Psyllid ID: psy11231

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYNYEETISTLRYASRVKKICNKARPPGSYVLWVGVNSWVV
ccccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccc
cEEEEEEEccccccccccccccccccccHHHccHHHHHHHHHHHHHHcccccccHHHcHHHHHcHHHcccccEEEEEEEEccEHHHHHHHHHHHHHHHHHHccEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEccccccccEEEEEEccEEEc
MGRLHLVDLagserqaktgasgqRLKEASKINLSLSTLGNVISALVdgkcthipyrnsKLTRILQDslggnsktvmcatvgpasynyeetISTLRYASRVKKICNkarvnqdpkDALLIKYQKEISELKKKSYNYEETISTLRYASRVKKIcnkarppgsyVLWVGVNSWVV
mgrlhlvdlagserqaktgasgqrlkEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNkarvnqdpkdaLLIKYQKEISelkkksynyeetistlrYASRVKKICnkarppgsyvlwvgvnswvv
MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYNYEETISTLRYASRVKKICNKARPPGSYVLWVGVNSWVV
******************************INLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYNYEETISTLRYASRVKKICNKARPPGSYVLWVGVNSWV*
*GRLHLVDLAGS**************EASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISE**************************************GVNSWVV
MGRLHLVDLAGSE************KEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYNYEETISTLRYASRVKKICNKARPPGSYVLWVGVNSWVV
MGRLHLVDLAG*************LKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYNYEETISTLRYASRVKKICNKARPPGSYVLWVGVNSWVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALxxxxxxxxxxxxxxxxxxxxxISTLRYASRVKKICNKARPPGSYVLWVGVNSWVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q5R4H3 702 Kinesin-like protein KIF3 yes N/A 0.796 0.195 0.817 5e-62
Q4R628 702 Kinesin-like protein KIF3 N/A N/A 0.796 0.195 0.817 5e-62
P28741 701 Kinesin-like protein KIF3 yes N/A 0.796 0.195 0.817 6e-62
Q9Y496 699 Kinesin-like protein KIF3 yes N/A 0.796 0.195 0.817 6e-62
P46872 699 Kinesin-II 85 kDa subunit yes N/A 0.761 0.187 0.801 1e-59
O15066 747 Kinesin-like protein KIF3 no N/A 0.75 0.172 0.782 4e-55
Q61771 747 Kinesin-like protein KIF3 no N/A 0.75 0.172 0.782 5e-55
P46871 742 Kinesin-II 95 kDa subunit no N/A 0.755 0.175 0.753 2e-54
Q99PW8 1038 Kinesin-like protein KIF1 no N/A 0.744 0.123 0.742 5e-52
P46873 699 Osmotic avoidance abnorma no N/A 0.75 0.184 0.744 2e-51
>sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 Back     alignment and function desciption
 Score =  236 bits (602), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 112/137 (81%), Positives = 125/137 (91%)

Query: 1   MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
           MG+LHLVDLAGSERQAKTGA+GQRLKEA+KINLSLSTLGNVISALVDGK TH+PYRNSKL
Sbjct: 243 MGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKL 302

Query: 61  TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIK 120
           TR+LQDSLGGNSKT+MCA +GPA YNY+ETISTLRYA+R K I NKAR+N+DPKDALL +
Sbjct: 303 TRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQ 362

Query: 121 YQKEISELKKKSYNYEE 137
           +QKEI ELKKK    EE
Sbjct: 363 FQKEIEELKKKLEEGEE 379
Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro (By similarity). Plays a role in primary cilia formation.
Pongo abelii (taxid: 9601)
>sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 Back     alignment and function description
>sp|P28741|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2 Back     alignment and function description
>sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 Back     alignment and function description
>sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 Back     alignment and function description
>sp|O15066|KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens GN=KIF3B PE=1 SV=1 Back     alignment and function description
>sp|Q61771|KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus GN=Kif3b PE=1 SV=1 Back     alignment and function description
>sp|P46871|KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP95 PE=1 SV=1 Back     alignment and function description
>sp|Q99PW8|KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus GN=Kif17 PE=1 SV=1 Back     alignment and function description
>sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
355698382 577 kinesin family member 3A [Mustela putori 0.796 0.237 0.817 1e-60
149052572 669 rCG33740, isoform CRA_b [Rattus norvegic 0.796 0.204 0.817 2e-60
217273045 669 kinesin family member 3A (predicted) [Or 0.796 0.204 0.817 2e-60
184185450 696 kinesin-like protein KIF3Abeta (predicte 0.796 0.196 0.817 2e-60
197215658 696 kinesin-like protein KIF3Abeta (predicte 0.796 0.196 0.817 2e-60
229368750 669 kinesin family member 3A (predicted) [Da 0.796 0.204 0.817 2e-60
281182706 669 kinesin-like protein KIF3A [Papio anubis 0.796 0.204 0.817 2e-60
354472606 702 PREDICTED: kinesin-like protein KIF3A-li 0.796 0.195 0.817 2e-60
170649705 669 kinesin-like protein KIF3A (predicted) [ 0.796 0.204 0.817 2e-60
354472610 695 PREDICTED: kinesin-like protein KIF3A-li 0.796 0.197 0.817 2e-60
>gi|355698382|gb|AES00779.1| kinesin family member 3A [Mustela putorius furo] Back     alignment and taxonomy information
 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/137 (81%), Positives = 125/137 (91%)

Query: 1   MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
           MG+LHLVDLAGSERQAKTGA+GQRLKEA+KINLSLSTLGNVISALVDGK TH+PYRNSKL
Sbjct: 122 MGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKL 181

Query: 61  TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIK 120
           TR+LQDSLGGNSKT+MCA +GPA YNY+ETISTLRYA+R K I NKAR+N+DPKDALL +
Sbjct: 182 TRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQ 241

Query: 121 YQKEISELKKKSYNYEE 137
           +QKEI ELKKK    EE
Sbjct: 242 FQKEIEELKKKLEEGEE 258

Source: Mustela putorius furo

Species: Mustela putorius

Genus: Mustela

Family: Mustelidae

Order: Carnivora

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|149052572|gb|EDM04389.1| rCG33740, isoform CRA_b [Rattus norvegicus] Back     alignment and taxonomy information
>gi|217273045|gb|ACK28138.1| kinesin family member 3A (predicted) [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|184185450|gb|ACC68856.1| kinesin-like protein KIF3Abeta (predicted) [Rhinolophus ferrumequinum] Back     alignment and taxonomy information
>gi|197215658|gb|ACH53049.1| kinesin-like protein KIF3Abeta (predicted) [Otolemur garnettii] Back     alignment and taxonomy information
>gi|229368750|gb|ACQ63031.1| kinesin family member 3A (predicted) [Dasypus novemcinctus] Back     alignment and taxonomy information
>gi|281182706|ref|NP_001162231.1| kinesin-like protein KIF3A [Papio anubis] gi|159461528|gb|ABW96803.1| kinesin family member 3A (predicted) [Papio anubis] Back     alignment and taxonomy information
>gi|354472606|ref|XP_003498529.1| PREDICTED: kinesin-like protein KIF3A-like isoform 1 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|170649705|gb|ACB21287.1| kinesin-like protein KIF3A (predicted) [Callicebus moloch] Back     alignment and taxonomy information
>gi|354472610|ref|XP_003498531.1| PREDICTED: kinesin-like protein KIF3A-like isoform 3 [Cricetulus griseus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
UNIPROTKB|F1NIP3 707 KIF3A "Uncharacterized protein 0.796 0.193 0.817 8.6e-56
UNIPROTKB|Q5W4S8268 KIF3A "Uncharacterized protein 0.796 0.511 0.817 8.6e-56
UNIPROTKB|E1B999 726 KIF3A "Uncharacterized protein 0.796 0.188 0.817 8.6e-56
UNIPROTKB|E1BKE3 593 KIF3A "Uncharacterized protein 0.796 0.231 0.817 8.6e-56
UNIPROTKB|E2QSW6 702 KIF3A "Uncharacterized protein 0.796 0.195 0.817 8.6e-56
UNIPROTKB|F1PQE6451 KIF3A "Uncharacterized protein 0.796 0.303 0.817 8.6e-56
UNIPROTKB|F1PSQ4 724 KIF3A "Uncharacterized protein 0.796 0.189 0.817 8.6e-56
UNIPROTKB|F6UP44 699 KIF3A "Uncharacterized protein 0.796 0.195 0.817 8.6e-56
UNIPROTKB|E9PES4 726 KIF3A "Kinesin-like protein KI 0.796 0.188 0.817 8.6e-56
UNIPROTKB|J3KPF9 702 KIF3A "Kinesin-like protein KI 0.796 0.195 0.817 8.6e-56
UNIPROTKB|F1NIP3 KIF3A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 575 (207.5 bits), Expect = 8.6e-56, P = 8.6e-56
 Identities = 112/137 (81%), Positives = 125/137 (91%)

Query:     1 MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
             MG+LHLVDLAGSERQAKTGA+GQRLKEA+KINLSLSTLGNVISALVDGK TH+PYRNSKL
Sbjct:   246 MGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKL 305

Query:    61 TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIK 120
             TR+LQDSLGGNSKT+MCA +GPA YNY+ETISTLRYA+R K I NKAR+N+DPKDALL +
Sbjct:   306 TRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQ 365

Query:   121 YQKEISELKKKSYNYEE 137
             +QKEI ELKKK    EE
Sbjct:   366 FQKEIEELKKKLEEGEE 382
GO:0003777 "microtubule motor activity" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0001701 "in utero embryonic development" evidence=IEA
GO:0001822 "kidney development" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0005876 "spindle microtubule" evidence=IEA
GO:0007224 "smoothened signaling pathway" evidence=IEA
GO:0007368 "determination of left/right symmetry" evidence=IEA
GO:0007507 "heart development" evidence=IEA
GO:0009952 "anterior/posterior pattern specification" evidence=IEA
GO:0016939 "kinesin II complex" evidence=IEA
GO:0021904 "dorsal/ventral neural tube patterning" evidence=IEA
GO:0032391 "photoreceptor connecting cilium" evidence=IEA
GO:0042384 "cilium assembly" evidence=IEA
UNIPROTKB|Q5W4S8 KIF3A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B999 KIF3A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKE3 KIF3A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSW6 KIF3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQE6 KIF3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSQ4 KIF3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UP44 KIF3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PES4 KIF3A "Kinesin-like protein KIF3A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KPF9 KIF3A "Kinesin-like protein KIF3A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R4H3KIF3A_PONABNo assigned EC number0.81750.79650.1951yesN/A
Q9US60KLP3_SCHPONo assigned EC number0.53230.750.2328yesN/A
Q8J1G4KIP1_ASHGONo assigned EC number0.55300.75580.1151yesN/A
P28741KIF3A_MOUSENo assigned EC number0.81750.79650.1954yesN/A
Q54UC9KIF3_DICDINo assigned EC number0.61360.74410.1072yesN/A
P46872KRP85_STRPUNo assigned EC number0.80150.76160.1874yesN/A
Q9Y496KIF3A_HUMANNo assigned EC number0.81750.79650.1959yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 2e-73
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 9e-65
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 1e-62
cd00106328 cd00106, KISc, Kinesin motor domain 7e-58
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 4e-55
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 4e-54
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 2e-53
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 4e-52
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 6e-51
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 3e-49
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 8e-42
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 6e-41
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 3e-40
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 6e-40
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 4e-38
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 3e-35
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 1e-29
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 1e-28
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 9e-25
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information 
 Score =  223 bits (570), Expect = 2e-73
 Identities = 84/103 (81%), Positives = 96/103 (93%)

Query: 1   MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
           +G+L+LVDLAGSERQ+KTGA+G RLKEA+KINLSLS LGNVISALVDGK THIPYR+SKL
Sbjct: 231 VGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKL 290

Query: 61  TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKI 103
           TR+LQDSLGGNSKTVMCA +GPA YNY+ET+STLRYA+R K I
Sbjct: 291 TRLLQDSLGGNSKTVMCANIGPADYNYDETLSTLRYANRAKNI 333

Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 333
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
KOG4280|consensus 574 100.0
KOG0245|consensus 1221 100.0
KOG0243|consensus 1041 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
KOG0240|consensus 607 100.0
KOG0242|consensus 675 100.0
KOG0241|consensus 1714 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
KOG0244|consensus 913 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 99.97
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 99.97
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 99.97
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 99.97
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 99.97
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 99.97
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 99.97
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 99.97
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 99.97
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 99.97
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 99.96
KOG0246|consensus676 99.95
KOG0239|consensus670 99.95
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 99.95
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.95
KOG0247|consensus 809 99.94
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.94
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.5e-42  Score=306.38  Aligned_cols=137  Identities=69%  Similarity=0.920  Sum_probs=132.0

Q ss_pred             CccEEEEeCCCCCcccccCCchhhHHHHHhhhhhHHHHHHHHHHHhcCCCCCCCCCCchhhhccccCCCCCceeEeEeee
Q psy11231          1 MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATV   80 (172)
Q Consensus         1 vsrL~~VDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~~L~~~~~~~ipyRdSkLT~lL~d~LgG~~~t~lI~~v   80 (172)
                      .|||+|||||||||..+++++|++++|+.+||+||++||+||.+|.+++..||||||||||+||+|+|||||+|+||+||
T Consensus       234 ~~rlnlvDLagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aLvd~~~~HIPYRdSkLT~LLqdSLGGN~kT~mianv  313 (574)
T KOG4280|consen  234 SSKLNLVDLAGSERQSKTGAEGERLKEATNINLSLSALGNVISALVDGSKTHIPYRDSKLTRLLQDSLGGNSKTTMIANV  313 (574)
T ss_pred             cceeeeeeccchhhhcccCccchhhhhhcccchhHHHHHHHHHHHhccccCCCCcchhHHHHHHHHHcCCCceEEEEEec
Confidence            48999999999999999999999999999999999999999999999887799999999999999999999999999999


Q ss_pred             CCCCCChHHHHHHHHHHHHHhcccccccccCCchHHHHHHHHHHHHHHHHHHHHHHH
Q psy11231         81 GPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYNYEE  137 (172)
Q Consensus        81 sp~~~~~~eTl~TL~fa~r~k~i~~~~~~n~~~~~~~i~~l~~ei~~Lk~~l~~~~~  137 (172)
                      +|...+|+||++||+||+|||.|+|+|.+|.++.+..++.|+.||+.|+.++.....
T Consensus       314 sp~~~~~~ETlsTLrfA~Rak~I~nk~~ined~~~~~~~~lq~ei~~Lk~~l~~~~~  370 (574)
T KOG4280|consen  314 SPSSDNYEETLSTLRFAQRAKAIKNKPVINEDPKDALLRELQEEIERLKKELDPGGS  370 (574)
T ss_pred             CchhhhhHHHHHHHHHHHHHHHhhccccccCCcchhhHHHHHHHHHHHHHhhccccC
Confidence            999999999999999999999999999999999999999999999999998876543

>KOG0245|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 4e-53
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 2e-44
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 8e-41
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 3e-36
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 5e-32
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 9e-32
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 1e-31
4a1z_A368 Eg5-1 Length = 368 1e-31
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 1e-31
4a28_A368 Eg5-2 Length = 368 1e-31
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 1e-31
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 1e-31
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 1e-31
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 4e-31
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 2e-30
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 7e-30
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 4e-29
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 5e-29
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 5e-29
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 3e-28
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 4e-28
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 4e-28
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 4e-28
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 1e-27
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 3e-27
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-27
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-27
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 3e-27
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 2e-26
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 2e-26
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 6e-25
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 3e-24
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 6e-24
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 4e-23
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 2e-22
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 3e-22
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 7e-22
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 7e-22
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 7e-22
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 4e-21
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 5e-21
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 6e-21
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 8e-20
2kin_B100 Kinesin (Monomeric) From Rattus Norvegicus Length = 4e-19
3kin_B117 Kinesin (Dimeric) From Rattus Norvegicus Length = 1 4e-19
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 7e-19
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 7e-19
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 7e-19
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 8e-19
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 5e-18
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 2e-17
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 2e-17
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 2e-17
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 3e-17
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 1e-16
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 5e-14
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 3e-13
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure 
Iteration: 1

 Score =  203 bits (516), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 111/122 (90%)
Query: 1   MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
           +G+L+LVDLAGSERQAKTGA G+RLKEA+KINLSLS LGNVISALVDGK THIPYR+SKL
Sbjct: 251 VGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKL 310
Query: 61  TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIK 120
           TR+LQDSLGGN+KTVM A VGPASYN EET++TLRYA+R K I NK RVN+DPKDALL +
Sbjct: 311 TRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLRE 370
Query: 121 YQ 122
           +Q
Sbjct: 371 FQ 372
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 Back     alignment and structure
>pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 4e-89
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 7e-89
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 1e-88
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 3e-87
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 2e-84
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 8e-84
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 3e-82
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 5e-82
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 5e-81
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 2e-80
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 1e-78
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 2e-77
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 3e-77
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 3e-76
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 6e-76
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 6e-75
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 9e-75
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 4e-74
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 4e-74
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 4e-73
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 1e-72
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 3e-71
3u06_A412 Protein claret segregational; motor domain, stalk 5e-71
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 3e-70
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 3e-68
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 8e-68
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 3e-58
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 7e-58
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
 Score =  263 bits (675), Expect = 4e-89
 Identities = 70/131 (53%), Positives = 89/131 (67%), Gaps = 1/131 (0%)

Query: 1   MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
            G+L+LVDLAGSE+ +KTGA G  L EA  IN SLS LGNVISAL DG  THIPYR+SKL
Sbjct: 231 SGKLYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKL 290

Query: 61  TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDP-KDALLI 119
           TRILQ+SLGGN++T +     PAS+N  ET STL +  R K + N   VN++   +    
Sbjct: 291 TRILQESLGGNARTTIVICCSPASFNESETKSTLDFGRRAKTVKNVVCVNEELTAEEWKR 350

Query: 120 KYQKEISELKK 130
           +Y+KE  +  +
Sbjct: 351 RYEKEKEKNAR 361
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-41  Score=289.10  Aligned_cols=128  Identities=55%  Similarity=0.753  Sum_probs=97.8

Q ss_pred             ccEEEEeCCCCCcccccCCchhhHHHHHhhhhhHHHHHHHHHHHhcCCCCCCCCCCchhhhccccCCCCCceeEeEeeeC
Q psy11231          2 GRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVG   81 (172)
Q Consensus         2 srL~~VDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~~L~~~~~~~ipyRdSkLT~lL~d~LgG~~~t~lI~~vs   81 (172)
                      |+|+|||||||||..++++.|.+++|+..||+||++||+||.+|++++..||||||||||+||+|+|||||+|+||+|||
T Consensus       232 skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~~~hvPyRdSkLT~lLqdsLgGnskt~mI~~is  311 (365)
T 2y65_A          232 GKLYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCS  311 (365)
T ss_dssp             EEEEEEECCCCCC----------------CCHHHHHHHHHHHHHHHCCCSCCCGGGCHHHHHTGGGTTSSSEEEEEEEEC
T ss_pred             EEEEEEECCCCCcchhcCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCCCCccccCHHHHHHHhhcCCCccEEEEEEec
Confidence            78999999999999999999999999999999999999999999988668999999999999999999999999999999


Q ss_pred             CCCCChHHHHHHHHHHHHHhcccccccccCCchH-HHHHHHHHHHHHHH
Q psy11231         82 PASYNYEETISTLRYASRVKKICNKARVNQDPKD-ALLIKYQKEISELK  129 (172)
Q Consensus        82 p~~~~~~eTl~TL~fa~r~k~i~~~~~~n~~~~~-~~i~~l~~ei~~Lk  129 (172)
                      |...+++||++||+||+||+.|+|.|.+|.++.. .++++|++|+++++
T Consensus       312 P~~~~~~ETl~TL~fA~rak~I~n~~~~n~~~~~~~~~~~~~~e~~~~~  360 (365)
T 2y65_A          312 PASFNESETKSTLDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNA  360 (365)
T ss_dssp             CBGGGHHHHHHHHHHHHHHTTCEEECCCEEECCSHHHHHC---------
T ss_pred             CccCCHHHHHHHHHHHHHHhcccCcceeCCCCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999998764 56666777766654
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 1e-49
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 2e-44
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 3e-44
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 8e-44
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 1e-42
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 2e-42
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 3e-42
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 1e-40
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 2e-40
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Neurospora crassa [TaxId: 5141]

 Score =  161 bits (408), Expect = 1e-49
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 3/131 (2%)

Query: 1   MGRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKL 60
            G+L LVDLAGSE+  KTGASGQ L+EA KIN SLS LG VI+AL DGK +H+PYR+SKL
Sbjct: 227 SGQLFLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINALTDGKSSHVPYRDSKL 286

Query: 61  TRILQDSLGGNSKTVMCATVGPASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIK 120
           TRILQ+SLGGNS+T +     P+SYN  ET+STLR+  R K I NKA+VN +   A L  
Sbjct: 287 TRILQESLGGNSRTTLIINCSPSSYNDAETLSTLRFGMRAKSIKNKAKVNAELSPAEL-- 344

Query: 121 YQKEISELKKK 131
            ++ +++ K +
Sbjct: 345 -KQMLAKAKTQ 354
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 99.97
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 99.97
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 99.97
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 99.97
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 99.97
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=3.4e-38  Score=268.79  Aligned_cols=130  Identities=51%  Similarity=0.748  Sum_probs=106.8

Q ss_pred             ccEEEEeCCCCCcccccCCchhhHHHHHhhhhhHHHHHHHHHHHhcCCCCCCCCCCchhhhccccCCCCCceeEeEeeeC
Q psy11231          2 GRLHLVDLAGSERQAKTGASGQRLKEASKINLSLSTLGNVISALVDGKCTHIPYRNSKLTRILQDSLGGNSKTVMCATVG   81 (172)
Q Consensus         2 srL~~VDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~~L~~~~~~~ipyRdSkLT~lL~d~LgG~~~t~lI~~vs   81 (172)
                      |+|+|||||||||..++++.|.+++|+..||+||++|++||.+|++++ .|||||+||||++|+|+|||+|+|+||+|||
T Consensus       222 ~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~-~~ipyR~SkLT~lL~d~Lggns~t~~I~~is  300 (364)
T d1sdma_         222 GKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALSSGN-QHIPYRNHKLTMLMSDSLGGNAKTLMFVNIS  300 (364)
T ss_dssp             EEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHHHHTC-SCCCGGGCHHHHHTTTTTTSSSEEEEEEEEC
T ss_pred             EEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHHHcCC-CcCCchhhhhhHHHHhhcCCCceEEEEEEeC
Confidence            789999999999999999999999999999999999999999999875 7999999999999999999999999999999


Q ss_pred             CCCCChHHHHHHHHHHHHHhcccccccccCCchHHHHHHHHHHHHHHHHHHHH
Q psy11231         82 PASYNYEETISTLRYASRVKKICNKARVNQDPKDALLIKYQKEISELKKKSYN  134 (172)
Q Consensus        82 p~~~~~~eTl~TL~fa~r~k~i~~~~~~n~~~~~~~i~~l~~ei~~Lk~~l~~  134 (172)
                      |...+|+||++||+||++|++|+|+|.+|....  .+.+|++++..|++++..
T Consensus       301 p~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~~--~~~~l~~~i~~l~~~~~~  351 (364)
T d1sdma_         301 PAESNLDETHNSLTYASRVRSIVNDPSKNVSSK--EVARLKKLVSYWKEQAGR  351 (364)
T ss_dssp             CBGGGHHHHHHHHHHHHHHTTCCCCCCCCEECH--HHHHHHTTTTCC------
T ss_pred             CCcchHHHHHHHHHHHHHHhhcccCCcccCCHH--HHHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999998664  355666666666665543
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure