Psyllid ID: psy11303


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDIIL
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcHHHHHHHHHHHHHHHcccEEEEEEcccccccccHcEEcccccccHHcccHHHHHcHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHccccccccEEEEc
MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSrrkhtydtnfttlnVGTARSILITSCETALGLQLALHFsslgfrvfagfkpsggenkseckseesKSDAYKILRAKLKSCQNHLLSAsvnlddsnvlkvitlpldvtredsLHEAVDIIRRhlpagedgwdiil
MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFkpsggenkseckseesKSDAYKILRAKLKSCQNHLLSasvnlddsnvLKVITlpldvtredsLHEAVDIIrrhlpagedgwdiil
MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGenkseckseesksDAYKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDIIL
*****AFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGF********************YKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDI**
**EQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGG******************LRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDIIL
MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFKP****************DAYKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDIIL
*DEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPS******EC*****KSDAYKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDIIL
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDGWDIIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q02337 344 D-beta-hydroxybutyrate de yes N/A 0.680 0.328 0.260 8e-05
>sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 Back     alignment and function desciption
 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 33/146 (22%)

Query: 21  GALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCETALGLQLALHFSSLGFRVFAG 80
           G+LLLY    +   + TY  +   +    ++++LIT C++  G  LA H  S GF VFAG
Sbjct: 29  GSLLLYSAPFVPVGRRTYAASVDPVG---SKAVLITGCDSGFGFSLAKHLHSEGFLVFAG 85

Query: 81  FKPSGGENKSECKSEESKSDAYKILRAKLKSCQNHLLSASVNLDDSNVLKVITLPLDVTR 140
                      C  ++  SD  K                   LD     ++ T+ L+V +
Sbjct: 86  -----------CLMKDKGSDGVK------------------ELDSMKSDRLRTVQLNVCK 116

Query: 141 EDSLHEAVDIIRRHLPAGEDG-WDII 165
            + + +A ++IR  L   E G W ++
Sbjct: 117 SEEVDKAAEVIRSSLEDPEKGLWGLV 142





Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 0

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
242012421 342 short-chain dehydrogenase, putative [Ped 0.969 0.470 0.488 1e-34
328700295 335 PREDICTED: d-beta-hydroxybutyrate dehydr 0.915 0.453 0.476 8e-28
91081053 322 PREDICTED: similar to AGAP004450-PA [Tri 0.885 0.456 0.467 9e-22
170065349 269 short-chain dehydrogenase [Culex quinque 0.819 0.505 0.428 2e-18
158292184 319 AGAP004450-PA [Anopheles gambiae str. PE 0.801 0.416 0.438 2e-18
157118207 325 short-chain dehydrogenase [Aedes aegypti 0.801 0.409 0.432 5e-18
156554062 269 PREDICTED: D-beta-hydroxybutyrate dehydr 0.903 0.557 0.360 8e-18
350405080 320 PREDICTED: D-beta-hydroxybutyrate dehydr 0.879 0.456 0.364 1e-17
380012757151 PREDICTED: uncharacterized protein LOC10 0.855 0.940 0.369 1e-17
340718632 320 PREDICTED: d-beta-hydroxybutyrate dehydr 0.879 0.456 0.358 2e-17
>gi|242012421|ref|XP_002426931.1| short-chain dehydrogenase, putative [Pediculus humanus corporis] gi|212511160|gb|EEB14193.1| short-chain dehydrogenase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 111/170 (65%), Gaps = 9/170 (5%)

Query: 1   MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTY---DTNFTTLNVGTARSILITS 57
           MD+QTAFVLA+QLIAL  +  AL+LYL+C++ +   T    + + T +N+G  + IL+TS
Sbjct: 1   MDDQTAFVLALQLIALCTVVSALILYLMCRIRKNHFTPFSDNDDLTYVNIGGGKGILVTS 60

Query: 58  CETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSD-AYKILRAKLKSCQNHL 116
            +  LGLQLA H ++ GFRVFAG KPSG E   +    ES+S    KIL AK K  +   
Sbjct: 61  LDNMLGLQLAYHLATRGFRVFAGVKPSGYEADGQNVVIESESSIPKKILEAKWKKFE--- 117

Query: 117 LSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPAGEDG-WDII 165
            +     ++ N + ++ LPLDVTRED LHEA+  IRRHLPAGEDG W +I
Sbjct: 118 -ACCKKEENENFVGLVVLPLDVTREDLLHEALGTIRRHLPAGEDGLWAVI 166




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328700295|ref|XP_003241208.1| PREDICTED: d-beta-hydroxybutyrate dehydrogenase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91081053|ref|XP_975382.1| PREDICTED: similar to AGAP004450-PA [Tribolium castaneum] gi|270005322|gb|EFA01770.1| hypothetical protein TcasGA2_TC007369 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170065349|ref|XP_001867902.1| short-chain dehydrogenase [Culex quinquefasciatus] gi|167882419|gb|EDS45802.1| short-chain dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158292184|ref|XP_313742.4| AGAP004450-PA [Anopheles gambiae str. PEST] gi|347971923|ref|XP_003436816.1| AGAP004450-PB [Anopheles gambiae str. PEST] gi|157017315|gb|EAA09223.4| AGAP004450-PA [Anopheles gambiae str. PEST] gi|333469090|gb|EGK97174.1| AGAP004450-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157118207|ref|XP_001659060.1| short-chain dehydrogenase [Aedes aegypti] gi|108875785|gb|EAT40010.1| AAEL008227-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|156554062|ref|XP_001599721.1| PREDICTED: D-beta-hydroxybutyrate dehydrogenase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350405080|ref|XP_003487319.1| PREDICTED: D-beta-hydroxybutyrate dehydrogenase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380012757|ref|XP_003690442.1| PREDICTED: uncharacterized protein LOC100870811 [Apis florea] Back     alignment and taxonomy information
>gi|340718632|ref|XP_003397768.1| PREDICTED: d-beta-hydroxybutyrate dehydrogenase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
FB|FBgn0261446 330 CG13377 [Drosophila melanogast 0.463 0.233 0.487 2.3e-18
ZFIN|ZDB-GENE-070410-130 363 bdh1 "3-hydroxybutyrate dehydr 0.216 0.099 0.552 9.7e-08
FB|FBgn0033679 388 CG8888 [Drosophila melanogaste 0.253 0.108 0.367 5.3e-05
UNIPROTKB|Q02337 344 BDH1 "D-beta-hydroxybutyrate d 0.343 0.165 0.4 8.5e-05
UNIPROTKB|C9JM78169 BDH1 "D-beta-hydroxybutyrate d 0.198 0.195 0.470 0.0001
UNIPROTKB|C9JQ90186 BDH1 "D-beta-hydroxybutyrate d 0.198 0.177 0.470 0.00017
UNIPROTKB|E1BXM0 323 E1BXM0 "Uncharacterized protei 0.361 0.185 0.406 0.00079
FB|FBgn0261446 CG13377 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 2.3e-18, Sum P(2) = 2.3e-18
 Identities = 40/82 (48%), Positives = 54/82 (65%)

Query:     1 MDEQTAFVLAIQLIALSCIAGALLLYLLCKMSRRKHTYDTNFTTLNVGTARSILITSCET 60
             M+  T  VL  QL+AL  IAGALL+YL+CK+  R+ +   N  +     +R +LITS +T
Sbjct:     1 MEAMTMLVLGFQLLALFSIAGALLIYLICKV--REDSASANADS---HPSRVVLITSADT 55

Query:    61 ALGLQLALHFSSLGFRVFAGFK 82
             ALGLQL  H ++ G+RVFAG K
Sbjct:    56 ALGLQLCTHLANKGYRVFAGMK 77


GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0042048 "olfactory behavior" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0016319 "mushroom body development" evidence=IMP
ZFIN|ZDB-GENE-070410-130 bdh1 "3-hydroxybutyrate dehydrogenase, type 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0033679 CG8888 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q02337 BDH1 "D-beta-hydroxybutyrate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9JM78 BDH1 "D-beta-hydroxybutyrate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQ90 BDH1 "D-beta-hydroxybutyrate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXM0 E1BXM0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
cd09805 281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 7e-07
cd05374 248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-05
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
 Score = 47.3 bits (113), Expect = 7e-07
 Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 31/105 (29%)

Query: 53  ILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAKLKSC 112
           +LIT C++  G  LA    SLGF V AG           C ++       K LR   + C
Sbjct: 3   VLITGCDSGFGNLLAKKLDSLGFTVLAG-----------CLTKN--GPGAKELR---RVC 46

Query: 113 QNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVDIIRRHLPA 157
                        S+ L+  TL LDVT+ + +  A   ++ H+  
Sbjct: 47  -------------SDRLR--TLQLDVTKPEQIKRAAQWVKEHVGE 76


17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. This classical-SDR subgroup includes the human proteins: type 2 17beta-HSD, type 6 17beta-HSD, type 2 11beta-HSD, dehydrogenase/reductase SDR family member 9, short-chain dehydrogenase/reductase family 9C member 7, 3-hydroxybutyrate dehydrogenase type 1, and retinol dehydrogenase 5. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 281

>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
KOG1201|consensus 300 99.47
KOG1610|consensus 322 99.45
KOG1205|consensus 282 99.41
COG0300 265 DltE Short-chain dehydrogenases of various substra 99.39
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 99.3
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.28
PRK05867 253 short chain dehydrogenase; Provisional 99.27
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.26
PRK08303 305 short chain dehydrogenase; Provisional 99.26
PRK05854 313 short chain dehydrogenase; Provisional 99.26
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 99.26
PRK06114 254 short chain dehydrogenase; Provisional 99.26
PRK08862 227 short chain dehydrogenase; Provisional 99.25
PRK05876 275 short chain dehydrogenase; Provisional 99.25
PRK07478 254 short chain dehydrogenase; Provisional 99.25
PRK07062 265 short chain dehydrogenase; Provisional 99.24
PRK08589 272 short chain dehydrogenase; Validated 99.24
KOG1208|consensus 314 99.23
PRK07063 260 short chain dehydrogenase; Provisional 99.23
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 99.23
PRK08339 263 short chain dehydrogenase; Provisional 99.21
PRK07109 334 short chain dehydrogenase; Provisional 99.21
PRK06139 330 short chain dehydrogenase; Provisional 99.21
PRK07523 255 gluconate 5-dehydrogenase; Provisional 99.21
PRK07890 258 short chain dehydrogenase; Provisional 99.2
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.2
PLN02780 320 ketoreductase/ oxidoreductase 99.2
PRK08085 254 gluconate 5-dehydrogenase; Provisional 99.2
PRK12743 256 oxidoreductase; Provisional 99.19
PRK07035 252 short chain dehydrogenase; Provisional 99.18
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 99.18
PRK05866 293 short chain dehydrogenase; Provisional 99.18
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 99.17
PRK06194 287 hypothetical protein; Provisional 99.17
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.17
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.17
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 99.17
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.17
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.17
PRK08936 261 glucose-1-dehydrogenase; Provisional 99.17
PRK08265 261 short chain dehydrogenase; Provisional 99.17
PRK08278 273 short chain dehydrogenase; Provisional 99.16
PRK06197 306 short chain dehydrogenase; Provisional 99.16
PRK08643 256 acetoin reductase; Validated 99.16
PRK12937 245 short chain dehydrogenase; Provisional 99.16
PRK07791 286 short chain dehydrogenase; Provisional 99.16
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 99.16
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 99.16
PRK09186 256 flagellin modification protein A; Provisional 99.15
PRK07097 265 gluconate 5-dehydrogenase; Provisional 99.15
PRK06138 252 short chain dehydrogenase; Provisional 99.15
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 99.15
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.15
PRK06172 253 short chain dehydrogenase; Provisional 99.15
PRK07677 252 short chain dehydrogenase; Provisional 99.15
PRK07024 257 short chain dehydrogenase; Provisional 99.15
PRK05872 296 short chain dehydrogenase; Provisional 99.14
PLN02253 280 xanthoxin dehydrogenase 99.14
PRK08277 278 D-mannonate oxidoreductase; Provisional 99.14
PRK08340 259 glucose-1-dehydrogenase; Provisional 99.14
KOG0725|consensus 270 99.14
PRK06128 300 oxidoreductase; Provisional 99.14
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 99.14
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.14
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 99.14
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.13
PRK07806 248 short chain dehydrogenase; Provisional 99.13
PRK07814 263 short chain dehydrogenase; Provisional 99.13
PRK08628 258 short chain dehydrogenase; Provisional 99.13
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 99.13
PRK08251 248 short chain dehydrogenase; Provisional 99.12
PRK05599 246 hypothetical protein; Provisional 99.12
PRK07576 264 short chain dehydrogenase; Provisional 99.12
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.11
PRK12935 247 acetoacetyl-CoA reductase; Provisional 99.11
PRK06398 258 aldose dehydrogenase; Validated 99.11
KOG1014|consensus 312 99.11
PRK05717 255 oxidoreductase; Validated 99.11
PRK06124 256 gluconate 5-dehydrogenase; Provisional 99.11
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 99.11
PRK06179 270 short chain dehydrogenase; Provisional 99.11
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.11
PRK08213 259 gluconate 5-dehydrogenase; Provisional 99.11
PRK12939 250 short chain dehydrogenase; Provisional 99.11
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 99.1
PRK09134 258 short chain dehydrogenase; Provisional 99.1
PRK07904 253 short chain dehydrogenase; Provisional 99.1
PRK07454 241 short chain dehydrogenase; Provisional 99.1
PRK08226 263 short chain dehydrogenase; Provisional 99.1
PRK06701 290 short chain dehydrogenase; Provisional 99.1
PRK07985 294 oxidoreductase; Provisional 99.1
PRK06523 260 short chain dehydrogenase; Provisional 99.1
PRK07774 250 short chain dehydrogenase; Provisional 99.09
PRK12744 257 short chain dehydrogenase; Provisional 99.09
PRK06720169 hypothetical protein; Provisional 99.09
PRK07825 273 short chain dehydrogenase; Provisional 99.09
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.09
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 99.09
PRK09242 257 tropinone reductase; Provisional 99.08
PRK07453 322 protochlorophyllide oxidoreductase; Validated 99.08
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.08
PRK06949 258 short chain dehydrogenase; Provisional 99.08
PRK06947 248 glucose-1-dehydrogenase; Provisional 99.08
PRK06182 273 short chain dehydrogenase; Validated 99.08
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.08
PRK06196 315 oxidoreductase; Provisional 99.07
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.07
PRK09135 249 pteridine reductase; Provisional 99.07
PRK06483 236 dihydromonapterin reductase; Provisional 99.07
PRK07201 657 short chain dehydrogenase; Provisional 99.06
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 99.06
PRK07067 257 sorbitol dehydrogenase; Provisional 99.06
PRK12938 246 acetyacetyl-CoA reductase; Provisional 99.06
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 99.06
PRK06180 277 short chain dehydrogenase; Provisional 99.05
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.05
TIGR02415 254 23BDH acetoin reductases. One member of this famil 99.05
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.05
PRK07831 262 short chain dehydrogenase; Provisional 99.04
PRK05993 277 short chain dehydrogenase; Provisional 99.04
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.04
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.03
PRK06123 248 short chain dehydrogenase; Provisional 99.03
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.03
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.03
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.03
PRK07856 252 short chain dehydrogenase; Provisional 99.03
PRK05650 270 short chain dehydrogenase; Provisional 99.03
PRK06500 249 short chain dehydrogenase; Provisional 99.02
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.02
PRK12746 254 short chain dehydrogenase; Provisional 99.02
PRK09072 263 short chain dehydrogenase; Provisional 99.02
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.01
PRK12828 239 short chain dehydrogenase; Provisional 99.01
PRK05855 582 short chain dehydrogenase; Validated 99.01
PRK05693 274 short chain dehydrogenase; Provisional 99.0
PRK12824 245 acetoacetyl-CoA reductase; Provisional 99.0
PRK06484 520 short chain dehydrogenase; Validated 99.0
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.0
PRK12747 252 short chain dehydrogenase; Provisional 99.0
PRK06181 263 short chain dehydrogenase; Provisional 99.0
PRK06841 255 short chain dehydrogenase; Provisional 98.99
PRK06924 251 short chain dehydrogenase; Provisional 98.99
PRK06914 280 short chain dehydrogenase; Provisional 98.99
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 98.99
PRK08263 275 short chain dehydrogenase; Provisional 98.99
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.99
PRK07775 274 short chain dehydrogenase; Provisional 98.98
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 98.98
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.98
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 98.97
PRK06198 260 short chain dehydrogenase; Provisional 98.97
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.97
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.97
PRK07102 243 short chain dehydrogenase; Provisional 98.97
PRK06484 520 short chain dehydrogenase; Validated 98.97
PRK05875 276 short chain dehydrogenase; Provisional 98.97
PRK06057 255 short chain dehydrogenase; Provisional 98.97
PRK07832 272 short chain dehydrogenase; Provisional 98.97
PRK06101 240 short chain dehydrogenase; Provisional 98.96
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.96
PRK12827 249 short chain dehydrogenase; Provisional 98.96
PRK07326 237 short chain dehydrogenase; Provisional 98.96
PRK06482 276 short chain dehydrogenase; Provisional 98.95
PRK08267 260 short chain dehydrogenase; Provisional 98.95
PRK07074 257 short chain dehydrogenase; Provisional 98.95
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.95
PRK12829 264 short chain dehydrogenase; Provisional 98.94
PRK06940 275 short chain dehydrogenase; Provisional 98.94
PRK10538 248 malonic semialdehyde reductase; Provisional 98.93
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.92
PRK07069 251 short chain dehydrogenase; Validated 98.91
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 98.91
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.91
KOG1210|consensus 331 98.9
PLN00015 308 protochlorophyllide reductase 98.9
PRK08703 239 short chain dehydrogenase; Provisional 98.89
PRK06125 259 short chain dehydrogenase; Provisional 98.88
KOG1200|consensus 256 98.88
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.86
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.84
COG1028 251 FabG Dehydrogenases with different specificities ( 98.84
KOG4169|consensus 261 98.83
PRK07023 243 short chain dehydrogenase; Provisional 98.82
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.8
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.79
PRK08177 225 short chain dehydrogenase; Provisional 98.78
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.78
PRK08017 256 oxidoreductase; Provisional 98.77
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 98.76
KOG1611|consensus 249 98.75
PRK12742 237 oxidoreductase; Provisional 98.73
PRK09291 257 short chain dehydrogenase; Provisional 98.73
PRK08324 681 short chain dehydrogenase; Validated 98.71
PRK07577 234 short chain dehydrogenase; Provisional 98.7
PRK05884 223 short chain dehydrogenase; Provisional 98.69
PRK08264 238 short chain dehydrogenase; Validated 98.68
PRK06953 222 short chain dehydrogenase; Provisional 98.67
KOG1209|consensus 289 98.66
KOG1199|consensus 260 98.65
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 98.63
PRK07060 245 short chain dehydrogenase; Provisional 98.6
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.57
PRK12367 245 short chain dehydrogenase; Provisional 98.57
PRK07041 230 short chain dehydrogenase; Provisional 98.56
PRK08309177 short chain dehydrogenase; Provisional 98.54
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.52
PLN02583 297 cinnamoyl-CoA reductase 98.49
PRK08219 227 short chain dehydrogenase; Provisional 98.47
COG0623 259 FabI Enoyl-[acyl-carrier-protein] 98.46
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 98.45
PRK09009 235 C factor cell-cell signaling protein; Provisional 98.44
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 98.44
PLN02653 340 GDP-mannose 4,6-dehydratase 98.44
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 98.43
KOG1478|consensus 341 98.41
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 98.41
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.37
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.34
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 98.33
PLN00198 338 anthocyanidin reductase; Provisional 98.33
PLN03209 576 translocon at the inner envelope of chloroplast su 98.32
KOG1502|consensus 327 98.31
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.31
PLN02686 367 cinnamoyl-CoA reductase 98.3
PLN02214 342 cinnamoyl-CoA reductase 98.28
KOG1207|consensus 245 98.26
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 98.26
PLN02896 353 cinnamyl-alcohol dehydrogenase 98.23
PLN02240 352 UDP-glucose 4-epimerase 98.23
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.21
PRK07578199 short chain dehydrogenase; Provisional 98.2
PLN02572 442 UDP-sulfoquinovose synthase 98.18
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 98.15
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.15
PLN02650 351 dihydroflavonol-4-reductase 98.12
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.1
CHL00194 317 ycf39 Ycf39; Provisional 98.07
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.05
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 97.95
PRK10675 338 UDP-galactose-4-epimerase; Provisional 97.93
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.92
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 97.91
PLN02427 386 UDP-apiose/xylose synthase 97.91
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 97.83
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.79
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 97.79
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 97.77
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 97.76
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.75
KOG1371|consensus 343 97.67
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.66
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.66
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 97.59
PLN02695 370 GDP-D-mannose-3',5'-epimerase 97.57
TIGR01746 367 Thioester-redct thioester reductase domain. It has 97.56
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 97.49
PRK05865 854 hypothetical protein; Provisional 97.36
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 97.35
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 97.33
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 97.32
TIGR02114 227 coaB_strep phosphopantothenate--cysteine ligase, s 97.3
PLN02260 668 probable rhamnose biosynthetic enzyme 97.27
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 97.25
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 97.25
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 97.21
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.2
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.17
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 97.16
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 97.12
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 96.83
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 96.81
PRK12320 699 hypothetical protein; Provisional 96.78
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 96.75
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 96.69
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 96.66
PRK07201 657 short chain dehydrogenase; Provisional 96.61
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 96.6
PLN02206 442 UDP-glucuronate decarboxylase 96.56
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.54
KOG1430|consensus 361 96.54
PLN02996 491 fatty acyl-CoA reductase 96.51
PRK10669558 putative cation:proton antiport protein; Provision 96.5
PF07993 249 NAD_binding_4: Male sterility protein; InterPro: I 96.35
PLN02166 436 dTDP-glucose 4,6-dehydratase 96.33
PLN02503 605 fatty acyl-CoA reductase 2 96.3
KOG2865|consensus 391 96.27
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 96.23
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.09
PLN00016 378 RNA-binding protein; Provisional 96.08
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 96.07
PLN02778 298 3,5-epimerase/4-reductase 96.02
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 95.98
PRK03562 621 glutathione-regulated potassium-efflux system prot 95.88
PRK03659601 glutathione-regulated potassium-efflux system prot 95.86
KOG2733|consensus 423 95.85
PRK09620229 hypothetical protein; Provisional 95.76
COG4982 866 3-oxoacyl-[acyl-carrier protein] 95.64
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 95.55
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 95.54
COG3320 382 Putative dehydrogenase domain of multifunctional n 95.43
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.36
COG2910211 Putative NADH-flavin reductase [General function p 95.2
PRK06849 389 hypothetical protein; Provisional 95.13
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.05
KOG1372|consensus 376 94.94
PRK06732229 phosphopantothenate--cysteine ligase; Validated 94.85
KOG1221|consensus 467 94.76
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 94.76
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.75
PRK09496 453 trkA potassium transporter peripheral membrane com 94.61
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.59
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 94.43
PRK04148134 hypothetical protein; Provisional 94.41
PRK09496 453 trkA potassium transporter peripheral membrane com 94.4
PRK14982340 acyl-ACP reductase; Provisional 94.32
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 94.3
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.3
PRK10537393 voltage-gated potassium channel; Provisional 94.27
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.09
KOG1429|consensus 350 93.92
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.9
KOG1204|consensus 253 93.88
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 93.84
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 93.84
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.64
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 93.62
PF08643 299 DUF1776: Fungal family of unknown function (DUF177 93.59
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.58
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 93.54
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 93.46
KOG1203|consensus 411 93.42
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 93.33
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 93.11
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 92.89
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 92.67
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.59
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 92.39
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 92.25
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 92.21
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 92.18
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 92.17
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 92.15
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 92.11
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 92.05
KOG1198|consensus347 91.93
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 91.83
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.69
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 91.63
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 91.34
COG2085211 Predicted dinucleotide-binding enzymes [General fu 91.26
PLN02260 668 probable rhamnose biosynthetic enzyme 91.13
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 91.09
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 90.85
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 90.68
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.63
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 90.56
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 90.46
PRK08328231 hypothetical protein; Provisional 90.18
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 89.86
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 89.73
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 89.73
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 89.72
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 89.65
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 89.61
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 89.43
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.41
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 89.35
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 89.25
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.12
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 89.02
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 89.01
PRK06719157 precorrin-2 dehydrogenase; Validated 88.99
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 88.99
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 88.97
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.97
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 88.83
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 88.77
PRK08306296 dipicolinate synthase subunit A; Reviewed 88.74
PLN02494 477 adenosylhomocysteinase 88.69
PTZ00354334 alcohol dehydrogenase; Provisional 88.51
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 88.48
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 88.47
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 88.45
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.43
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.36
PRK08655 437 prephenate dehydrogenase; Provisional 88.36
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 88.31
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 88.21
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 88.16
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.13
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 88.03
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 88.01
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 87.83
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 87.78
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 87.78
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.74
PTZ00075 476 Adenosylhomocysteinase; Provisional 87.66
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 87.63
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 87.57
PLN02928347 oxidoreductase family protein 87.57
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 87.54
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 87.52
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 87.42
PRK12549284 shikimate 5-dehydrogenase; Reviewed 87.35
PRK09880343 L-idonate 5-dehydrogenase; Provisional 87.34
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 87.13
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 86.89
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 86.8
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 86.74
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 86.71
cd01483143 E1_enzyme_family Superfamily of activating enzymes 86.7
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 86.67
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 86.58
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 86.52
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 86.37
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 86.32
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 86.27
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 86.21
PRK12480330 D-lactate dehydrogenase; Provisional 86.11
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 86.11
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 86.05
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 86.03
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 86.0
PRK08223 287 hypothetical protein; Validated 85.99
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 85.98
PRK13771334 putative alcohol dehydrogenase; Provisional 85.97
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 85.97
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 85.96
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 85.91
PRK13243333 glyoxylate reductase; Reviewed 85.85
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 85.83
PRK06932314 glycerate dehydrogenase; Provisional 85.75
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 85.68
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 85.42
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 85.34
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 85.29
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 85.24
PRK07574385 formate dehydrogenase; Provisional 85.02
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 84.91
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 84.8
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 84.58
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 84.48
cd08251303 polyketide_synthase polyketide synthase. Polyketid 84.47
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.47
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 84.41
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 84.39
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 84.34
PRK06444197 prephenate dehydrogenase; Provisional 84.33
PRK06487317 glycerate dehydrogenase; Provisional 84.29
KOG1431|consensus 315 84.16
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 84.12
CHL00175 281 minD septum-site determining protein; Validated 84.11
PRK06436303 glycerate dehydrogenase; Provisional 84.01
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 83.85
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.79
PLN02306 386 hydroxypyruvate reductase 83.71
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 83.63
cd08252336 AL_MDR Arginate lyase and other MDR family members 83.62
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 83.58
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 83.52
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 83.49
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.38
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 83.37
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 83.33
PRK14027283 quinate/shikimate dehydrogenase; Provisional 83.17
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 83.12
KOG1197|consensus336 83.11
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.94
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 82.88
TIGR01968 261 minD_bact septum site-determining protein MinD. Th 82.76
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.72
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 82.68
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 82.65
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 82.47
PLN02586360 probable cinnamyl alcohol dehydrogenase 82.3
PRK13940 414 glutamyl-tRNA reductase; Provisional 82.25
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 82.17
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 82.17
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 82.12
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.04
PRK14968188 putative methyltransferase; Provisional 82.0
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 81.98
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.68
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 81.58
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 81.58
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.51
PLN02740381 Alcohol dehydrogenase-like 81.39
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 81.26
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 81.15
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 81.1
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 81.03
COG2130340 Putative NADP-dependent oxidoreductases [General f 80.84
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 80.78
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 80.49
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 80.45
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.4
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 80.32
PLN03139386 formate dehydrogenase; Provisional 80.31
>KOG1201|consensus Back     alignment and domain information
Probab=99.47  E-value=8e-13  Score=112.72  Aligned_cols=81  Identities=15%  Similarity=0.223  Sum_probs=68.9

Q ss_pred             CCCCEEEEecCCChhHHHHHHHHHHcCCeEEEEeCCCCCCCCcccccccchhhHHHHHHHHHHHHhhhhhccccccccCC
Q psy11303         48 GTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAKLKSCQNHLLSASVNLDDSN  127 (166)
Q Consensus        48 ~~~k~vlITG~~~giG~~la~~l~~~G~~Vi~~~r~~~~~~~~~~~~~~~~~~~~~~L~~~~~~l~~~~~~~~~~~~~~~  127 (166)
                      .+|+.|+|||+++|||+++|.+|+++|+++++++.|..+.+                  +..+.+++.            
T Consensus        36 v~g~~vLITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~------------------etv~~~~~~------------   85 (300)
T KOG1201|consen   36 VSGEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNE------------------ETVKEIRKI------------   85 (300)
T ss_pred             ccCCEEEEeCCCchHHHHHHHHHHHhCCeEEEEeccccchH------------------HHHHHHHhc------------
Confidence            58999999999999999999999999999999999985532                  223344432            


Q ss_pred             CceEEEEEecCCChHHHHHHHHHHHHhCCCCC
Q psy11303        128 VLKVITLPLDVTREDSLHEAVDIIRRHLPAGE  159 (166)
Q Consensus       128 ~~~v~~~~~Dvt~~~si~~~v~~i~~~~g~~~  159 (166)
                       +.++.+.||+++.+++.+..+++++++|+-+
T Consensus        86 -g~~~~y~cdis~~eei~~~a~~Vk~e~G~V~  116 (300)
T KOG1201|consen   86 -GEAKAYTCDISDREEIYRLAKKVKKEVGDVD  116 (300)
T ss_pred             -CceeEEEecCCCHHHHHHHHHHHHHhcCCce
Confidence             3799999999999999999999999999743



>KOG1610|consensus Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-06
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 2e-05
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
 Score = 44.4 bits (105), Expect = 4e-06
 Identities = 23/107 (21%), Positives = 37/107 (34%), Gaps = 26/107 (24%)

Query: 49  TARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAK 108
           + + ILIT   +  G   A   +  G RV+A  +   G N S  ++    +         
Sbjct: 4   SKKIILITGASSGFGRLTAEALAGAGHRVYASMRDIVGRNASNVEAIAGFARDND----- 58

Query: 109 LKSCQNHLLSASVNLDDSNVLKVITLPLDVTREDSLHEAVD-IIRRH 154
                               + + TL LDV  + S+  A+D II   
Sbjct: 59  --------------------VDLRTLELDVQSQVSVDRAIDQIIGED 85


>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 99.52
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 99.5
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.44
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 99.41
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 99.41
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.41
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 99.4
3imf_A 257 Short chain dehydrogenase; structural genomics, in 99.4
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.39
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.39
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.39
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.38
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.38
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 99.37
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.37
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 99.37
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.37
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 99.37
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.37
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.36
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 99.36
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.36
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 99.36
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 99.36
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.36
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 99.36
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.36
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.36
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.36
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 99.35
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 99.35
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.35
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.35
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 99.35
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.34
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 99.34
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.34
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 99.34
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 99.34
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 99.34
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 99.34
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.34
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 99.34
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 99.34
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.34
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.34
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.34
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.34
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.33
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.33
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.33
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.33
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 99.33
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 99.33
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 99.33
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.32
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 99.32
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.32
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.32
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 99.32
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.32
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.31
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.31
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.31
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.31
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.31
3rih_A 293 Short chain dehydrogenase or reductase; structural 99.31
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.31
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.31
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.3
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.3
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 99.3
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.3
3cxt_A 291 Dehydrogenase with different specificities; rossma 99.3
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 99.3
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.3
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.3
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.3
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 99.3
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 99.3
1xkq_A 280 Short-chain reductase family member (5D234); parra 99.29
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.29
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.29
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 99.29
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.29
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.29
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.29
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.29
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.29
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 99.29
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.28
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.28
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.28
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 99.28
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.28
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.28
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 99.28
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.28
4dqx_A 277 Probable oxidoreductase protein; structural genomi 99.27
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 99.27
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.27
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.27
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.27
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 99.27
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 99.27
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.27
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.27
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 99.27
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.27
1spx_A 278 Short-chain reductase family member (5L265); paral 99.26
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 99.26
1xhl_A 297 Short-chain dehydrogenase/reductase family member 99.26
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.26
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.26
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 99.26
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.25
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.25
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.25
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.25
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 99.25
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.25
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.25
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.25
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 99.25
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 99.24
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 99.24
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.24
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.24
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.23
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.23
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.23
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 99.23
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.23
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.23
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 99.22
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 99.22
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 99.22
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.22
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.22
1xq1_A 266 Putative tropinone reducatse; structural genomics, 99.22
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.22
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.22
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.22
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.22
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.21
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.21
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.21
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.21
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.21
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.21
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.21
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.21
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 99.21
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.21
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.21
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.21
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.2
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.2
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 99.2
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 99.19
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.18
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.18
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.17
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.17
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.17
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 99.16
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.16
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.15
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 99.15
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.15
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.15
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 99.14
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.14
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.14
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.14
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 99.14
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.14
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.13
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 99.13
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 99.12
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.11
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.11
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 99.11
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 99.1
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.1
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 99.07
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 99.06
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.06
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.05
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.02
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.02
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 99.01
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.01
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.0
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 98.99
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 98.98
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.98
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.89
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 98.87
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.86
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.86
4e4y_A 244 Short chain dehydrogenase family protein; structur 98.86
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 98.83
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.83
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 98.82
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 98.81
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.81
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.81
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 98.8
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.78
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.78
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 98.77
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.74
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 98.74
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 98.73
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.73
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.72
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.72
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.71
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.69
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 98.67
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 98.66
1xq6_A 253 Unknown protein; structural genomics, protein stru 98.66
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 98.65
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.64
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.63
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.63
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.63
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 98.6
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.59
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.59
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 98.59
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 98.57
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.57
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.56
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 98.55
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.54
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 98.53
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.53
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 98.51
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.51
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.51
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 98.51
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.51
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 98.51
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 98.5
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 98.5
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 98.49
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 98.49
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.48
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 98.47
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 98.47
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 98.46
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 98.46
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 98.46
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 98.44
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 98.43
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 98.42
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.42
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.42
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.41
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.41
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 98.4
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 98.4
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 98.4
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.4
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.39
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.39
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 98.38
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.38
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 98.38
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 98.37
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 98.36
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.36
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 98.35
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.35
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.31
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 98.31
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 98.29
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 98.29
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 98.29
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 98.28
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 98.28
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 98.27
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 98.27
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 98.26
4f6c_A 427 AUSA reductase domain protein; thioester reductase 98.26
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 98.26
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 98.24
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 98.22
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.21
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.21
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.19
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 98.18
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 98.17
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 98.16
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 98.13
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 98.12
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.11
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.07
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.04
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.04
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.03
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.01
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 97.98
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.98
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.97
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 97.93
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 97.92
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 97.91
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 97.85
4f6l_B 508 AUSA reductase domain protein; thioester reductase 97.83
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 97.82
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.77
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 97.71
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.67
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 97.64
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.62
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 97.55
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.52
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 97.5
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.5
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.42
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 97.38
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.36
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.34
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 97.23
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.16
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.15
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.12
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.07
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.07
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.07
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.01
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.98
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.95
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.94
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.84
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.84
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 96.81
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 96.8
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.73
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 96.69
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 96.67
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.66
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.65
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.59
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.59
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.53
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.5
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 96.49
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.42
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.34
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.28
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.22
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.17
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.03
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.97
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.96
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 95.82
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.77
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.7
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.65
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 95.62
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 95.61
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 95.57
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.54
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.49
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 95.37
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 95.3
1lnq_A 336 MTHK channels, potassium channel related protein; 95.26
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.24
1p9o_A 313 Phosphopantothenoylcysteine synthetase; ligase; 2. 95.22
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.16
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.16
3fbg_A346 Putative arginate lyase; structural genomics, unkn 95.05
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 94.99
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.95
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 94.93
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 94.9
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.84
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 94.82
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 94.58
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.43
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 94.35
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.34
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 94.33
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 94.28
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.1
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 94.01
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 93.89
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 93.88
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 93.72
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 93.69
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 93.55
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 93.34
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.31
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 93.28
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 93.25
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 93.15
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.08
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 92.82
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.73
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 92.57
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 92.55
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 92.48
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.33
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 92.18
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 92.08
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 92.06
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 92.03
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 91.94
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 91.86
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 91.79
2rir_A300 Dipicolinate synthase, A chain; structural genomic 91.74
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 91.74
3p2o_A285 Bifunctional protein fold; structural genomics, ce 91.4
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 91.3
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 91.29
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 91.28
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 91.26
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 91.19
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 91.14
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 91.11
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 90.98
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 90.97
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 90.96
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 90.88
3qha_A 296 Putative oxidoreductase; seattle structural genomi 90.78
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 90.72
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 90.52
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 90.42
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 90.4
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 90.23
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 90.17
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.08
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 90.01
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 89.95
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 89.85
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 89.78
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 89.65
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 89.65
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 89.61
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 89.59
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 89.59
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 89.58
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 89.48
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 89.38
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 89.37
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 89.36
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 89.31
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 89.3
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 89.22
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 89.05
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 88.88
3l07_A285 Bifunctional protein fold; structural genomics, ID 88.86
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 88.82
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 88.76
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 88.64
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 88.56
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 88.56
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 88.53
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 88.47
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 88.44
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 88.38
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 88.33
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 88.32
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 88.3
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 88.13
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 88.1
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 88.09
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 88.03
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 88.03
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 87.8
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 87.79
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 87.75
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 87.67
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 87.65
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 87.56
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 87.47
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 87.45
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 87.45
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 87.39
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 87.38
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 87.29
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 87.23
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 87.23
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 87.06
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 87.05
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 87.04
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 87.04
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 87.0
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 86.85
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 86.84
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 86.64
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 86.54
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 86.5
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 86.47
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=99.52  E-value=6.9e-14  Score=115.46  Aligned_cols=83  Identities=14%  Similarity=0.119  Sum_probs=70.6

Q ss_pred             cCCCCEEEEecCCChhHHHHHHHHHHcCCeEEEEeCCCCCCCCcccccccchhhHHHHHHHHHHHHhhhhhccccccccC
Q psy11303         47 VGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAKLKSCQNHLLSASVNLDDS  126 (166)
Q Consensus        47 ~~~~k~vlITG~~~giG~~la~~l~~~G~~Vi~~~r~~~~~~~~~~~~~~~~~~~~~~L~~~~~~l~~~~~~~~~~~~~~  126 (166)
                      .+++|+++|||+++|||+++|+.|++.|++|++.+|+.+                  .+++..+++++.           
T Consensus         4 sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~~~------------------~~~~~~~~i~~~-----------   54 (254)
T 4fn4_A            4 SLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLED------------------RLNQIVQELRGM-----------   54 (254)
T ss_dssp             GGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHH------------------HHHHHHHHHHHT-----------
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHH------------------HHHHHHHHHHhc-----------
Confidence            368999999999999999999999999999999999872                  244444555543           


Q ss_pred             CCceEEEEEecCCChHHHHHHHHHHHHhCCCCC
Q psy11303        127 NVLKVITLPLDVTREDSLHEAVDIIRRHLPAGE  159 (166)
Q Consensus       127 ~~~~v~~~~~Dvt~~~si~~~v~~i~~~~g~~~  159 (166)
                       +.++.++++||+|+++++++++.+.++||.-+
T Consensus        55 -g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iD   86 (254)
T 4fn4_A           55 -GKEVLGVKADVSKKKDVEEFVRRTFETYSRID   86 (254)
T ss_dssp             -TCCEEEEECCTTSHHHHHHHHHHHHHHHSCCC
T ss_pred             -CCcEEEEEccCCCHHHHHHHHHHHHHHcCCCC
Confidence             56799999999999999999999999998643



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.56
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.55
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 99.53
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.53
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.53
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.53
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 99.52
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 99.52
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.52
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.52
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 99.52
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.51
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.51
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.51
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.5
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 99.5
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.5
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.5
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.5
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.5
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.49
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.49
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.48
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 99.48
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 99.48
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.48
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 99.47
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.47
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.47
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.47
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.46
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 99.45
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 99.45
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.44
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 99.43
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.43
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.42
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.42
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.41
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 99.4
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.38
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.38
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 99.36
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.36
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.33
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.31
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.28
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.28
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.26
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.23
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.22
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.17
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.16
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 99.16
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.09
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.08
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 99.07
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.06
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 99.03
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.02
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.99
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.93
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 98.8
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.75
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.66
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.66
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 98.61
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.59
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.56
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.54
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 98.45
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.38
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.37
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.36
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.33
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.3
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.3
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 98.29
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.26
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.25
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 98.23
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.16
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.1
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.0
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 97.99
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.96
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 97.83
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.82
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.82
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 97.79
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.76
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.76
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 97.56
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.32
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.29
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 97.18
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.16
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.12
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 97.0
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.99
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.92
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.84
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.81
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.8
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.76
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.76
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.7
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.65
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 96.37
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 96.33
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.12
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.09
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.99
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.93
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.79
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.36
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.36
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.24
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.21
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.99
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.78
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.74
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.64
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.46
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.46
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 94.05
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.01
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 93.88
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.86
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.67
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.6
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.58
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.57
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 93.5
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.49
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.44
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.42
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.3
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.28
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.24
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 93.22
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.21
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.15
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.11
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 92.74
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.67
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.65
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.47
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.41
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.38
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.28
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 92.27
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.19
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.04
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.03
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 91.98
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.91
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 91.88
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 91.84
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.76
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 91.72
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.58
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 91.37
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.34
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.32
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 91.29
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 91.21
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 91.19
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.14
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 91.08
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.08
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 90.94
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 90.54
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 90.41
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.35
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.22
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.84
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.52
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 89.38
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 89.3
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 89.09
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 88.89
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 88.87
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.72
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 88.65
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.64
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.63
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 88.62
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 88.45
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 87.87
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 87.57
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 87.5
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 87.48
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 87.32
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.08
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 86.88
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.71
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.66
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 86.45
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 86.33
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 86.21
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 85.95
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 85.62
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 85.28
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.77
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 84.6
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 84.55
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.43
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 84.23
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 84.11
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 83.85
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 83.81
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.79
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 83.0
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 82.94
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 82.74
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.62
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.58
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 82.57
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 82.1
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 81.96
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 81.76
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 81.53
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 81.35
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 81.25
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 81.14
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 80.84
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 80.74
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 80.65
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 80.43
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: 17-beta-hydroxysteroid dehydrogenase type XI
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.56  E-value=1.2e-14  Score=116.92  Aligned_cols=83  Identities=17%  Similarity=0.185  Sum_probs=70.5

Q ss_pred             cCCCCEEEEecCCChhHHHHHHHHHHcCCeEEEEeCCCCCCCCcccccccchhhHHHHHHHHHHHHhhhhhccccccccC
Q psy11303         47 VGTARSILITSCETALGLQLALHFSSLGFRVFAGFKPSGGENKSECKSEESKSDAYKILRAKLKSCQNHLLSASVNLDDS  126 (166)
Q Consensus        47 ~~~~k~vlITG~~~giG~~la~~l~~~G~~Vi~~~r~~~~~~~~~~~~~~~~~~~~~~L~~~~~~l~~~~~~~~~~~~~~  126 (166)
                      .++||+++||||++|||+++|++|++.|++|++.+|+.+                  .+++..+++++.           
T Consensus         4 ~l~Gkv~lITGas~GIG~~ia~~la~~G~~V~l~~r~~~------------------~l~~~~~~~~~~-----------   54 (244)
T d1yb1a_           4 SVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKH------------------GLEETAAKCKGL-----------   54 (244)
T ss_dssp             CCTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHH------------------HHHHHHHHHHHT-----------
T ss_pred             CCCCCEEEEeCCCcHHHHHHHHHHHHCCCEEEEEECCHH------------------HHHHHHHHHHhc-----------
Confidence            368999999999999999999999999999999999872                  244434455443           


Q ss_pred             CCceEEEEEecCCChHHHHHHHHHHHHhCCCCC
Q psy11303        127 NVLKVITLPLDVTREDSLHEAVDIIRRHLPAGE  159 (166)
Q Consensus       127 ~~~~v~~~~~Dvt~~~si~~~v~~i~~~~g~~~  159 (166)
                       +.+++++.||++|+++++++++.+.+++|..+
T Consensus        55 -~~~~~~~~~Dvs~~~~v~~~~~~i~~~~g~id   86 (244)
T d1yb1a_          55 -GAKVHTFVVDCSNREDIYSSAKKVKAEIGDVS   86 (244)
T ss_dssp             -TCCEEEEECCTTCHHHHHHHHHHHHHHTCCCS
T ss_pred             -CCcEEEEEeeCCCHHHHHHHHHHHHHHcCCCc
Confidence             56799999999999999999999999998654



>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure