Psyllid ID: psy11311

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MSEFIVALFPKGLNKSLAECVGESEAFPPPLDLDIEWNDDVTHDDDEDSAGDESDEDSLCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTKRNPQESSAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPESSAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLRPES
cHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEEccccccccEEEEcHHHHHHcccccEEEEEEccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHcHHHHHHHccccccccHHHHHccHHHHcccccEEEEEcccccccccccccccccccccccccccHHHHHHHHHccccccEEEEcccccccccccEEEEEccccEEEEEEccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEccEEEEEEEEccccccccEEEEcccccccccEEEEEEEccccEEEEEEEcccEEEEEccccc
ccHHHHHHccHcccccccHHccccccccccccccHHHHHHccccccccccccccHHHHHcccEEEEEEcccccccccEEEEEccccccccEEEHHHHHHHccccEEEEEEcccEEEccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHcccHHHccHHcHcccccccccHHHHHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHcccccccccccccccccHcEEEcccccccHHHHHHHHcccEEEEEEEEEccccccccEEEEEEcccccEEEEHHHHHHHccccccccccccccccccccEEEEEEEEccccccEEEEEccccEEEEEEcccccEEccEEEEEcccccccEEEEEEEEccccEEEEEEEccEEEEEEccccc
MSEFIVALFPKGLNKSLAEcvgeseafpppldldiewnddvthdddedsagdesdedslcNKLCTYTITQKEfmnqhwyhchtckmidgvgvCSVCAqvchknhdityskfgnffcdcgakengqclaltkrnpqessaamssaslshqesssmpsslrqrssfepilsnsyhymyddnyygynqIKIENLreklgpessaamssaslshqesssmpsslrqrssfepilsnsyhymyddnyygynqIKIENLreklgpvspniFDRIWEILPPILEVFKEMTPALKAgiaktspvgvfdrvshgLFQLQNMQHKfventdnlmvpvmgsqegaFENVRMNLNGDQGQTIRQLISNNSIRRTCMcilsspqskrqHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILsveanpcneELLAVCGLKECIVFSFtsgmsqatdsitinphcetsnYIIKalwipgrqSTLAIVTALNIKIYQLRPES
MSEFIVALFPKGLNKSLAECVGESEAFPPPLDLDIEWNDDVTHDDDEdsagdesdedslCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTKRNPQESSAAMSSASlshqesssmpsslrqrsSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPESSAAMSSASLShqesssmpsslrqrsSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKiyqlrpes
MSEFIVALFPKGLNKSLAECVGESEAFPPPLDLDIEWNDDVTHdddedsagdesdedsLCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTKRNPQEssaamssaslshqesssmpsslrqrssFEPILsnsyhymyddnyygynQIKIENLREKLGPEssaamssaslshqesssmpsslrqrssFEPILsnsyhymyddnyygynQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLRPES
***FIVALFPKGLNKSLAECVGES*AF***LDLDIEW*********************LCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLAL*************************************ILSNSYHYMYDDNYYGYNQIKIENL*************************************ILSNSYHYMYDDNYYGYNQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSS*****QHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQL****
*SEFI*A****************************EWND*******************LCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLAL********************************************************************************************************************************GPVSPNIFDRIWEILPPILEVFKEMTP************************LQNMQHKFVENTDNLMVPVMGSQEGA***************IRQLISNNSIRRTCMCIL**************HEKGKITLLQLSG**************IKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLRP**
MSEFIVALFPKGLNKSLAECVGESEAFPPPLDLDIEWNDDVTH**************SLCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTKR*****************************SSFEPILSNSYHYMYDDNYYGYNQIKIENLREKL****************************SSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSP*********VSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLRPES
*SEFIVALFPKGLNKSLA**VG**EAFPPPLDLDIEWNDDVTH*******GDESDEDSLCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTK*****************************************HYMYDDNYYGYNQIKIENLREKLGPESSAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEFIVALFPKGLNKSLAECVGESEAFPPPLDLDIEWNDDVTHDDDEDSAGDESDEDSLCNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTKRNPQESSAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPESSAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGPVSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLRPES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query499 2.2.26 [Sep-21-2011]
Q2TL32 5194 E3 ubiquitin-protein liga yes N/A 0.803 0.077 0.464 1e-112
A2AN08 5180 E3 ubiquitin-protein liga yes N/A 0.803 0.077 0.464 1e-112
Q5T4S7 5183 E3 ubiquitin-protein liga yes N/A 0.809 0.077 0.453 1e-110
Q29L39 5381 Protein purity of essence yes N/A 0.436 0.040 0.529 7e-59
Q9VLT5 5322 Protein purity of essence yes N/A 0.436 0.040 0.524 2e-58
Q54QG5 5875 Probable E3 ubiquitin-pro yes N/A 0.188 0.016 0.416 2e-20
Q9SRU2 5098 Auxin transport protein B yes N/A 0.210 0.020 0.429 1e-19
B9G2A8 4965 Auxin transport protein B yes N/A 0.226 0.022 0.401 8e-19
Q80TP3 2792 E3 ubiquitin-protein liga no N/A 0.124 0.022 0.380 1e-08
O95071 2799 E3 ubiquitin-protein liga no N/A 0.124 0.022 0.380 1e-08
>sp|Q2TL32|UBR4_RAT E3 ubiquitin-protein ligase UBR4 OS=Rattus norvegicus GN=Ubr4 PE=2 SV=2 Back     alignment and function desciption
 Score =  405 bits (1041), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 293/476 (61%), Gaps = 75/476 (15%)

Query: 22   GESEAFPPPLDLDIEWNDDVTHDDDEDSAGDESDEDSLCNKLCTYTITQKEFMNQHWYHC 81
            GE  A    +++D +W +++  ++ EDS  ++SDEDSLCNKLCT+TITQKEFMNQHWYHC
Sbjct: 1626 GEERA----IEVDSDWVEELAVEE-EDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHC 1680

Query: 82   HTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAKENGQCLALTKRNPQESSAAM 141
            HTCKM+DGVGVC+VCA+VCHK+H+I+Y+K+G+FFCDCGAKE+G CLAL KR P       
Sbjct: 1681 HTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTP------- 1733

Query: 142  SSASLSHQESSSMPSSLRQRSSF--EPILSNSYHYMYDDNYYGYNQIKIENLREKLGPES 199
                     SS M S++++ S+F  EP +S S                + +       ++
Sbjct: 1734 ---------SSGMSSTMKE-SAFQSEPRVSESL---------------VRHASTSPADKA 1768

Query: 200  SAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMYDDNYYGYNQIKIENLREKLGP 259
               +S   ++ +E     S  R                            +E  RE+L  
Sbjct: 1769 KVTISDGKVADEEKPKKSSLCR---------------------------TVEGCREELQN 1801

Query: 260  VSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVEN 319
             +   F       P +L++   +  A++    + S VG   R    L +L  +  K VE 
Sbjct: 1802 QANFSFA------PLVLDMLNFLMDAIQTNFQQASAVGSSSRAQQALSELHTVD-KVVEM 1854

Query: 320  TDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVA 379
            TD LMVP +GSQEGAFENVRMN +GDQGQTIRQLIS + +RR  MC+LSSP  +RQHL A
Sbjct: 1855 TDQLMVPTLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHL-A 1913

Query: 380  VSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLK 439
            VSHEKGKIT+LQLS LLKQ DSSKRKLTL +LAS  +P T+LS+  NPC E+ LAVCGLK
Sbjct: 1914 VSHEKGKITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLK 1973

Query: 440  ECIVFSFTSGMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQL 495
            +C V +F+S  S  +D + ++P   T N+IIKA+W+PG Q+ LAIVTA  +KIY L
Sbjct: 1974 DCHVLTFSSSGS-VSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDL 2028
E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Regulates integrin-mediated signaling. May play a role in activation of FAK in response to cell-matrix interactions.
Rattus norvegicus (taxid: 10116)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|A2AN08|UBR4_MOUSE E3 ubiquitin-protein ligase UBR4 OS=Mus musculus GN=Ubr4 PE=1 SV=1 Back     alignment and function description
>sp|Q5T4S7|UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens GN=UBR4 PE=1 SV=1 Back     alignment and function description
>sp|Q29L39|POE_DROPS Protein purity of essence OS=Drosophila pseudoobscura pseudoobscura GN=poe PE=3 SV=1 Back     alignment and function description
>sp|Q9VLT5|POE_DROME Protein purity of essence OS=Drosophila melanogaster GN=poe PE=1 SV=1 Back     alignment and function description
>sp|Q54QG5|Y3893_DICDI Probable E3 ubiquitin-protein ligase DDB_G0283893 OS=Dictyostelium discoideum GN=DDB_G0283893 PE=3 SV=2 Back     alignment and function description
>sp|Q9SRU2|BIG_ARATH Auxin transport protein BIG OS=Arabidopsis thaliana GN=BIG PE=1 SV=2 Back     alignment and function description
>sp|B9G2A8|BIG_ORYSJ Auxin transport protein BIG OS=Oryza sativa subsp. japonica GN=Os09g0247700 PE=2 SV=1 Back     alignment and function description
>sp|Q80TP3|UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus GN=Ubr5 PE=1 SV=2 Back     alignment and function description
>sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
427788303 5397 Putative e3 ubiquitin-protein ligase ubr 0.863 0.079 0.487 1e-121
241013980 3788 hypothetical protein IscW_ISCW016136 [Ix 0.851 0.112 0.480 1e-119
307167934 5256 Protein purity of essence [Camponotus fl 0.859 0.081 0.462 1e-113
189535964 5143 PREDICTED: e3 ubiquitin-protein ligase U 0.805 0.078 0.472 1e-111
444728092 4591 E3 ubiquitin-protein ligase UBR4 [Tupaia 0.803 0.087 0.466 1e-110
383416997 5182 E3 ubiquitin-protein ligase UBR4 [Macaca 0.803 0.077 0.464 1e-110
402853165 5182 PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu 0.803 0.077 0.464 1e-110
147742911 5194 RecName: Full=E3 ubiquitin-protein ligas 0.803 0.077 0.464 1e-110
84781733 5194 E3 ubiquitin-protein ligase UBR4 [Rattus 0.803 0.077 0.464 1e-110
297282358 5171 PREDICTED: e3 ubiquitin-protein ligase U 0.803 0.077 0.464 1e-110
>gi|427788303|gb|JAA59603.1| Putative e3 ubiquitin-protein ligase ubr4 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 244/501 (48%), Positives = 314/501 (62%), Gaps = 70/501 (13%)

Query: 12   GLNKSLAE---CVGESEAFPPPLD-------LDIEWNDDVTHDDDEDSAGDESDEDSLCN 61
            G  K LAE    VG S A  PPLD        D +W D++  +DDE S G++SDEDSLCN
Sbjct: 1622 GSLKLLAERPLIVGRSGAASPPLDGDGQHPEPDSDWADELGPEDDE-SGGEDSDEDSLCN 1680

Query: 62   KLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQVCHKNHDITYSKFGNFFCDCGAK 121
            KLCT+T+TQKEFMNQHWYHCHTC+M+DGVGVC++CA+VCHK+HD+TY+KFG+FFCDCGAK
Sbjct: 1681 KLCTFTMTQKEFMNQHWYHCHTCRMVDGVGVCTICAKVCHKDHDVTYAKFGSFFCDCGAK 1740

Query: 122  ENGQCLALTKRNPQESS-----AAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHYMY 176
            E+G C AL KRNPQ SS     +A ++A+ S    + +PSS+R+R+S  P+         
Sbjct: 1741 EDGSCQALVKRNPQISSDTGPVSASTTAAFSLPSENVLPSSMRRRTS-SPVQGPGS---- 1795

Query: 177  DDNYYGYNQIKIENLREKLGPESSAAMSSASLSHQESSSMPSSLRQRSSFEPILSNSYHY 236
                               GP SSAA             M +S+  + + E  L +    
Sbjct: 1796 -------------------GPGSSAA--------DARPPMATSVDSKKATEETLKHRQQL 1828

Query: 237  MYDDNYYGYNQIKIENLREKLGP--VSPNIFDRIWEILPPILEVFKEMTPALKAGIAKTS 294
                        K+E  R  L    VS N+   +       LE+ + + PA+     + S
Sbjct: 1829 AK----------KLEAFRGALVEHIVSTNLVGTV-------LELIQFLMPAIVETYNRNS 1871

Query: 295  PVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGAFENVRMNLNGDQGQTIRQLI 354
            P+G   R    L +L   Q K  E+ D LMVP +GSQEGAFENVRMN +G+QGQTIRQL+
Sbjct: 1872 PIGSSTRAQKALAELHT-QEKLFEHVDQLMVPTLGSQEGAFENVRMNFSGEQGQTIRQLL 1930

Query: 355  SNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASV 414
            S + IRR  MC L+SPQ KRQHL AVSHEKGKITLLQLS LLKQ DSSKRKLT+ +LAS 
Sbjct: 1931 SAHMIRRVAMCCLASPQGKRQHL-AVSHEKGKITLLQLSALLKQADSSKRKLTITRLASA 1989

Query: 415  SLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQATDSITINPHCETSNYIIKALW 474
             +P T+LS+  NPCNE+ LAVCGLK+C V +F+S  S  ++ + ++P  ET NYIIKA+W
Sbjct: 1990 PVPFTVLSITGNPCNEDFLAVCGLKDCHVLTFSSSGS-VSEHLVLHPQLETGNYIIKAMW 2048

Query: 475  IPGRQSTLAIVTALNIKIYQL 495
            +PG Q+ LA+VTA  +K+Y L
Sbjct: 2049 LPGSQTELALVTADFVKVYDL 2069

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|241013980|ref|XP_002405559.1| hypothetical protein IscW_ISCW016136 [Ixodes scapularis] gi|215491764|gb|EEC01405.1| hypothetical protein IscW_ISCW016136 [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307167934|gb|EFN61308.1| Protein purity of essence [Camponotus floridanus] Back     alignment and taxonomy information
>gi|189535964|ref|XP_693147.3| PREDICTED: e3 ubiquitin-protein ligase UBR4 [Danio rerio] Back     alignment and taxonomy information
>gi|444728092|gb|ELW68556.1| E3 ubiquitin-protein ligase UBR4 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|383416997|gb|AFH31712.1| E3 ubiquitin-protein ligase UBR4 [Macaca mulatta] Back     alignment and taxonomy information
>gi|402853165|ref|XP_003891270.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UBR4 [Papio anubis] Back     alignment and taxonomy information
>gi|147742911|sp|Q2TL32.2|UBR4_RAT RecName: Full=E3 ubiquitin-protein ligase UBR4; AltName: Full=N-recognin-4; AltName: Full=Zinc finger UBR1-type protein 1 Back     alignment and taxonomy information
>gi|84781733|ref|NP_001034115.1| E3 ubiquitin-protein ligase UBR4 [Rattus norvegicus] gi|61380888|gb|AAX45146.1| ZUBR1 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|297282358|ref|XP_002802257.1| PREDICTED: e3 ubiquitin-protein ligase UBR4-like [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
ZFIN|ZDB-GENE-090313-341 5152 ubr4 "ubiquitin protein ligase 0.436 0.042 0.583 2.2e-97
UNIPROTKB|Q5T4S7 5183 UBR4 "E3 ubiquitin-protein lig 0.440 0.042 0.569 5.9e-97
RGD|1563121 5194 Ubr4 "ubiquitin protein ligase 0.440 0.042 0.569 7.6e-97
UNIPROTKB|Q2TL32 5194 Ubr4 "E3 ubiquitin-protein lig 0.440 0.042 0.569 7.6e-97
UNIPROTKB|G3N0A8 4028 UBR4 "Uncharacterized protein" 0.440 0.054 0.565 8.4e-97
UNIPROTKB|E2RF02 5181 UBR4 "Uncharacterized protein" 0.440 0.042 0.569 9.6e-97
MGI|MGI:1916366 5180 Ubr4 "ubiquitin protein ligase 0.440 0.042 0.569 1.2e-96
UNIPROTKB|F1P2G5 5201 UBR4 "Uncharacterized protein" 0.440 0.042 0.569 1.2e-96
UNIPROTKB|E1BHT5 5186 UBR4 "Uncharacterized protein" 0.440 0.042 0.565 1.6e-96
FB|FBgn0011230 5322 poe "purity of essence" [Droso 0.436 0.040 0.524 2.3e-86
ZFIN|ZDB-GENE-090313-341 ubr4 "ubiquitin protein ligase E3 component n-recognin 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 633 (227.9 bits), Expect = 2.2e-97, Sum P(2) = 2.2e-97
 Identities = 129/221 (58%), Positives = 161/221 (72%)

Query:   275 ILEVFKEMTPALKAGIAKTSPVGVFDRVSHGLFQLQNMQHKFVENTDNLMVPVMGSQEGA 334
             +LE+   +  A++    + S VG   R  H L +L   Q K VE TD LMVP +GSQEGA
Sbjct:  1787 VLELLIFLMDAIQTNFQQASAVGSSSRAQHALNELHT-QDKTVEMTDQLMVPTLGSQEGA 1845

Query:   335 FENVRMNLNGDQGQTIRQLISNNSIRRTCMCILSSPQSKRQHLVAVSHEKGKITLLQLSG 394
             FENVRMN +GDQGQTIRQLIS + +RR  MC+LSSP  +RQHL AVSHEKGKIT+LQLS 
Sbjct:  1846 FENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHL-AVSHEKGKITVLQLSA 1904

Query:   395 LLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTSGMSQAT 454
             LLKQ DSSKRKLTL +LAS  +P T+LS+  NPCNE+ LAVCGLK+C V +F+S  S  +
Sbjct:  1905 LLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCNEDYLAVCGLKDCHVLTFSSTGS-VS 1963

Query:   455 DSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQL 495
             D + ++P   T N+IIKA+W+PG Q+ LAI+TA  +KIY L
Sbjct:  1964 DHLVLHPQLATGNFIIKAIWLPGSQTELAIITADFVKIYDL 2004
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
UNIPROTKB|Q5T4S7 UBR4 "E3 ubiquitin-protein ligase UBR4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1563121 Ubr4 "ubiquitin protein ligase E3 component n-recognin 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TL32 Ubr4 "E3 ubiquitin-protein ligase UBR4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3N0A8 UBR4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF02 UBR4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1916366 Ubr4 "ubiquitin protein ligase E3 component n-recognin 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2G5 UBR4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHT5 UBR4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0011230 poe "purity of essence" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29L39POE_DROPSNo assigned EC number0.52940.43680.0405yesN/A
Q9VLT5POE_DROMENo assigned EC number0.52480.43680.0409yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
smart0039671 smart00396, ZnF_UBR1, Putative zinc finger in N-re 5e-16
pfam0220771 pfam02207, zf-UBR, Putative zinc finger in N-recog 1e-13
>gnl|CDD|197698 smart00396, ZnF_UBR1, Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway Back     alignment and domain information 
 Score = 72.1 bits (177), Expect = 5e-16
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 62  KLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQ-VCHKNHDITYS-KFGNFFCDCG 119
            +C Y  T  E +    Y C TC +     +CS C +  CHK HD++     G+  CDCG
Sbjct: 1   DVCGYKFTGGEVI----YRCKTCGLDPTCVLCSDCFRPSCHKGHDVSLKTSRGSGICDCG 56

Query: 120 AKE 122
            KE
Sbjct: 57  DKE 59

Domain is involved in recognition of N-end rule substrates in yeast Ubr1p. Length = 71
>gnl|CDD|216929 pfam02207, zf-UBR, Putative zinc finger in N-recognin (UBR box) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 499
KOG2752|consensus345 99.59
PF0220771 zf-UBR: Putative zinc finger in N-recognin (UBR bo 99.45
KOG1777|consensus625 99.36
KOG0943|consensus 3015 99.29
smart0039671 ZnF_UBR1 Putative zinc finger in N-recognin, a rec 99.28
KOG1776|consensus1110 98.41
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 97.65
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.38
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 94.21
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 94.21
PTZ00421 493 coronin; Provisional 93.38
PLN00181 793 protein SPA1-RELATED; Provisional 92.78
KOG4460|consensus 741 92.68
PRK11028 330 6-phosphogluconolactonase; Provisional 91.83
PTZ00421 493 coronin; Provisional 91.75
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 91.74
PTZ00420 568 coronin; Provisional 91.74
KOG0269|consensus 839 90.51
PRK11028 330 6-phosphogluconolactonase; Provisional 89.36
KOG0264|consensus422 88.35
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 87.75
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 86.89
PF0064342 zf-B_box: B-box zinc finger; InterPro: IPR000315 Z 86.58
KOG0310|consensus 487 84.26
KOG4378|consensus 673 83.82
PTZ00420 568 coronin; Provisional 83.67
KOG0279|consensus 315 83.39
PLN00181793 protein SPA1-RELATED; Provisional 82.61
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 82.4
>KOG2752|consensus Back     alignment and domain information 
Probab=99.59  E-value=2e-16  Score=159.33  Aligned_cols=79  Identities=33%  Similarity=0.770  Sum_probs=69.7

Q ss_pred             cccCCCCCccccccccccc-ccceeeccCCCCCC-CceeehhhhhhhcCCCeEE--EeecCceEeeCCCCC--CCcceec
Q psy11311         56 EDSLCNKLCTYTITQKEFM-NQHWYHCHTCKMID-GVGVCSVCAQVCHKNHDIT--YSKFGNFFCDCGAKE--NGQCLAL  129 (499)
Q Consensus        56 e~~l~~~~CTf~~TG~~~i-rQ~~Y~C~TC~~~~-~~gIC~aCA~vCH~GHdLv--y~K~r~F~CDCG~~k--~~~Ckll  129 (499)
                      ........|||.   +||+ ||.+|.|+||.|.. -+|||++|+..||.||+++  |+| |+|+||||+.+  ..+|.++
T Consensus        35 L~~~~~~~CTy~---~Gy~~rQ~l~sClTC~P~~~~agvC~~C~~~CH~~H~lveL~tK-R~FrCDCg~sk~g~~sc~l~  110 (345)
T KOG2752|consen   35 LGTQNPDVCTYA---KGYKKRQALFSCLTCTPAPEMAGVCYACSLSCHDGHELVELYTK-RNFRCDCGNSKFGRCSCNLL  110 (345)
T ss_pred             cCCCCCcccccc---cCcccccceeEeecccCChhhceeEEEeeeeecCCceeeecccc-CCcccccccccccccccccc
Confidence            334568899999   9997 89999999999998 5899999999999999998  999 99999999999  5677779


Q ss_pred             ccCCCCCCc
Q psy11311        130 TKRNPQESS  138 (499)
Q Consensus       130 ~~K~~~~~~  138 (499)
                      ..++..|+.
T Consensus       111 ~~~~~~n~~  119 (345)
T KOG2752|consen  111 EDKDAENSE  119 (345)
T ss_pred             cccccccch
Confidence            988877653

>PF02207 zf-UBR: Putative zinc finger in N-recognin (UBR box); InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1777|consensus Back     alignment and domain information
>KOG0943|consensus Back     alignment and domain information
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway Back     alignment and domain information
>KOG1776|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
3ny3_A75 E3 ubiquitin-protein ligase UBR2; zinc finger-like 2e-10
3nis_A82 E3 ubiquitin-protein ligase UBR1; E3 ubiquitin lig 8e-08
>3ny3_A E3 ubiquitin-protein ligase UBR2; zinc finger-like, ubiquitin ligase, protein binding, lygase,; 1.60A {Homo sapiens} PDB: 3ny2_A 3ny1_A Length = 75 Back     alignment and structure
 Score = 56.1 bits (135), Expect = 2e-10
 Identities = 19/73 (26%), Positives = 24/73 (32%), Gaps = 10/73 (13%)

Query: 60  CNKLCTYTITQKEFMNQHWYHCHTCKMIDGVGVCSVCAQV-CHKNHDIT-YSKFGNFFCD 117
              LC       E      Y C  C +     +C  C     H++H     +  G  FCD
Sbjct: 3   LGSLCGRVFKVGEPT----YSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCD 58

Query: 118 CG----AKENGQC 126
           CG     KE   C
Sbjct: 59  CGDTEAWKEGPYC 71
>3nis_A E3 ubiquitin-protein ligase UBR1; E3 ubiquitin ligase, UBR BOX, zinc-binding protein, N-END RU ligase, metal binding protein; 1.68A {Saccharomyces cerevisiae} PDB: 3nii_A 3nij_A 3nih_A 3nik_A 3nim_A 3nin_A 3nil_A 3nit_A Length = 82 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
3ny3_A75 E3 ubiquitin-protein ligase UBR2; zinc finger-like 98.17
3nis_A82 E3 ubiquitin-protein ligase UBR1; E3 ubiquitin lig 98.0
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.8
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.71
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.64
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 96.43
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.16
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 96.1
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 96.04
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 96.02
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.96
3jrp_A 379 Fusion protein of protein transport protein SEC13 95.95
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.9
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.8
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.75
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.7
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.68
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 95.64
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.63
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 95.6
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.59
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.57
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.31
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 95.28
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.27
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.21
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 95.13
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 95.07
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.07
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.98
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.81
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.78
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.76
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.74
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.74
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.72
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.72
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.71
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 94.58
3jrp_A379 Fusion protein of protein transport protein SEC13 94.52
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.43
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 94.41
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.41
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.31
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.3
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.28
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 94.26
2pm7_B297 Protein transport protein SEC13, protein transport 94.24
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 94.24
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.2
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.17
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.1
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.07
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.04
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 94.01
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 93.91
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.9
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 93.88
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.88
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.79
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.74
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.69
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.54
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.54
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.52
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.46
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.42
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.32
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.29
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 93.2
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 93.16
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 93.14
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 93.11
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.09
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 93.04
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 93.03
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 93.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 92.96
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.94
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.91
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 92.89
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 92.85
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 92.8
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.8
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 92.59
3ow8_A321 WD repeat-containing protein 61; structural genomi 92.41
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.35
3jro_A 753 Fusion protein of protein transport protein SEC13 92.25
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 92.23
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.18
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.16
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 92.08
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.02
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 92.01
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 91.87
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 91.71
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 91.53
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 91.48
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 91.43
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.34
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 91.27
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 91.01
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 90.94
2pm7_B297 Protein transport protein SEC13, protein transport 90.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 90.66
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 90.56
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 90.51
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 90.14
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 89.99
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 89.62
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.58
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 89.34
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 89.19
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 89.07
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 88.99
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 88.85
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 88.82
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 88.81
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 88.71
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 88.23
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 88.12
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 88.09
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 87.72
3jro_A 753 Fusion protein of protein transport protein SEC13 87.53
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 87.48
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 87.02
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.68
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 85.93
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 85.85
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 84.91
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 84.69
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 84.12
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 83.16
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.05
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 82.69
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 81.79
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 81.62
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 81.17
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 80.64
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 80.55
>3ny3_A E3 ubiquitin-protein ligase UBR2; zinc finger-like, ubiquitin ligase, protein binding, lygase,; 1.60A {Homo sapiens} PDB: 3ny2_A 3ny1_A Back     alignment and structure
Probab=98.17  E-value=1.5e-06  Score=71.22  Aligned_cols=56  Identities=29%  Similarity=0.624  Sum_probs=46.1

Q ss_pred             cc-ccceeeccCCCCCCCceeehhhhhh-hcCCCeEEEee-cCceEeeCCCCC----CCccee
Q psy11311         73 FM-NQHWYHCHTCKMIDGVGVCSVCAQV-CHKNHDITYSK-FGNFFCDCGAKE----NGQCLA  128 (499)
Q Consensus        73 ~i-rQ~~Y~C~TC~~~~~~gIC~aCA~v-CH~GHdLvy~K-~r~F~CDCG~~k----~~~Ckl  128 (499)
                      +. ....|+|+||..++.-.+|..|... -|+||++.+.. ...+.||||...    .+.|+.
T Consensus        11 f~~ge~~Y~C~~C~~d~tc~lC~~CF~~~~H~gH~~~~~~s~~gG~CDCGD~eawk~~~fC~~   73 (75)
T 3ny3_A           11 FKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQK   73 (75)
T ss_dssp             CCTTCEEEEETTTBSSTTCCBCHHHHHTSGGGGSCEEEEECCSCBBCCTTCTTTBSSCCSCTT
T ss_pred             ccCCCEEEECccCCCCCCeeEChHHCCCCCcCCceEEEEEcCCCCEecCcCHHHcCCCCCCCC
Confidence            43 6679999999999999999999965 99999997443 467899999986    566754
>3nis_A E3 ubiquitin-protein ligase UBR1; E3 ubiquitin ligase, UBR BOX, zinc-binding protein, N-END RU ligase, metal binding protein; 1.68A {Saccharomyces cerevisiae} PDB: 3nii_A 3nij_A 3nih_A 3nik_A 3nim_A 3nin_A 3nil_A 3nit_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.77
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.64
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.49
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.38
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.04
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.61
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 94.61
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.35
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.13
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.89
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.8
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 93.53
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.37
d1tbga_340 beta1-subunit of the signal-transducing G protein 92.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 92.49
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.4
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.19
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.19
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 91.29
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 91.22
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.13
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 91.0
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.63
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 89.08
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 88.67
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.46
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.26
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 87.31
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 85.17
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 85.14
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 84.86
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 82.66
d2csva159 Tripartite motif-containing protein 29 {Human (Hom 81.5
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 81.38
d2dq5a147 Midline-1 {Human (Homo sapiens) [TaxId: 9606]} 80.6
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 80.48
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.3
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: Cell cycle arrest protein BUB3
domain: Cell cycle arrest protein BUB3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.77  E-value=0.041  Score=45.27  Aligned_cols=111  Identities=14%  Similarity=0.035  Sum_probs=66.8

Q ss_pred             CcccccceEEEEeecCCeEEEeehhhhcccccccccccccccccccccceeEEEeeecCCCcceeeeeccceeEEEEecC
Q psy11311        369 SPQSKRQHLVAVSHEKGKITLLQLSGLLKQIDSSKRKLTLIKLASVSLPITILSVEANPCNEELLAVCGLKECIVFSFTS  448 (499)
Q Consensus       369 sp~g~rq~LvAVshEk~KVtllqls~LLkqadss~~Kltl~rLs~~~VpF~Vlsl~~NP~ne~~LAV~GlkeC~Vlti~~  448 (499)
                      ||.|  ..| |++...|.|-|.++..--         .+.+......-.-.|.+|+|+|..+.+|+++|. |..|...+.
T Consensus        20 sp~~--~~L-~s~s~Dg~v~iwd~~~~~---------~~~~~~~~~~h~~~V~~v~f~~~~~~~l~sg~~-d~~v~~w~~   86 (342)
T d1yfqa_          20 IPSK--SLL-LITSWDGSLTVYKFDIQA---------KNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTV-QGEILKVDL   86 (342)
T ss_dssp             EGGG--TEE-EEEETTSEEEEEEEETTT---------TEEEEEEEEECSSCEEEEEEEESSSEEEEEEET-TSCEEEECS
T ss_pred             eCCC--CEE-EEEECCCeEEEEEccCCC---------cceEEEEecCCCCCEEEEEEeCCCCCEEEEccc-ccceeeeec
Confidence            6655  345 777788999999874311         111111111234469999999987777777764 455555554


Q ss_pred             CCCcccceeeeccccCCCceeEeeEEecCCCceEEEeecCceEEeecC
Q psy11311        449 GMSQATDSITINPHCETSNYIIKALWIPGRQSTLAIVTALNIKIYQLR  496 (499)
Q Consensus       449 ~G~~v~d~l~i~l~l~~~~fIik~~Wipgsq~~LAVvT~~fVKIYDLs  496 (499)
                      ...    ..................|.++....++......|+|||+.
T Consensus        87 ~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~wd~~  130 (342)
T d1yfqa_          87 IGS----PSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPR  130 (342)
T ss_dssp             SSS----SSEEECBSCCCCSCEEEEEEETTTEEEEEETTSEEEEECHH
T ss_pred             ccc----cccccccccccccccccccccccccccccccccccceeecc
Confidence            333    12222222234445556677777767777778889999974
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure