|||.+|+||||||+||||||++||+||.+|+++|+.|||+.|.++.++.|.++|+++++
T Consensus         1 e~~pEy~lIvq~~~l~~~iD~ein~~~~~lrewY~~~FPEL~~lv~~~~~Y~~~V~~i~~~~~~~~~~~~l~~~l~~~~~   80 (249)
T d2ozbb1           1 EAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATI   80 (249)
T ss_dssp             CCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCTTHHHHCCSHHHHHHHHHHHTTCGGGCTTCTTGGGTSCHHHH
T ss_pred             CCChhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHCCcChhHHHHcCCHHHHHHHHHHHcCccccccchhHHHHhCCHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999988877889999999999


Q ss_pred             hhhheeccccCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCchhHHhchHHHHHHHHHhCCCccccCC
Q psy11166       1300 MVVSVTASTTQGQLLSEEELSEVYQACDMAFELNQFKTSIFEYVESRMTYIAPNLSAIVGASTAAKMMGVAGGLSRLSKM 1379 (1746)
Q Consensus      1300 mvVsv~AstS~G~~Lseedl~~I~~ac~~i~~L~~~r~~i~~YVesRM~~IAPNLsALVG~~vAArLI~~AGGL~~~~~~ 1379 (1746)
                      |+|+++|++|+|.+|+++|+..|..+|+++++|+++|+.|.+||++||..||||||||||+.+|||||++||||      
T Consensus        81 ~~i~~aa~~s~G~~ls~~dl~~i~~~~~~i~~L~~~r~~l~~yi~~rm~~iAPNl~aLvG~~~aArLi~~AGgL------  154 (249)
T d2ozbb1          81 MVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGL------  154 (249)
T ss_dssp             HHHHHHHHSCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHTSH------
T ss_pred             HHHHHHhcccCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCccHHHHHCchHHHHHHHHhCCH------
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999      


Q ss_pred             CCcCCccccccCCCchhhhhhcccccccccccccCCCCceEEEecccccccCchhhHHHhhhhhcCCchhhHhHHHHHhh
Q psy11166       1380 PGVAGGLSRLSKMPACNILLQGAQKKLLSGFSQTSVLPHTGFVYYSSLVQDYPADMRRKAARLVQDYPADMRRKAARLVA 1459 (1746)
Q Consensus      1380 ~~~~~~~~~LAkmPAcNIq~LGAeK~l~~glst~~~~pk~G~Iy~s~lVq~~P~~~~~~~~~~~~~~~~~~r~KaaR~lA 1459 (1746)
                             .+||+|||||||+|||+|++|+||++++.+|||||||||++||++|+               ++|+||+|+||
T Consensus       155 -------~~LAk~PastIq~LGaeKalf~~l~~~~~~pk~G~i~~~~~V~~~p~---------------~~rgk~~R~lA  212 (249)
T d2ozbb1         155 -------TNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPP---------------DLRRKAARLVA  212 (249)
T ss_dssp             -------HHHHTSCHHHHTTTTCC----------CCCTTCCTTTTSHHHHTSCG---------------GGHHHHHHHHH
T ss_pred             -------HHHHhCChHHHHHHhhhhhhHHHHhcCCCCCCCCeeecCHHHHhCCH---------------HHHHHHHHHHH
Confidence                   99999999999999999999999999999999999999999999999               99999999999


Q ss_pred             hhHHhhhhhcccCCCCCCcccHHHHHHHHHHHHHhcC
Q psy11166       1460 AKCALAARVDAAHDSVDGAIGRSFREDIEKKLDKLTE 1496 (1746)
Q Consensus      1460 aK~aLAARvD~~~~~~dg~~G~~lreeIe~kl~Kl~E 1496 (1746)
                      +|||||||||+|+++++|.+|.+||++|++||+||+|
T Consensus       213 ~K~slAARiD~~~~~~~~~~G~~~r~~ie~ki~k~~E  249 (249)
T d2ozbb1         213 AKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQE  249 (249)
T ss_dssp             HHHHHHHHHHHTTCSTTSHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHhHcCCCCCchHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999987
>d1nt2b_ a.183.1.1 (B:) Nop5p {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozbb1 a.183.1.1 (B:85-333) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2b_ a.183.1.1 (B:) Nop5p {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure