Psyllid ID: psy11241

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
NIASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR
cccccccEEEEcHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccccccEEEEccccccccccccccccccccccccEEEEccccccEEEEEcccccccEEEEEEEEEcccccEEEEEcEEEEccccccccHHHHHHHHHcc
cccccccEEEccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccccEEEEccccEEEEccccccccccccccccEEEEccccccEEEEEEEHHHHEEcEEEEEEEccccEEEEEccccEEEcccccccHHHHHHHHccc
niastgnlrilDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVvgghshtflysgkppcphdkpkgpypivvtssvdnrQVLVVQAAAYSRYLGLIHLQyndkgnivswrgdpilldkhiqegNIVVLFAKRFR
niastgnlrildeitsvnkeadrlvREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILldkhiqegnivVLFAKRFR
NIASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR
********RILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGK*********GPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAK***
N*ASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR
NIASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR
****TGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NIASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
P52307 580 Protein 5NUC (Fragment) O N/A N/A 0.986 0.251 0.426 4e-29
Q61503 576 5'-nucleotidase OS=Mus mu yes N/A 0.858 0.220 0.461 5e-27
B3A0N5 554 Apyrase OS=Tabanus yao PE N/A N/A 0.912 0.243 0.430 2e-26
P21588 576 5'-nucleotidase OS=Rattus yes N/A 0.858 0.220 0.453 6e-23
P21589 574 5'-nucleotidase OS=Homo s yes N/A 0.858 0.221 0.453 7e-23
Q05927 574 5'-nucleotidase OS=Bos ta yes N/A 0.858 0.221 0.469 1e-22
Q9XZ43 572 Protein 5NUC OS=Lutzomyia N/A N/A 0.979 0.253 0.353 2e-22
E0D877 564 Apyrase OS=Aedes albopict N/A N/A 0.898 0.235 0.374 3e-22
P50635 562 Apyrase OS=Aedes aegypti N/A N/A 0.898 0.236 0.352 8e-22
P29240 577 5'-nucleotidase OS=Diplob N/A N/A 0.804 0.206 0.479 4e-20
>sp|P52307|5NTD_BOOMI Protein 5NUC (Fragment) OS=Boophilus microplus PE=1 SV=2 Back     alignment and function desciption
 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 91/150 (60%), Gaps = 4/150 (2%)

Query: 2   IASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGH 61
           ++S G +R  DE   + +EA RL RE+ V ++IA+ H+GV  D  + +    VS+VVGGH
Sbjct: 176 LSSPGKVRFTDEAECIQREAQRLRREEGVQVIIAVGHSGVPRDLEICERVPEVSLVVGGH 235

Query: 62  SHTFLYSGKPP---CPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKG 118
           +HTFLYSG         DKP+GPYPIVV  + D+R  LVVQ     +Y+G I + +N +G
Sbjct: 236 THTFLYSGPTENGRVSGDKPQGPYPIVVDRAADSR-CLVVQDFYMGKYMGNISITWNQRG 294

Query: 119 NIVSWRGDPILLDKHIQEGNIVVLFAKRFR 148
            +V W G P+LLD+ I E    +    R+R
Sbjct: 295 EVVRWSGQPVLLDRSIPEDPDGIALLDRYR 324
Degradation of external UDP-glucose to uridine monophosphate and glucose-1-phosphate, which can then be used by the cell.
Boophilus microplus (taxid: 6941)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 5
>sp|Q61503|5NTD_MOUSE 5'-nucleotidase OS=Mus musculus GN=Nt5e PE=1 SV=2 Back     alignment and function description
>sp|B3A0N5|APY_TABYA Apyrase OS=Tabanus yao PE=1 SV=1 Back     alignment and function description
>sp|P21588|5NTD_RAT 5'-nucleotidase OS=Rattus norvegicus GN=Nt5e PE=1 SV=1 Back     alignment and function description
>sp|P21589|5NTD_HUMAN 5'-nucleotidase OS=Homo sapiens GN=NT5E PE=1 SV=1 Back     alignment and function description
>sp|Q05927|5NTD_BOVIN 5'-nucleotidase OS=Bos taurus GN=NT5E PE=1 SV=2 Back     alignment and function description
>sp|Q9XZ43|5NTD_LUTLO Protein 5NUC OS=Lutzomyia longipalpis GN=5NUC PE=1 SV=1 Back     alignment and function description
>sp|E0D877|APY_AEDAL Apyrase OS=Aedes albopictus PE=1 SV=1 Back     alignment and function description
>sp|P50635|APY_AEDAE Apyrase OS=Aedes aegypti GN=APY PE=1 SV=2 Back     alignment and function description
>sp|P29240|5NTD_DIPOM 5'-nucleotidase OS=Diplobatis ommata PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
307183761 537 5'-nucleotidase [Camponotus floridanus] 0.898 0.247 0.511 6e-34
91076716 556 PREDICTED: similar to chrysoptin [Tribol 0.932 0.248 0.510 3e-33
380021930 550 PREDICTED: apyrase-like [Apis florea] 0.898 0.241 0.503 4e-32
332022518 533 5'-nucleotidase [Acromyrmex echinatior] 0.898 0.249 0.488 5e-32
197116371 567 apyrase precursor [Apis mellifera] gi|19 0.898 0.234 0.503 1e-31
307202232 589 Apyrase [Harpegnathos saltator] 0.898 0.225 0.481 2e-31
383854911 542 PREDICTED: apyrase-like [Megachile rotun 0.898 0.245 0.488 5e-31
322794101 555 hypothetical protein SINV_01916 [Solenop 0.898 0.239 0.474 6e-31
350424951 545 PREDICTED: protein 5NUC-like [Bombus imp 0.891 0.242 0.492 4e-30
190702509 552 5' nucleotidase, putative [Glyptapantele 0.898 0.240 0.466 6e-30
>gi|307183761|gb|EFN70435.1| 5'-nucleotidase [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 99/135 (73%), Gaps = 2/135 (1%)

Query: 2   IASTGNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGH 61
           IASTG L+ LDE+ +VN EA RL ++  VDI+I LSH G+D+D+ +A     + ++VGGH
Sbjct: 190 IASTGKLKFLDEVETVNDEAQRL-KKKGVDIIIVLSHCGLDIDRIMAAKCPLIDVIVGGH 248

Query: 62  SHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIV 121
           SHTFLY+G PP   D P+  YP+VVT +  NR VL+VQAAA+++YLG + + ++D+G +V
Sbjct: 249 SHTFLYTGPPPFI-DTPEDEYPVVVTQNETNRTVLIVQAAAFTKYLGNLTVWFDDQGEVV 307

Query: 122 SWRGDPILLDKHIQE 136
            W G+P+LLD+ I E
Sbjct: 308 DWDGNPLLLDESIPE 322

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91076716|ref|XP_972463.1| PREDICTED: similar to chrysoptin [Tribolium castaneum] gi|270001896|gb|EEZ98343.1| hypothetical protein TcasGA2_TC000798 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380021930|ref|XP_003694809.1| PREDICTED: apyrase-like [Apis florea] Back     alignment and taxonomy information
>gi|332022518|gb|EGI62821.1| 5'-nucleotidase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|197116371|ref|NP_001127699.1| apyrase precursor [Apis mellifera] gi|194718514|gb|ACF93470.1| apyrase [Apis mellifera] Back     alignment and taxonomy information
>gi|307202232|gb|EFN81716.1| Apyrase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383854911|ref|XP_003702963.1| PREDICTED: apyrase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322794101|gb|EFZ17310.1| hypothetical protein SINV_01916 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350424951|ref|XP_003493965.1| PREDICTED: protein 5NUC-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|190702509|gb|ACE75394.1| 5' nucleotidase, putative [Glyptapanteles indiensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
UNIPROTKB|F1PY94 467 NT5E "Uncharacterized protein" 0.858 0.271 0.469 2.2e-26
UNIPROTKB|Q05927 574 NT5E "5'-nucleotidase" [Bos ta 0.858 0.221 0.469 4.6e-26
FB|FBgn0259101 558 CG42249 [Drosophila melanogast 0.932 0.247 0.401 7e-26
UNIPROTKB|P21589 574 NT5E "5'-nucleotidase" [Homo s 0.858 0.221 0.453 7.7e-26
MGI|MGI:99782 576 Nt5e "5' nucleotidase, ecto" [ 0.858 0.220 0.461 1e-25
RGD|61956 576 Nt5e "5' nucleotidase, ecto" [ 0.858 0.220 0.453 1e-25
UNIPROTKB|Q66HL0 576 Nt5e "5' nucleotidase, ecto, i 0.858 0.220 0.453 1e-25
UNIPROTKB|K7GSR6 574 LOC100157995 "Uncharacterized 0.858 0.221 0.446 2.1e-25
FB|FBgn0050103 588 CG30103 [Drosophila melanogast 0.898 0.226 0.441 1e-24
ZFIN|ZDB-GENE-040426-1261 581 nt5e "5'-nucleotidase, ecto (C 0.851 0.216 0.426 1.6e-23
UNIPROTKB|F1PY94 NT5E "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 300 (110.7 bits), Expect = 2.2e-26, P = 2.2e-26
 Identities = 61/130 (46%), Positives = 91/130 (70%)

Query:     7 NLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFL 66
             NL   DEIT++  E D+L +   V+ +IAL H+G ++D+ +A+  K V IVVGGHS+TFL
Sbjct:    83 NLVFEDEITALQPEVDKL-KTLNVNKIIALGHSGFEMDKLIAQKVKGVDIVVGGHSNTFL 141

Query:    67 YSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGD 126
             Y+G PP   + P G YP +VTS  D R+V VVQA A+ +YLG + +++++KGN+++  G+
Sbjct:   142 YTGTPPSK-EVPAGKYPFIVTSD-DGRKVPVVQAYAFGKYLGYLKVEFDEKGNVIASHGN 199

Query:   127 PILLDKHIQE 136
             PILL+  I E
Sbjct:   200 PILLNSSILE 209
GO:0050728 "negative regulation of inflammatory response" evidence=IEA
GO:0046086 "adenosine biosynthetic process" evidence=IEA
GO:0008253 "5'-nucleotidase activity" evidence=IEA
GO:0006196 "AMP catabolic process" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|Q05927 NT5E "5'-nucleotidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0259101 CG42249 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P21589 NT5E "5'-nucleotidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99782 Nt5e "5' nucleotidase, ecto" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61956 Nt5e "5' nucleotidase, ecto" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q66HL0 Nt5e "5' nucleotidase, ecto, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|K7GSR6 LOC100157995 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0050103 CG30103 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1261 nt5e "5'-nucleotidase, ecto (CD73)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd07409281 cd07409, MPP_CD73_N, CD73 ecto-5'-nucleotidase and 2e-50
cd00845252 cd00845, MPP_UshA_N_like, Escherichia coli UshA-li 1e-15
COG0737 517 COG0737, UshA, 5'-nucleotidase/2',3'-cyclic phosph 2e-14
cd08162313 cd08162, MPP_PhoA_N, Synechococcus sp 1e-11
cd07412288 cd07412, MPP_YhcR_N, Bacillus subtilis YhcR endonu 8e-11
PRK09419 1163 PRK09419, PRK09419, bifunctional 2',3'-cyclic nucl 3e-09
cd07411264 cd07411, MPP_SoxB_N, Thermus thermophilus SoxB and 8e-09
cd07410277 cd07410, MPP_CpdB_N, Escherichia coli CpdB and rel 1e-07
cd07408257 cd07408, MPP_SA0022_N, Staphylococcus aureus SA002 3e-07
cd07406257 cd07406, MPP_CG11883_N, Drosophila melanogaster CG 2e-06
PRK09558 551 PRK09558, ushA, bifunctional UDP-sugar hydrolase/5 3e-06
TIGR01530 545 TIGR01530, nadN, NAD pyrophosphatase/5'-nucleotida 4e-06
cd07405285 cd07405, MPP_UshA_N, Escherichia coli UshA and rel 5e-05
PRK09419 1163 PRK09419, PRK09419, bifunctional 2',3'-cyclic nucl 3e-04
>gnl|CDD|163652 cd07409, MPP_CD73_N, CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information 
 Score =  161 bits (411), Expect = 2e-50
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 4/130 (3%)

Query: 2   IASTG-NLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGG 60
           ++S G  ++ LDEI +  KEAD+L +   V+ +IALSH+G ++D+ +A+    V ++VGG
Sbjct: 155 LSSPGGKVKFLDEIEAAQKEADKL-KAQGVNKIIALSHSGYEVDKEIARKVPGVDVIVGG 213

Query: 61  HSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNI 120
           HSHTFLY+G PP   +KP GPYP VV ++ D R+VLVVQA AY +YLG + + ++D GN+
Sbjct: 214 HSHTFLYTGPPPSG-EKPVGPYPTVVKNA-DGRKVLVVQAYAYGKYLGYLDVTFDDNGNV 271

Query: 121 VSWRGDPILL 130
            SW G+PILL
Sbjct: 272 TSWEGNPILL 281

CD73 is a mammalian ecto-5'-nucleotidase expressed in endothelial cells and lymphocytes that catalyzes the conversion of 5'-AMP to adenosine in the final step of a pathway that generates adenosine from ATP. This pathway also includes a CD39 nucleoside triphosphate dephosphorylase that mediates the dephosphorylation of ATP to ADP and then to 5'-AMP. These enzymes all have an N-terminal metallophosphatase domain and a C-terminal 5'nucleotidase domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 281
>gnl|CDD|163620 cd00845, MPP_UshA_N_like, Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|223808 COG0737, UshA, 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|163669 cd08162, MPP_PhoA_N, Synechococcus sp Back     alignment and domain information
>gnl|CDD|163655 cd07412, MPP_YhcR_N, Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|236505 PRK09419, PRK09419, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>gnl|CDD|163654 cd07411, MPP_SoxB_N, Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163653 cd07410, MPP_CpdB_N, Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163651 cd07408, MPP_SA0022_N, Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163649 cd07406, MPP_CG11883_N, Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|236566 PRK09558, ushA, bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>gnl|CDD|211667 TIGR01530, nadN, NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>gnl|CDD|163648 cd07405, MPP_UshA_N, Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|236505 PRK09419, PRK09419, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 99.96
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 99.95
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 99.94
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 99.93
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 99.93
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 99.92
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 99.92
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 99.92
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 99.91
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 99.91
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 99.9
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 99.89
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 99.89
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 99.89
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 99.88
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 99.88
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 99.87
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 99.84
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 99.77
KOG4419|consensus 602 99.52
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 99.42
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 99.18
cd07381239 MPP_CapA CapA and related proteins, metallophospha 99.09
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 98.6
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 98.37
COG2843372 PgsA Putative enzyme of poly-gamma-glutamate biosy 97.33
COG0622172 Predicted phosphoesterase [General function predic 96.81
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 96.68
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 96.33
PRK09453182 phosphodiesterase; Provisional 96.04
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 96.02
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 95.99
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 95.46
PF13277253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 94.99
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 94.48
PRK09968218 serine/threonine-specific protein phosphatase 2; P 94.25
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 94.09
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 93.95
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 93.82
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 93.6
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 93.51
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 93.05
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 93.03
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 92.49
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 92.28
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 92.07
COG1692266 Calcineurin-like phosphoesterase [General function 91.93
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 91.9
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 91.68
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 91.31
PRK11340271 phosphodiesterase YaeI; Provisional 91.13
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 90.78
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 90.14
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 89.56
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 89.2
PLN02533427 probable purple acid phosphatase 88.9
TIGR00282 266 metallophosphoesterase, MG_246/BB_0505 family. A m 88.7
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 88.47
COG1408284 Predicted phosphohydrolases [General function pred 88.32
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 87.52
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 86.74
KOG3325|consensus183 86.5
cd00838131 MPP_superfamily metallophosphatase superfamily, me 85.78
PTZ00422394 glideosome-associated protein 50; Provisional 85.49
COG0621 437 MiaB 2-methylthioadenine synthetase [Translation, 84.3
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 83.92
PRK14327 509 (dimethylallyl)adenosine tRNA methylthiotransferas 83.91
PF13277 253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 83.48
PF0091998 UPF0004: Uncharacterized protein family UPF0004; I 83.33
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 81.8
PF1370497 Glyco_tranf_2_4: Glycosyl transferase family 2 81.03
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information 
Probab=99.96  E-value=8e-28  Score=189.96  Aligned_cols=121  Identities=52%  Similarity=0.997  Sum_probs=106.6

Q ss_pred             CCeEEechHHHHHHHHHHHhhcCCCCEEEEEeCCCchhhHHHHhhCCCccEEEeCCccceecCCCCCCCCCCCCCCCCEE
Q psy11241          6 GNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPYPIV   85 (148)
Q Consensus         6 ~~v~f~d~~~~~~~~v~~lr~~~g~D~iI~lsH~g~~~d~~la~~~~~iDvIlgGH~H~~~~~~~~~~~~~~~~~~~p~~   85 (148)
                      +++.|.|+++++++++++||++ |||+||+|+|+|.+.+++||+++++||+|||||+|..+..+..| -++..+++||..
T Consensus       160 ~~~~~~d~~~~~~~~v~~lr~~-~~D~II~l~H~G~~~d~~la~~~~giD~IiggH~H~~~~~~~~~-~~~~~~~~~p~~  237 (281)
T cd07409         160 GKVKFLDEIEAAQKEADKLKAQ-GVNKIIALSHSGYEVDKEIARKVPGVDVIVGGHSHTFLYTGPPP-SGEKPVGPYPTV  237 (281)
T ss_pred             CceEECCHHHHHHHHHHHHHhc-CCCEEEEEeccCchhHHHHHHcCCCCcEEEeCCcCccccCCCCC-cCcccCCCCCEE
Confidence            6899999999999999999998 89999999999999999999999999999999999998643322 123456788988


Q ss_pred             EecCCCCceEEEEecCccccceeEEEEEEecCCCEEEEeceEEe
Q psy11241         86 VTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPIL  129 (148)
Q Consensus        86 v~~~~~g~~~~vvq~g~~g~~lg~l~l~~~~~g~v~~~~~~~i~  129 (148)
                      +.+ ++|++|+++|+|++|++||+++|+|+++|+++.+++++++
T Consensus       238 ~~~-~~~~~~~ivq~g~~g~~~g~i~l~~~~~~~~~~~~~~~~~  280 (281)
T cd07409         238 VKN-ADGRKVLVVQAYAYGKYLGYLDVTFDDNGNVTSWEGNPIL  280 (281)
T ss_pred             eeC-CCCCEEEEEeCChHHheEEEEEEEEcCCCCEEEeeCEEEe
Confidence            855 7888999999999999999999999988999888877664

CD73 is a mammalian ecto-5'-nucleotidase expressed in endothelial cells and lymphocytes that catalyzes the conversion of 5'-AMP to adenosine in the final step of a pathway that generates adenosine from ATP. This pathway also includes a CD39 nucleoside triphosphate dephosphorylase that mediates the dephosphorylation of ATP to ADP and then to 5'-AMP. These enzymes all have an N-terminal metallophosphatase domain and a C-terminal 5'nucleotidase domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active si
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG4419|consensus Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>COG2843 PgsA Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3325|consensus Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PF00919 UPF0004: Uncharacterized protein family UPF0004; InterPro: IPR013848 The methylthiotransferase (MTTase) or miaB-like family is named after the (dimethylallyl)adenosine tRNA MTTase miaB protein, which catalyses a C-H to C-S bond conversion in the methylthiolation of tRNA Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
4h2b_A 547 Human Ecto-5'-Nucleotidase (Cd73): Crystal Form Ii 2e-24
4h1y_P 546 Human Ecto-5'-Nucleotidase (Cd73): Crystal Form Ii 3e-24
4h2f_A 546 Human Ecto-5'-Nucleotidase (Cd73): Crystal Form I ( 3e-24
4h2i_A 532 Human Ecto-5'-Nucleotidase (Cd73): Crystal Form Iii 3e-24
4h1s_A 530 Crystal Structure Of A Truncated Soluble Form Of Hu 7e-24
2z1a_A 552 Crystal Structure Of 5'-Nucleotidase Precursor From 4e-14
>pdb|4H2B|A Chain A, Human Ecto-5'-Nucleotidase (Cd73): Crystal Form Ii (Open) In Complex With Baicalin Length = 547 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
Query: 7   NLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFL 66
           NL   DEIT++  E D+L +   V+ +IAL H+G ++D+ +A+  + V +VVGGHS+TFL
Sbjct: 188 NLVFEDEITALQPEVDKL-KTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFL 246
Query: 67  YSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGD 126
           Y+G PP   + P G YP +VTS  D R+V VVQA A+ +YLG + ++++++GN++S  G+
Sbjct: 247 YTGNPPS-KEVPAGKYPFIVTSD-DGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGN 304
Query: 127 PILLDKHIQE 136
           PILLD  I E
Sbjct: 305 PILLDSSIPE 314
>pdb|4H1Y|P Chain P, Human Ecto-5'-Nucleotidase (Cd73): Crystal Form Ii (Open) In Complex With Psb11552 Length = 546 Back     alignment and structure
>pdb|4H2F|A Chain A, Human Ecto-5'-Nucleotidase (Cd73): Crystal Form I (Open) In Complex With Adenosine Length = 546 Back     alignment and structure
>pdb|4H2I|A Chain A, Human Ecto-5'-Nucleotidase (Cd73): Crystal Form Iii (Closed) In Complex With Ampcp Length = 532 Back     alignment and structure
>pdb|4H1S|A Chain A, Crystal Structure Of A Truncated Soluble Form Of Human Cd73 With Ecto- 5'-Nucleotidase Activity Length = 530 Back     alignment and structure
>pdb|2Z1A|A Chain A, Crystal Structure Of 5'-Nucleotidase Precursor From Thermus Thermophilus Hb8 Length = 552 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 6e-40
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 1e-36
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 1e-31
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 5e-25
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 2e-24
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 4e-22
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 1e-16
3qfk_A 527 Uncharacterized protein; structural genomics, cent 1e-16
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 2e-06
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Length = 552 Back     alignment and structure
 Score =  139 bits (352), Expect = 6e-40
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 5/133 (3%)

Query: 1   NIASTG-NLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVG 59
            I++ G  +  LD   S  K    L     V+ ++ LSH G   D  +A+    V ++VG
Sbjct: 178 EISNPGPTVAFLDPYESAQKAVYEL-LAKGVNKIVVLSHLGYGEDLKLARRLVGVQVIVG 236

Query: 60  GHSHTFLYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGN 119
           GHSHT L S         P GPYP VV +  + + VLVVQA  + + +GL+ + ++ KG 
Sbjct: 237 GHSHTLLGSFPH--KELSPAGPYPTVVKNP-EGKDVLVVQAWEWGKVVGLLEVTFDAKGE 293

Query: 120 IVSWRGDPILLDK 132
           +++++G+ +L+  
Sbjct: 294 LLAYKGEALLMTP 306
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Length = 579 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Length = 516 Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Length = 341 Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Length = 509 Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Length = 339 Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Length = 562 Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Length = 527 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Length = 557 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 99.97
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 99.97
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 99.96
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 99.95
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 99.95
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 99.95
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 99.92
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 99.91
3qfk_A 527 Uncharacterized protein; structural genomics, cent 99.89
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 99.89
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 99.82
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 99.37
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 99.33
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 99.32
2xmo_A443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 97.21
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 96.77
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 96.14
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 96.03
3ck2_A176 Conserved uncharacterized protein (predicted phosp 95.82
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 95.78
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 95.7
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 95.24
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 95.15
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 94.83
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 94.69
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 94.38
1ute_A313 Protein (II purple acid phosphatase); tartrate res 94.03
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 93.81
2q8u_A336 Exonuclease, putative; structural genomics, joint 93.81
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 93.65
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 93.53
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 93.47
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 93.34
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 92.08
3av0_A386 DNA double-strand break repair protein MRE11; DNA 91.44
3t1i_A431 Double-strand break repair protein MRE11A; DNA rep 90.41
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 89.99
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 87.66
3tho_B379 Exonuclease, putative; adenosine triphosphate, bac 87.47
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 85.43
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 84.17
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
Probab=99.97  E-value=5.5e-30  Score=216.76  Aligned_cols=143  Identities=43%  Similarity=0.801  Sum_probs=128.7

Q ss_pred             CCCC-CeEEechHHHHHHHHHHHhhcCCCCEEEEEeCCCchhhHHHHhhCCCccEEEeCCccceecCCCCCCCCCCCCCC
Q psy11241          3 ASTG-NLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGP   81 (148)
Q Consensus         3 s~~~-~v~f~d~~~~~~~~v~~lr~~~g~D~iI~lsH~g~~~d~~la~~~~~iDvIlgGH~H~~~~~~~~~~~~~~~~~~   81 (148)
                      ++|+ ++.|.|+++++++++++||++ |||+||+|+|+|++.|++||+++++||+|||||+|..+.++..|. ++...++
T Consensus       182 ~~~~~~~~~~d~~~~~~~~v~~l~~~-g~D~iI~l~H~g~~~d~~la~~~~giDlIlgGHtH~~~~~g~~~~-~~~~~g~  259 (546)
T 4h2g_A          182 SNPGTNLVFEDEITALQPEVDKLKTL-NVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPS-KEVPAGK  259 (546)
T ss_dssp             SCCCSSEEECCHHHHHHHHHHHHHHT-TCCCEEEEEESCHHHHHHHHHHSTTCCEEECCSSCCCCCSSSCSS-SCCCSSC
T ss_pred             cCCCCCcEEccHHHHHHHHHHHHHhc-CCCEEEEEeccCccchHHHHHhCCCCcEEEeCCcCcccccCCCCc-ccccCCC
Confidence            4566 999999999999999999998 899999999999999999999999999999999999986554333 3556789


Q ss_pred             CCEEEecCCCCceEEEEecCccccceeEEEEEEecCCCEEEEeceEEecCCCCCCCHHHHHHhHhhC
Q psy11241         82 YPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDKHIQEGNIVVLFAKRFR  148 (148)
Q Consensus        82 ~p~~v~~~~~g~~~~vvq~g~~g~~lg~l~l~~~~~g~v~~~~~~~i~~~~~~~~D~~i~~~v~~~~  148 (148)
                      ||.++.+ ++|++++|+|+|+||++||+++|+|+++|+++.+++.++.++..+++||++++++++|+
T Consensus       260 yp~~v~~-~~G~~~~ivqag~~g~~lg~i~l~~d~~g~~~~~~~~~i~~~~~~~~d~~v~~~v~~~~  325 (546)
T 4h2g_A          260 YPFIVTS-DDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLDSSIPEDPSIKADINKWR  325 (546)
T ss_dssp             SSEEEEC-TTSCEEEEECCCSTTSEEEEEEEEECTTSCEEEEEECCEECCTTSCCCHHHHHHHHHHH
T ss_pred             cceEEec-CCCCEEEEEecChhhcEEEEEEEEEecCCcEEEEeeeEEEcCCCCCCCHHHHHHHHHHH
Confidence            9998877 88999999999999999999999999889988888888888888999999999999884
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d2z1aa2302 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sug 3e-20
d1usha2337 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sug 2e-16
d3c9fa2322 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sug 7e-08
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain
domain: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain
species: Thermus thermophilus [TaxId: 274]

 Score = 82.3 bits (202), Expect = 3e-20
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 4/126 (3%)

Query: 6   GNLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTF 65
             +  LD   S  K    L     V+ ++ LSH G   D  +A+    V ++VGGHSHT 
Sbjct: 157 PTVAFLDPYESAQKAVYEL-LAKGVNKIVVLSHLGYGEDLKLARRLVGVQVIVGGHSHTL 215

Query: 66  LYSGKPPCPHDKPKGPYPIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRG 125
           L  G  P     P GPYP VV +  + + VLVVQA  + + +GL+ + ++ KG +++++G
Sbjct: 216 L--GSFPHKELSPAGPYPTVVKNP-EGKDVLVVQAWEWGKVVGLLEVTFDAKGELLAYKG 272

Query: 126 DPILLD 131
           + +L+ 
Sbjct: 273 EALLMT 278
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 337 Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Length = 322 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 99.97
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 99.92
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 99.68
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 96.99
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 96.37
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 96.14
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 95.98
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 95.9
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 95.69
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 95.54
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 94.6
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 93.9
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 93.66
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 92.95
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilu 91.09
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 90.94
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 90.65
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodura 89.42
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 87.59
d1t71a_ 281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 83.85
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain
domain: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=99.97  E-value=1.7e-29  Score=198.02  Aligned_cols=141  Identities=31%  Similarity=0.547  Sum_probs=124.5

Q ss_pred             CCC-CeEEechHHHHHHHHHHHhhcCCCCEEEEEeCCCchhhHHHHhhCCCccEEEeCCccceecCCCCCCCCCCCCCCC
Q psy11241          4 STG-NLRILDEITSVNKEADRLVREDKVDIVIALSHAGVDLDQTVAKASKHVSIVVGGHSHTFLYSGKPPCPHDKPKGPY   82 (148)
Q Consensus         4 ~~~-~v~f~d~~~~~~~~v~~lr~~~g~D~iI~lsH~g~~~d~~la~~~~~iDvIlgGH~H~~~~~~~~~~~~~~~~~~~   82 (148)
                      +|+ .+.|.|+++++++++++||++ |||+||+|+|+|+++|..||+++++||+|++||+|..+..  .+.......++|
T Consensus       154 ~~~~~~~~~d~~~~~~~~~~~l~~~-~~DiiV~l~H~g~~~d~~la~~~~giD~ii~gh~h~~~~~--~~~~~~~~~~~~  230 (302)
T d2z1aa2         154 NPGPTVAFLDPYESAQKAVYELLAK-GVNKIVVLSHLGYGEDLKLARRLVGVQVIVGGHSHTLLGS--FPHKELSPAGPY  230 (302)
T ss_dssp             CCCTTCEECCHHHHHHHHHHHHHHT-TCCCEEEEEESCHHHHHHHHTTCSSCCEEEECSSCCCBSC--CSCTTCCCSBCS
T ss_pred             cccCcccccCHHHHHHHHHHHhhcc-CCCEEEEeeccCcchhhHHHhcCCCeeeeecCccceeecc--CCcccccccCCC
Confidence            344 789999999999999999987 8999999999999999999999999999999999998843  122234556788


Q ss_pred             CEEEecCCCCceEEEEecCccccceeEEEEEEecCCCEEEEeceEEecCC-CCCCCHHHHHHhHhhC
Q psy11241         83 PIVVTSSVDNRQVLVVQAAAYSRYLGLIHLQYNDKGNIVSWRGDPILLDK-HIQEGNIVVLFAKRFR  148 (148)
Q Consensus        83 p~~v~~~~~g~~~~vvq~g~~g~~lg~l~l~~~~~g~v~~~~~~~i~~~~-~~~~D~~i~~~v~~~~  148 (148)
                      |..+.| ++|++++|+|+|++|++||+++|+|+++|+++.+++++++++. ..++|+++++++++|+
T Consensus       231 ~~~~~~-~~g~~v~ivqag~~g~~lg~i~l~~d~~g~v~~~~~~~~~~~~~~~~~D~~~~~~v~~~~  296 (302)
T d2z1aa2         231 PTVVKN-PEGKDVLVVQAWEWGKVVGLLEVTFDAKGELLAYKGEALLMTPEAAPEDFFAKEALLAYA  296 (302)
T ss_dssp             SEEEEC-TTSCEEEEEECCSTTSEEEEEEEEECTTSCEEEEEEEEEECSTTTCCCCHHHHHHHHHHH
T ss_pred             CeEeeC-CCCCEEEEEeCChHhcEEEEEEEEEeCCCcEEEEEeEEEEcCcccCCCCHHHHHHHHHHH
Confidence            988877 8899999999999999999999999988999999999888864 4788999999999885
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure