Psyllid ID: psy11270

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRYHTTWC
ccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccc
HHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHcHcccccc
MKGDYYRYLAEVAtgdtrnavvEDSQKAYQEAFDIakskmqpthpirlglaLNFSVFYYEIINSPARACHLAKQVQYscigasrvqilsvpryhttwc
MKGDYYRYLAEvatgdtrnavvEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRYHTTWC
MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRYHTTWC
****YYRYLAEVATGDTRNAVV******YQEAFDIAK***QPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRYHTTW*
MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVP*Y*****
MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRYHTTWC
*KGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRY***WC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCIGASRVQILSVPRYHTTWC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
P29310248 14-3-3 protein zeta OS=Dr yes N/A 0.755 0.298 0.851 7e-34
Q2F637247 14-3-3 protein zeta OS=Bo N/A N/A 0.755 0.299 0.851 9e-34
Q1HR36248 14-3-3 protein zeta OS=Ae N/A N/A 0.755 0.298 0.837 3e-33
Q20655248 14-3-3-like protein 2 OS= no N/A 0.755 0.298 0.824 3e-33
Q26537214 14-3-3 protein homolog 2 N/A N/A 0.755 0.345 0.824 5e-33
Q6UFZ9244 14-3-3 protein beta/alpha N/A N/A 0.744 0.299 0.780 8e-31
Q7T356242 14-3-3 protein beta/alpha no N/A 0.744 0.301 0.780 1e-30
Q5ZKC9245 14-3-3 protein zeta OS=Ga yes N/A 0.744 0.297 0.780 1e-30
P41932248 14-3-3-like protein 1 OS= no N/A 0.744 0.294 0.837 1e-30
Q5R651245 14-3-3 protein zeta/delta yes N/A 0.744 0.297 0.767 4e-30
>sp|P29310|1433Z_DROME 14-3-3 protein zeta OS=Drosophila melanogaster GN=14-3-3zeta PE=1 SV=1 Back     alignment and function desciption
 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (91%)

Query: 1   MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
           MKGDYYRYLAEVATGD RN VV+DSQ AYQ+AFDI+K KMQPTHPIRLGLALNFSVFYYE
Sbjct: 124 MKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYE 183

Query: 61  IINSPARACHLAKQ 74
           I+NSP +AC LAKQ
Sbjct: 184 ILNSPDKACQLAKQ 197
Required in Raf-dependent cell proliferation and photoreceptor differentiation during eye development. Acts upstream of Raf and downstream of Ras, and is essential for viability. Acts as a negative regulator by decreasing its voltage sensitivity. Inhibits yki activity by restricting its nuclear localization.
Drosophila melanogaster (taxid: 7227)
>sp|Q2F637|1433Z_BOMMO 14-3-3 protein zeta OS=Bombyx mori GN=14-3-3zeta PE=2 SV=2 Back     alignment and function description
>sp|Q1HR36|1433Z_AEDAE 14-3-3 protein zeta OS=Aedes aegypti GN=14-3-3zeta PE=2 SV=1 Back     alignment and function description
>sp|Q20655|14332_CAEEL 14-3-3-like protein 2 OS=Caenorhabditis elegans GN=ftt-2 PE=1 SV=1 Back     alignment and function description
>sp|Q26537|14332_SCHMA 14-3-3 protein homolog 2 (Fragment) OS=Schistosoma mansoni PE=2 SV=1 Back     alignment and function description
>sp|Q6UFZ9|143B1_ONCMY 14-3-3 protein beta/alpha-1 OS=Oncorhynchus mykiss PE=2 SV=1 Back     alignment and function description
>sp|Q7T356|143BB_DANRE 14-3-3 protein beta/alpha-B OS=Danio rerio GN=ywhabb PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKC9|1433Z_CHICK 14-3-3 protein zeta OS=Gallus gallus GN=YWHAZ PE=2 SV=1 Back     alignment and function description
>sp|P41932|14331_CAEEL 14-3-3-like protein 1 OS=Caenorhabditis elegans GN=par-5 PE=1 SV=2 Back     alignment and function description
>sp|Q5R651|1433Z_PONAB 14-3-3 protein zeta/delta OS=Pongo abelii GN=YWHAZ PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
365266873 247 14-3-3 zeta [Megachile rotundata] 0.755 0.299 0.986 2e-37
365266852 247 14-3-3 zeta [Bombus terrestris] gi|36526 0.755 0.299 0.986 2e-37
365266882 247 14-3-3 zeta [Atta cephalotes] 0.755 0.299 0.959 2e-36
365266863 247 14-3-3 zeta [Acromyrmex echinatior] 0.755 0.299 0.959 2e-36
308220204 248 14-3-3 zeta [Culex pipiens] 0.755 0.298 0.959 2e-36
365266879 247 14-3-3 zeta [Harpegnathos saltator] 0.755 0.299 0.959 2e-36
31562376497 14-3-3 zeta, partial [Apis cerana] 0.755 0.762 0.986 2e-36
365266848 247 14-3-3 zeta [Camponotus floridanus] 0.755 0.299 0.959 2e-36
365266876 247 14-3-3 zeta [Linepithema humile] 0.755 0.299 0.945 4e-36
25013056 248 RH61958p [Drosophila melanogaster] 0.755 0.298 0.945 5e-36
>gi|365266873|gb|AEW70349.1| 14-3-3 zeta [Megachile rotundata] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/74 (98%), Positives = 74/74 (100%)

Query: 1   MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
           MKGDYYRYLAEVATG+TRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE
Sbjct: 123 MKGDYYRYLAEVATGETRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 182

Query: 61  IINSPARACHLAKQ 74
           IINSPARACHLAKQ
Sbjct: 183 IINSPARACHLAKQ 196

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|365266852|gb|AEW70334.1| 14-3-3 zeta [Bombus terrestris] gi|365266856|gb|AEW70337.1| 14-3-3 zeta [Bombus impatiens] gi|365266860|gb|AEW70340.1| 14-3-3 zeta [Apis florea] Back     alignment and taxonomy information
>gi|365266882|gb|AEW70355.1| 14-3-3 zeta [Atta cephalotes] Back     alignment and taxonomy information
>gi|365266863|gb|AEW70342.1| 14-3-3 zeta [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|308220204|gb|ADO22677.1| 14-3-3 zeta [Culex pipiens] Back     alignment and taxonomy information
>gi|365266879|gb|AEW70353.1| 14-3-3 zeta [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|315623764|gb|ADU53533.1| 14-3-3 zeta, partial [Apis cerana] Back     alignment and taxonomy information
>gi|365266848|gb|AEW70331.1| 14-3-3 zeta [Camponotus floridanus] Back     alignment and taxonomy information
>gi|365266876|gb|AEW70351.1| 14-3-3 zeta [Linepithema humile] Back     alignment and taxonomy information
>gi|25013056|gb|AAN71617.1| RH61958p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
FB|FBgn0004907248 14-3-3zeta "14-3-3zeta" [Droso 0.755 0.298 0.851 1.4e-30
WB|WBGene00001502248 ftt-2 [Caenorhabditis elegans 0.755 0.298 0.824 1.6e-29
UNIPROTKB|Q20655248 ftt-2 "14-3-3-like protein 2" 0.755 0.298 0.824 1.6e-29
ZFIN|ZDB-GENE-030131-7135245 ywhaqb "tyrosine 3-monooxygena 0.755 0.302 0.770 8.2e-28
UNIPROTKB|F1NPX9210 YWHAZ "14-3-3 protein zeta" [G 0.744 0.347 0.780 1e-27
UNIPROTKB|Q5ZKC9245 YWHAZ "14-3-3 protein zeta" [G 0.744 0.297 0.780 1e-27
WB|WBGene00003920248 par-5 [Caenorhabditis elegans 0.744 0.294 0.837 1e-27
UNIPROTKB|P41932248 par-5 "14-3-3-like protein 1" 0.744 0.294 0.837 1e-27
ZFIN|ZDB-GENE-040426-2160242 ywhabb "tyrosine 3-monooxygena 0.744 0.301 0.780 1.7e-27
UNIPROTKB|P63103245 YWHAZ "14-3-3 protein zeta/del 0.744 0.297 0.767 2.2e-27
FB|FBgn0004907 14-3-3zeta "14-3-3zeta" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 63/74 (85%), Positives = 68/74 (91%)

Query:     1 MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
             MKGDYYRYLAEVATGD RN VV+DSQ AYQ+AFDI+K KMQPTHPIRLGLALNFSVFYYE
Sbjct:   124 MKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYE 183

Query:    61 IINSPARACHLAKQ 74
             I+NSP +AC LAKQ
Sbjct:   184 ILNSPDKACQLAKQ 197
GO:0007265 "Ras protein signal transduction" evidence=ISS;NAS
GO:0006588 "activation of tryptophan 5-monooxygenase activity" evidence=ISS
GO:0008426 "protein kinase C inhibitor activity" evidence=ISS;NAS
GO:0016483 "tryptophan hydroxylase activator activity" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0001751 "compound eye photoreceptor cell differentiation" evidence=NAS
GO:0008283 "cell proliferation" evidence=NAS
GO:0008355 "olfactory learning" evidence=NAS
GO:0007059 "chromosome segregation" evidence=IMP
GO:0045448 "mitotic cell cycle, embryonic" evidence=IMP
GO:0005634 "nucleus" evidence=NAS
GO:0007611 "learning or memory" evidence=NAS;IMP
GO:0045172 "germline ring canal" evidence=IDA
GO:0007294 "germarium-derived oocyte fate determination" evidence=IGI
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IGI
GO:0019904 "protein domain specific binding" evidence=IEA
GO:0050821 "protein stabilization" evidence=IMP;IDA
GO:0006457 "protein folding" evidence=IDA;IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
WB|WBGene00001502 ftt-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q20655 ftt-2 "14-3-3-like protein 2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7135 ywhaqb "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPX9 YWHAZ "14-3-3 protein zeta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKC9 YWHAZ "14-3-3 protein zeta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00003920 par-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P41932 par-5 "14-3-3-like protein 1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2160 ywhabb "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P63103 YWHAZ "14-3-3 protein zeta/delta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZKC91433Z_CHICKNo assigned EC number0.78080.74480.2979yesN/A
P293101433Z_DROMENo assigned EC number0.85130.75510.2983yesN/A
P631041433Z_HUMANNo assigned EC number0.76710.74480.2979yesN/A
P631011433Z_MOUSENo assigned EC number0.76710.74480.2979yesN/A
P631021433Z_RATNo assigned EC number0.76710.74480.2979yesN/A
P631031433Z_BOVINNo assigned EC number0.76710.74480.2979yesN/A
Q5R6511433Z_PONABNo assigned EC number0.76710.74480.2979yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
cd11310230 cd11310, 14-3-3_1, 14-3-3 protein domain 1e-47
pfam00244236 pfam00244, 14-3-3, 14-3-3 protein 3e-46
cd08774225 cd08774, 14-3-3, 14-3-3 domain 1e-44
cd10023234 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in 3e-41
cd10022229 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is 8e-41
COG5040268 COG5040, BMH1, 14-3-3 family protein [Signal trans 4e-36
cd11309231 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai 7e-36
cd10025239 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- 1e-35
cd10024246 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 3e-35
cd10019242 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 8e-35
smart00101244 smart00101, 14_3_3, 14-3-3 homologues 9e-35
cd10026237 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain 3e-33
cd10020230 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor 3e-33
>gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain Back     alignment and domain information 
 Score =  151 bits (382), Expect = 1e-47
 Identities = 67/74 (90%), Positives = 72/74 (97%)

Query: 1   MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
           MKGDYYRYLAEVATGDTRN+VVEDSQKAYQEAFDI+K+KMQPTHPIRLGLALNFSVFYYE
Sbjct: 120 MKGDYYRYLAEVATGDTRNSVVEDSQKAYQEAFDISKAKMQPTHPIRLGLALNFSVFYYE 179

Query: 61  IINSPARACHLAKQ 74
           I+NSP +AC LAKQ
Sbjct: 180 ILNSPDKACQLAKQ 193

This 14-3-3 domain family includes proteins in Caenorhabditis elegans, the silkworm (Bombyx mori) as well as barley (Hordeum vulgare). In C. elegans, 14-3-3 proteins are SIR-2.1 binding partners which induce transcriptional activation of DAF-16 during stress and are required for the life-span extension conferred by extra copies of sir-2.1. In B. mori, the 14-3-3 proteins are expressed widely in larval and adult tissues, including the brain, fat body, Malpighian tube, silk gland, midgut, testis, ovary, antenna, and pheromone gland, and interact with the N-terminal fragment of Hsp60, suggesting that 14-3-3 (a molecular adaptor) and Hsp60 (a molecular chaperone) work together to achieve a wide range of cellular functions in B. mori. In barley aleurone cells, 14-3-3 proteins and members of the ABF transcription factor family have a regulatory function in the gibberellic acid (GA) pathway since the balance of GA and abscisic acid (ABA) is a determining factor during transition of embryogenesis and seed germination. 14-3-3 is an essential part of 14-3-3 proteins, a ubiquitous class of regulatory, phosphoserine/threonine-binding proteins found in all eukaryotic cells, including yeast, protozoa and mammalian cells. Length = 230
>gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain Back     alignment and domain information
>gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain Back     alignment and domain information
>gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues Back     alignment and domain information
>gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain Back     alignment and domain information
>gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
COG5040268 BMH1 14-3-3 family protein [Signal transduction me 100.0
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 100.0
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 100.0
KOG0841|consensus247 100.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.03
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.4
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.66
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 88.19
KOG1840|consensus 508 85.21
KOG1840|consensus508 81.9
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 81.19
>COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-41  Score=252.14  Aligned_cols=91  Identities=58%  Similarity=0.966  Sum_probs=87.4

Q ss_pred             CccccchhhhcccCCcchhHHHHHHHHHHHHHHHHHHhcCCCCCcchhhhhhhHHHHHHHHhcChHHHHHHHHHHHHHHH
Q psy11270          1 MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCI   80 (98)
Q Consensus         1 mKGDyyRYlaE~~~~~~~~~~~~~a~~aY~~A~~~A~~~L~pt~PirLgL~LN~SVF~yEil~~~~~A~~iAk~Afd~Ai   80 (98)
                      ||||||||+|||..|++++++.+.++++|+.|.++|..+|||||||||||+||||||||||+|++++||.|||+|||+||
T Consensus       125 MKGDYyRYlAEf~~G~~~~e~a~~slE~YK~AseiA~teLpPT~PirLGLALNfSVFyYEIlnspdkAC~lAKqaFDeAI  204 (268)
T COG5040         125 MKGDYYRYLAEFSVGEAREEAADSSLEAYKAASEIATTELPPTHPIRLGLALNFSVFYYEILNSPDKACHLAKQAFDEAI  204 (268)
T ss_pred             ecchHHHHHHHhccchHhHHHHHhHHHHHHHHHHHhhccCCCCCchhhhheecceeeeeecccCcHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcchhccccCCcc
Q psy11270         81 GASRVQILSVPRY   93 (98)
Q Consensus        81 ~~~d~~~~~~~~~   93 (98)
                      +++|  .+|...|
T Consensus       205 ~ELD--tLSEEsY  215 (268)
T COG5040         205 SELD--TLSEESY  215 (268)
T ss_pred             HHHh--hhhhhhh
Confidence            9999  5655544

>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG0841|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
2c1j_A258 Molecular Basis For The Recognition Of Phosphorylat 3e-31
2v7d_A247 14-3-3 Protein Zeta In Complex With Thr758 Phosphor 3e-31
4fj3_A235 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla 3e-31
1a38_A245 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 3e-31
2o02_A230 Phosphorylation Independent Interactions Between 14 3e-31
3rdh_A248 X-Ray Induced Covalent Inhibition Of 14-3-3 Length 3e-31
2bq0_A245 14-3-3 Protein Beta (Human) Length = 245 2e-30
2c63_A247 14-3-3 Protein Eta (Human) Complexed To Peptide Len 5e-30
4gnt_A245 Complex Of Chrebp And 14-3-3beta Length = 245 5e-30
2btp_A256 14-3-3 Protein Theta (Human) Complexed To Peptide L 8e-30
2b05_A246 Crystal Structure Of 14-3-3 Gamma In Complex With A 3e-29
3uzd_A248 Crystal Structure Of 14-3-3 Gamma Length = 248 3e-29
4dnk_A247 Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP 9e-29
4e2e_A248 Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP 1e-27
3smo_A235 Crystal Structure Of Human 14-3-3 Sigma C38vN166H I 8e-27
3p1r_A236 Crystal Structure Of Human 14-3-3 Sigma C38vN166H I 8e-27
3p1p_A236 Crystal Structure Of Human 14-3-3 Sigma C38nN166H I 8e-27
3p1n_A235 Crystal Structure Of Human 14-3-3 Sigma In Complex 5e-26
3lw1_A253 Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid 5e-26
3u9x_A235 Covalent Attachment Of Pyridoxal-Phosphate Derivati 5e-26
3iqj_A236 Crystal Structure Of Human 14-3-3 Sigma In Complex 5e-26
3o8i_A239 Structure Of 14-3-3 Isoform Sigma In Complex With A 6e-26
3t0l_A235 Small-Molecule Inhibitors Of 14-3-3 Protein-Protein 6e-26
4hqw_A236 Molecular Tweezers Modulate 14-3-3 Protein-protein 6e-26
4dat_A234 Structure Of 14-3-3 Sigma In Complex With Padi6 14- 6e-26
1ywt_A248 Crystal Structure Of The Human Sigma Isoform Of 14- 6e-26
2br9_A234 14-3-3 Protein Epsilon (Human) Complexed To Peptide 2e-25
3ual_A232 Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti 2e-25
3ubw_A261 Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope 2e-25
3m50_A240 Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E 4e-25
2o98_A242 Structure Of The 14-3-3 H+-Atpase Plant Complex Len 4e-25
1o9c_A260 Structural View Of A Fungal Toxin Acting On A 14-3- 5e-25
3axy_C240 Structure Of Florigen Activation Complex Consisting 3e-24
4dx0_A243 Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A 4e-24
2npm_A260 Crystal Structure Of Cryptosporidium Parvum 14-3-3 1e-21
3efz_A268 Crystal Structure Of A 14-3-3 Protein From Cryptosp 9e-06
>pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 Back     alignment and structure 
Iteration: 1

 Score =  129 bits (325), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 56/73 (76%), Positives = 65/73 (89%)
Query: 1   MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
           MKGDYYRYLAEVA GD +  +V+ SQ+AYQEAF+I+K +MQPTHPIRLGLALNFSVFYYE
Sbjct: 134 MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE 193
Query: 61  IINSPARACHLAK 73
           I+NSP +AC LAK
Sbjct: 194 ILNSPEKACSLAK 206
>pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 Back     alignment and structure
>pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 Back     alignment and structure
>pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 Back     alignment and structure
>pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 Back     alignment and structure
>pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 Back     alignment and structure
>pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 Back     alignment and structure
>pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 Back     alignment and structure
>pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 Back     alignment and structure
>pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 Back     alignment and structure
>pdb|2B05|A Chain A, Crystal Structure Of 14-3-3 Gamma In Complex With A Phosphoserine Peptide Length = 246 Back     alignment and structure
>pdb|3UZD|A Chain A, Crystal Structure Of 14-3-3 Gamma Length = 248 Back     alignment and structure
>pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 Back     alignment and structure
>pdb|4E2E|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Gamma Polypeptide (Ywhag) From Homo Sapiens At 2.25 A Resolution Length = 248 Back     alignment and structure
>pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 Back     alignment and structure
>pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 Back     alignment and structure
>pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 Back     alignment and structure
>pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 Back     alignment and structure
>pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 Back     alignment and structure
>pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 Back     alignment and structure
>pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 Back     alignment and structure
>pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 Back     alignment and structure
>pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 Back     alignment and structure
>pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 Back     alignment and structure
>pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 Back     alignment and structure
>pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 Back     alignment and structure
>pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 Back     alignment and structure
>pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 Back     alignment and structure
>pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 Back     alignment and structure
>pdb|3M50|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 240 Back     alignment and structure
>pdb|2O98|A Chain A, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 242 Back     alignment and structure
>pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 Regulatory Complex Length = 260 Back     alignment and structure
>pdb|3AXY|C Chain C, Structure Of Florigen Activation Complex Consisting Of Rice Florigen Hd3a, 14-3-3 Protein Gf14 And Rice Fd Homolog Osfd1 Length = 240 Back     alignment and structure
>pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A PYRAZOLE Derivative Length = 243 Back     alignment and structure
>pdb|2NPM|A Chain A, Crystal Structure Of Cryptosporidium Parvum 14-3-3 Protein In Complex With Peptide Length = 260 Back     alignment and structure
>pdb|3EFZ|A Chain A, Crystal Structure Of A 14-3-3 Protein From Cryptosporidium Parvum (Cgd1_2980) Length = 268 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
2o8p_A227 14-3-3 domain containing protein; signaling protei 2e-39
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 4e-28
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 7e-28
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 9e-28
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 1e-27
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 2e-27
2npm_A260 14-3-3 domain containing protein; cell regulator p 5e-26
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 2e-24
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 Back     alignment and structure
 Score =  129 bits (326), Expect = 2e-39
 Identities = 16/73 (21%), Positives = 27/73 (36%), Gaps = 5/73 (6%)

Query: 1   MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
           +K D  RY  E          +EDS+K +Q+AF +          + LG   N +    E
Sbjct: 125 VKSDISRYKLEFGLCS-----LEDSKKIHQDAFTLLCEHPDKIEQLPLGFIQNLAYILSE 179

Query: 61  IINSPARACHLAK 73
                 +  ++  
Sbjct: 180 KYGEKKQVFNMLN 192
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 100.0
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 100.0
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 100.0
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 100.0
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 100.0
2npm_A260 14-3-3 domain containing protein; cell regulator p 100.0
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 100.0
2o8p_A227 14-3-3 domain containing protein; signaling protei 100.0
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.3
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.03
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.73
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.36
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 94.16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 93.69
3u3w_A293 Transcriptional activator PLCR protein; ternary co 93.51
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 93.26
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 92.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 92.36
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 90.41
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 88.7
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 88.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 88.01
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 87.92
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 87.12
4g1t_A 472 Interferon-induced protein with tetratricopeptide 86.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 86.45
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 85.51
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 85.3
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 85.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 84.69
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 84.57
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 83.66
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 82.17
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 82.01
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 81.64
3k9i_A117 BH0479 protein; putative protein binding protein, 80.89
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 80.82
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 80.75
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 80.74
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 80.19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 80.08
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
Probab=100.00  E-value=3.8e-42  Score=259.30  Aligned_cols=85  Identities=59%  Similarity=0.925  Sum_probs=83.5

Q ss_pred             CccccchhhhcccCCcchhHHHHHHHHHHHHHHHHHHhcCCCCCcchhhhhhhHHHHHHHHhcChHHHHHHHHHHHHHHH
Q psy11270          1 MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCI   80 (98)
Q Consensus         1 mKGDyyRYlaE~~~~~~~~~~~~~a~~aY~~A~~~A~~~L~pt~PirLgL~LN~SVF~yEil~~~~~A~~iAk~Afd~Ai   80 (98)
                      ||||||||+|||..|++|++++++|+++|++|.++|+.+|||||||||||+||||||||||+|+|++||+|||+|||+||
T Consensus       128 mKGDyyRYlAE~~~g~~r~~~~e~a~~aY~~A~~iA~~~L~pthPirLGLaLNfSVFyyEiln~~~~Ac~lAk~Afd~Ai  207 (236)
T 3iqu_A          128 MKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAM  207 (236)
T ss_dssp             HHHHHHHHHHHHCCSTTHHHHHHHHHHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHTSSCHHHHHHHHHHHHHHHH
T ss_pred             hhhhHHHHHHHhcCchHHHHHHHHHHHHHHHHHHHHHhhCCCCCcHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcchh
Q psy11270         81 GASRV   85 (98)
Q Consensus        81 ~~~d~   85 (98)
                      +++|+
T Consensus       208 ~eld~  212 (236)
T 3iqu_A          208 ADLHT  212 (236)
T ss_dssp             HHGGG
T ss_pred             HHhhc
Confidence            99983
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 98
d2o8pa1220 a.118.7.1 (A:8-227) 14-3-3 domain containing prote 1e-35
d1o9da_236 a.118.7.1 (A:) 14-3-3-like protein C {Common tobac 5e-34
d3efza1223 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry 9e-34
d2o02a1230 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) 5e-33
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: 14-3-3 protein
family: 14-3-3 protein
domain: 14-3-3 domain containing protein cgd7 2470
species: Cryptosporidium parvum [TaxId: 5807]

 Score =  118 bits (298), Expect = 1e-35
 Identities = 16/74 (21%), Positives = 27/74 (36%), Gaps = 5/74 (6%)

Query: 1   MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYE 60
           +K D  RY  E          +EDS+K +Q+AF +          + LG   N +    E
Sbjct: 123 VKSDISRYKLEFGLC-----SLEDSKKIHQDAFTLLCEHPDKIEQLPLGFIQNLAYILSE 177

Query: 61  IINSPARACHLAKQ 74
                 +  ++   
Sbjct: 178 KYGEKKQVFNMLNS 191
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 100.0
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 100.0
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 100.0
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 88.89
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 88.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 87.75
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 87.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 87.34
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 84.87
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 84.09
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 82.67
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 80.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 80.25
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: 14-3-3 protein
family: 14-3-3 protein
domain: zeta isoform
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=2.6e-39  Score=240.49  Aligned_cols=90  Identities=66%  Similarity=1.048  Sum_probs=85.2

Q ss_pred             CccccchhhhcccCCcchhHHHHHHHHHHHHHHHHHHhcCCCCCcchhhhhhhHHHHHHHHhcChHHHHHHHHHHHHHHH
Q psy11270          1 MKGDYYRYLAEVATGDTRNAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVQYSCI   80 (98)
Q Consensus         1 mKGDyyRYlaE~~~~~~~~~~~~~a~~aY~~A~~~A~~~L~pt~PirLgL~LN~SVF~yEil~~~~~A~~iAk~Afd~Ai   80 (98)
                      ||||||||+|||..|++|++++++|.++|++|+++|+.+||||||+||||+||||||+|||+|++++||+|||+|||+||
T Consensus       121 mkgDy~RY~aE~~~~~e~~~~~~~a~~aY~~A~~~A~~~L~~t~pirLgL~LN~SVF~YEi~~~~~~A~~lak~afd~ai  200 (230)
T d2o02a1         121 MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI  200 (230)
T ss_dssp             HHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHTSCCHHHHHHHHHHHHHHHH
T ss_pred             hcccHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhHHHHHHHHcCCHHHHHHHHHHHHHHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcchhccccCCc
Q psy11270         81 GASRVQILSVPR   92 (98)
Q Consensus        81 ~~~d~~~~~~~~   92 (98)
                      +++|  .+++..
T Consensus       201 ~~l~--~l~ee~  210 (230)
T d2o02a1         201 AELD--TLSEES  210 (230)
T ss_dssp             TTGG--GCCTTT
T ss_pred             HHhh--cCChhh
Confidence            9886  444443
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure