Psyllid ID: psy11337

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MSVPPPNETTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEEcccccHHHHHHHHHcccc
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHccccccccccEcccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEEcccccHHHHHHHHccccc
msvpppnettarldacgllgpaKREEWLQLRAEIESVTDNWLSLAIKCLTLinqrpsctnVIVITTQLIPALSKIMLFGlsgifdveniysstkigkdsCFERIVTRFGRKCTYVVIGDGQDEEAAAkqrnfpfwrissRSDLAALYHALDNGFL
msvpppnettarldacglLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYsstkigkdscFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
MSVPPPNETTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
************LDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHAL*****
*********TARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
**********ARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
********TTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVPPPNETTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
Q05201766 Developmental protein eye yes N/A 0.890 0.180 0.688 2e-56
Q99502592 Eyes absent homolog 1 OS= no N/A 0.941 0.246 0.643 3e-53
P97767591 Eyes absent homolog 1 OS= yes N/A 0.941 0.247 0.636 5e-53
Q9Z191616 Eyes absent homolog 4 OS= no N/A 0.941 0.237 0.643 6e-52
O95677639 Eyes absent homolog 4 OS= no N/A 0.941 0.228 0.636 4e-51
O08575532 Eyes absent homolog 2 OS= no N/A 0.941 0.274 0.609 1e-50
O00167538 Eyes absent homolog 2 OS= no N/A 0.941 0.271 0.609 5e-50
Q58DB6537 Eyes absent homolog 2 OS= no N/A 0.941 0.271 0.602 5e-50
Q99504573 Eyes absent homolog 3 OS= no N/A 0.896 0.242 0.618 9e-49
P97480510 Eyes absent homolog 3 OS= no N/A 0.896 0.272 0.618 1e-48
>sp|Q05201|EYA_DROME Developmental protein eyes absent OS=Drosophila melanogaster GN=eya PE=1 SV=1 Back     alignment and function desciption
 Score =  217 bits (553), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 95/138 (68%), Positives = 117/138 (84%)

Query: 18  LLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIML 77
           LLGP KRE WLQ+R+EIE  TDNW +LA+KCL++I+QR +C NV+V +TQL PAL+K++L
Sbjct: 629 LLGPGKREAWLQIRSEIEVATDNWATLALKCLSMISQRENCVNVLVTSTQLAPALAKVLL 688

Query: 78  FGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRI 137
           FGL GIF++ENIYS+ KIG ++C+ERIVTRFGRK TYVVIGDG +EE AAK  NFPFWRI
Sbjct: 689 FGLGGIFNIENIYSAHKIGHETCYERIVTRFGRKSTYVVIGDGNEEETAAKAMNFPFWRI 748

Query: 138 SSRSDLAALYHALDNGFL 155
           S+ SD+ ALY ALD GFL
Sbjct: 749 SAHSDIRALYTALDMGFL 766
Thought to play a role in transcription regulation during organogenesis through its intrinsic protein phosphatase activity. The phosphatase activity was shown in vitro. Appears to function together with So and Dac in eye development. Required for the survival of eye progenitor cells at a critical stage in morphogenesis.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q99502|EYA1_HUMAN Eyes absent homolog 1 OS=Homo sapiens GN=EYA1 PE=1 SV=2 Back     alignment and function description
>sp|P97767|EYA1_MOUSE Eyes absent homolog 1 OS=Mus musculus GN=Eya1 PE=1 SV=3 Back     alignment and function description
>sp|Q9Z191|EYA4_MOUSE Eyes absent homolog 4 OS=Mus musculus GN=Eya4 PE=2 SV=2 Back     alignment and function description
>sp|O95677|EYA4_HUMAN Eyes absent homolog 4 OS=Homo sapiens GN=EYA4 PE=1 SV=2 Back     alignment and function description
>sp|O08575|EYA2_MOUSE Eyes absent homolog 2 OS=Mus musculus GN=Eya2 PE=1 SV=1 Back     alignment and function description
>sp|O00167|EYA2_HUMAN Eyes absent homolog 2 OS=Homo sapiens GN=EYA2 PE=1 SV=2 Back     alignment and function description
>sp|Q58DB6|EYA2_BOVIN Eyes absent homolog 2 OS=Bos taurus GN=EYA2 PE=2 SV=1 Back     alignment and function description
>sp|Q99504|EYA3_HUMAN Eyes absent homolog 3 OS=Homo sapiens GN=EYA3 PE=1 SV=3 Back     alignment and function description
>sp|P97480|EYA3_MOUSE Eyes absent homolog 3 OS=Mus musculus GN=Eya3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
91086857 628 PREDICTED: eyes absent [Tribolium castan 0.896 0.221 0.769 6e-60
405958410 658 Eyes absent-like protein 1 [Crassostrea 0.929 0.218 0.680 8e-58
357624926 649 putative eyes absent [Danaus plexippus] 0.896 0.214 0.712 2e-57
321478905253 eye-absent 1-like protein [Daphnia pulex 0.896 0.549 0.719 4e-57
443734220 376 hypothetical protein CAPTEDRAFT_218995 [ 0.948 0.390 0.687 7e-57
241802307 266 eyes absent 1 protein, putative [Ixodes 0.922 0.537 0.701 1e-56
115938067 601 PREDICTED: eyes absent homolog 1 isoform 0.896 0.231 0.661 3e-55
390362134 595 PREDICTED: eyes absent homolog 1 isoform 0.896 0.233 0.661 4e-55
328782306 528 PREDICTED: eyes absent homolog 4 [Apis m 0.929 0.272 0.666 7e-55
383860598 528 PREDICTED: eyes absent homolog 4-like [M 0.948 0.278 0.653 9e-55
>gi|91086857|ref|XP_974387.1| PREDICTED: eyes absent [Tribolium castaneum] gi|270010998|gb|EFA07446.1| eyes absent [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 107/139 (76%), Positives = 124/139 (89%)

Query: 17  GLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIM 76
           GLLG  KRE+WLQLRAEIE+VTDNWL+LA KCLTLIN R +C NV+V TTQLIPAL+K++
Sbjct: 490 GLLGSNKREQWLQLRAEIEAVTDNWLTLANKCLTLINSRTNCVNVLVTTTQLIPALAKVL 549

Query: 77  LFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWR 136
           LFGL G+F ++NIYS+TKIGK+SCFERIV RFGRKCTYVVIGDGQDEEAAAK  NFPFWR
Sbjct: 550 LFGLGGVFPIDNIYSATKIGKESCFERIVARFGRKCTYVVIGDGQDEEAAAKAMNFPFWR 609

Query: 137 ISSRSDLAALYHALDNGFL 155
           I+S S++AALY+ALD  FL
Sbjct: 610 ITSHSEIAALYNALDMDFL 628

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|405958410|gb|EKC24540.1| Eyes absent-like protein 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|357624926|gb|EHJ75518.1| putative eyes absent [Danaus plexippus] Back     alignment and taxonomy information
>gi|321478905|gb|EFX89861.1| eye-absent 1-like protein [Daphnia pulex] Back     alignment and taxonomy information
>gi|443734220|gb|ELU18292.1| hypothetical protein CAPTEDRAFT_218995 [Capitella teleta] Back     alignment and taxonomy information
>gi|241802307|ref|XP_002400814.1| eyes absent 1 protein, putative [Ixodes scapularis] gi|215510867|gb|EEC20320.1| eyes absent 1 protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|115938067|ref|XP_789024.2| PREDICTED: eyes absent homolog 1 isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390362134|ref|XP_003730081.1| PREDICTED: eyes absent homolog 1 isoform 1 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|328782306|ref|XP_395983.4| PREDICTED: eyes absent homolog 4 [Apis mellifera] Back     alignment and taxonomy information
>gi|383860598|ref|XP_003705776.1| PREDICTED: eyes absent homolog 4-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
ZFIN|ZDB-GENE-990712-18609 eya1 "eyes absent homolog 1" [ 0.948 0.241 0.646 3.6e-50
FB|FBgn0000320766 eya "eyes absent" [Drosophila 0.890 0.180 0.688 4.8e-50
UNIPROTKB|F1NDB9602 Gga.2329 "Uncharacterized prot 0.896 0.230 0.676 6.7e-49
UNIPROTKB|F1Q2Y0621 EYA1 "Uncharacterized protein" 0.896 0.223 0.676 8.5e-49
UNIPROTKB|F1MKX9584 EYA1 "Uncharacterized protein" 0.896 0.238 0.669 1.1e-48
UNIPROTKB|A6NCB9586 EYA1 "cDNA FLJ61289, highly si 0.896 0.237 0.669 2.3e-48
UNIPROTKB|E7EQM5558 EYA1 "Eyes absent homolog 1" [ 0.896 0.249 0.669 2.3e-48
UNIPROTKB|F8WB53591 EYA1 "Eyes absent homolog 1" [ 0.896 0.235 0.669 2.3e-48
UNIPROTKB|Q99502592 EYA1 "Eyes absent homolog 1" [ 0.896 0.234 0.669 2.3e-48
MGI|MGI:109344591 Eya1 "eyes absent 1 homolog (D 0.896 0.235 0.661 2.9e-48
ZFIN|ZDB-GENE-990712-18 eya1 "eyes absent homolog 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 522 (188.8 bits), Expect = 3.6e-50, P = 3.6e-50
 Identities = 95/147 (64%), Positives = 122/147 (82%)

Query:     9 TTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQL 68
             TT + +  GLLGPAKRE WLQLRAEIE++TD+WL+LA+K LTLI+ R +C N++V TTQL
Sbjct:   463 TTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALTLIHSRSNCVNILVTTTQL 522

Query:    69 IPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAK 128
             IPAL+K++L+GL  +F +ENIYS+TKIGK+SCFER++ RFGRK  YVV+GDG +EE  +K
Sbjct:   523 IPALAKVLLYGLGVVFPIENIYSATKIGKESCFERVIQRFGRKVVYVVVGDGVEEEQGSK 582

Query:   129 QRNFPFWRISSRSDLAALYHALDNGFL 155
             + N PFWRISS SDL AL+HALD  +L
Sbjct:   583 KHNMPFWRISSHSDLMALHHALDLEYL 609
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0021984 "adenohypophysis development" evidence=IGI;IMP
GO:0042472 "inner ear morphogenesis" evidence=IMP
GO:0071600 "otic vesicle morphogenesis" evidence=IMP
GO:0048840 "otolith development" evidence=IMP
GO:0042471 "ear morphogenesis" evidence=IMP
FB|FBgn0000320 eya "eyes absent" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDB9 Gga.2329 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2Y0 EYA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKX9 EYA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6NCB9 EYA1 "cDNA FLJ61289, highly similar to Eyes absent homolog 1 (EC 3.1.3.48)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQM5 EYA1 "Eyes absent homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8WB53 EYA1 "Eyes absent homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q99502 EYA1 "Eyes absent homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:109344 Eya1 "eyes absent 1 homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q05201EYA_DROME3, ., 1, ., 3, ., 4, 80.68840.89030.1801yesN/A
P97767EYA1_MOUSE3, ., 1, ., 3, ., 4, 80.63690.94190.2470yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
TIGR01658274 TIGR01658, EYA-cons_domain, eyes absent protein co 3e-62
>gnl|CDD|233514 TIGR01658, EYA-cons_domain, eyes absent protein conserved domain Back     alignment and domain information 
 Score =  192 bits (489), Expect = 3e-62
 Identities = 60/156 (38%), Positives = 82/156 (52%), Gaps = 16/156 (10%)

Query: 16  CGLLGPAKREEWLQLRAEIESVTDNWLSLAIKC---------------LTLINQRPSCTN 60
             LL P   E   +L +E +  TD WLS A+K                L  I+ R +C N
Sbjct: 119 GPLLDPESMEALDELYSETDVYTDRWLSSALKFLEQCSCVEESSDGTSLIEISSRDNCIN 178

Query: 61  VIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGR-KCTYVVIGD 119
           V+V + QLIP+L+K +LF L  IF +EN+YSS K+GK  CF+ I  RFG  K  +  IGD
Sbjct: 179 VLVTSGQLIPSLAKCLLFRLDTIFRIENVYSSIKVGKLQCFKWIKERFGHPKVRFCAIGD 238

Query: 120 GQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL 155
           G +E  AA+  N+PF +I    D +  +  L    L
Sbjct: 239 GWEECTAAQAMNWPFVKIDLHPDSSHRFPGLTLKTL 274

This domain is common to all eyes absent (EYA) homologs. Metazoan EYA's also contain a variable N-terminal domain consisting largely of low-complexity sequences. Length = 274

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
TIGR01658274 EYA-cons_domain eyes absent protein conserved doma 100.0
KOG3107|consensus468 100.0
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.87
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 97.74
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 97.7
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 97.67
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 97.67
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 97.53
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 97.48
PRK13288214 pyrophosphatase PpaX; Provisional 97.44
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 97.38
PRK14988224 GMP/IMP nucleotidase; Provisional 97.37
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 97.35
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 97.34
PHA02597197 30.2 hypothetical protein; Provisional 97.3
PRK13222226 phosphoglycolate phosphatase; Provisional 97.25
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.24
PLN02770248 haloacid dehalogenase-like hydrolase family protei 97.2
PRK09449224 dUMP phosphatase; Provisional 97.12
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 97.1
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 97.05
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 97.03
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 96.97
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 96.84
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 96.82
PRK10563221 6-phosphogluconate phosphatase; Provisional 96.8
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.79
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 96.78
PRK13225273 phosphoglycolate phosphatase; Provisional 96.69
PLN02575381 haloacid dehalogenase-like hydrolase 96.59
PLN02779286 haloacid dehalogenase-like hydrolase family protei 96.34
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 96.29
PLN02940 382 riboflavin kinase 96.26
PLN02811220 hydrolase 96.26
PRK13226229 phosphoglycolate phosphatase; Provisional 96.19
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 96.16
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 95.99
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 95.96
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 95.89
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 95.81
PRK11587218 putative phosphatase; Provisional 95.81
PRK10748238 flavin mononucleotide phosphatase; Provisional 95.73
PRK13223272 phosphoglycolate phosphatase; Provisional 95.72
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 95.51
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 95.25
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 95.08
PRK06769173 hypothetical protein; Validated 94.88
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 94.58
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 94.52
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 94.22
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 93.96
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 93.64
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 93.55
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 93.44
PLN02954224 phosphoserine phosphatase 93.2
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 92.99
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 92.92
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 92.87
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 92.62
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 92.34
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 92.14
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 92.13
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 91.3
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 90.92
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 90.77
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 90.41
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 89.41
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 88.85
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 88.28
COG0546220 Gph Predicted phosphatases [General function predi 87.92
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 87.35
PHA02530300 pseT polynucleotide kinase; Provisional 87.23
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 86.52
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 86.07
PRK13582205 thrH phosphoserine phosphatase; Provisional 85.12
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 84.35
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 83.86
PRK11133322 serB phosphoserine phosphatase; Provisional 83.23
PLN02645311 phosphoglycolate phosphatase 82.86
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 82.76
PRK01158230 phosphoglycolate phosphatase; Provisional 81.64
COG5439112 Uncharacterized conserved protein [Function unknow 80.97
cd01973454 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -li 80.74
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 80.53
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain Back     alignment and domain information 
Probab=100.00  E-value=2e-75  Score=495.18  Aligned_cols=147  Identities=41%  Similarity=0.630  Sum_probs=142.6

Q ss_pred             cchhhhhhcccccCChhhHHHHHHHHHHhHHhhhHHHHHHHHH---------------HhhhhcCCCceEEEEeCCCchH
Q psy11337          6 PNETTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKC---------------LTLINQRPSCTNVIVITTQLIP   70 (155)
Q Consensus         6 ~~y~~Y~~nv~~Ll~~~~r~~w~~lr~e~e~~Td~WLs~A~k~---------------L~~i~~r~~~vNVLVTt~qLVp   70 (155)
                      |+|++|   |++|||+++|+.|++||+|||.+||+|||+|+||               +++|++|+||||||||||||||
T Consensus       112 e~Y~~~---v~~lL~~~~~~~w~~L~~e~d~~TD~WLs~A~k~l~~~~~~~~~~~~~~~~~i~sr~~~vNvLVTs~qLVP  188 (274)
T TIGR01658       112 EIYEKG---LGPLLDPESMEALDELYSETDVYTDRWLSSALKFLEQCSCVEESSDGTSLIEISSRDNCINVLVTSGQLIP  188 (274)
T ss_pred             HHHHhh---hhhccCHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHhhccccccccccchhccccCCceeEEEEEcCccHH
Confidence            455555   9999999999999999999999999999999999               8889999999999999999999


Q ss_pred             HHHHHHHhhcccccccCccccccccChhhHHHHHHHHhCC-CceEEEecCCHHHHHHHHHcCCceeEecccccHHHHHHH
Q psy11337         71 ALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGR-KCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHA  149 (155)
Q Consensus        71 aLaK~LLygL~~~fpieNIYSa~k~GKescFerI~~RFG~-k~~yvvIGDG~eEe~aAk~~~~PFwrI~~~~Dl~~L~~a  149 (155)
                      |||||||||||++|||||||||+|+|||||||||++|||+ ||+|||||||+|||+|||+||||||||++|||+.+||+|
T Consensus       189 aLaKcLLy~L~~~f~ieNIYSa~kvGK~~cFe~I~~Rfg~p~~~f~~IGDG~eEe~aAk~l~wPFw~I~~h~Dl~~l~~a  268 (274)
T TIGR01658       189 SLAKCLLFRLDTIFRIENVYSSIKVGKLQCFKWIKERFGHPKVRFCAIGDGWEECTAAQAMNWPFVKIDLHPDSSHRFPG  268 (274)
T ss_pred             HHHHHHHhccCCccccccccchhhcchHHHHHHHHHHhCCCCceEEEeCCChhHHHHHHhcCCCeEEeecCCCHHHhCcc
Confidence            9999999999999999999999999999999999999987 999999999999999999999999999999999999999


Q ss_pred             hhcCCC
Q psy11337        150 LDNGFL  155 (155)
Q Consensus       150 l~~~~l  155 (155)
                      |++++|
T Consensus       269 L~l~~l  274 (274)
T TIGR01658       269 LTLKTL  274 (274)
T ss_pred             CCcCCC
Confidence            999986

This domain is common to all eyes absent (EYA) homologs. Metazoan EYA's also contain a variable N-terminal domain consisting largely of low-complexity sequences.
>KOG3107|consensus Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG5439 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01973 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -like: Nitrogenase VFe protein, beta subunit like Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
3hb0_A274 Structure Of Edeya2 Complexed With Bef3 Length = 27 9e-51
3geb_A274 Crystal Structure Of Edeya2 Length = 274 1e-50
4egc_B294 Crystal Structure Of Mbp-fused Human Six1 Bound To 1e-50
>pdb|3HB0|A Chain A, Structure Of Edeya2 Complexed With Bef3 Length = 274 Back     alignment and structure 
Iteration: 1

 Score =  195 bits (495), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 89/146 (60%), Positives = 114/146 (78%)
Query: 10  TARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLI 69
           T + +  GL+G  KRE WLQLRAE+E++TD WL+ ++K L LIN RP+C NV+V TTQLI
Sbjct: 129 TYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLI 188
Query: 70  PALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQ 129
           PAL+K++L+GL  +F +ENIYS+TK GK+SCFERI+ RFGRK  YVVIGDG +EE  AK+
Sbjct: 189 PALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKK 248
Query: 130 RNFPFWRISSRSDLAALYHALDNGFL 155
            N PFWRIS  +DL AL HAL+  +L
Sbjct: 249 HNMPFWRISCHADLEALRHALELEYL 274
>pdb|3GEB|A Chain A, Crystal Structure Of Edeya2 Length = 274 Back     alignment and structure
>pdb|4EGC|B Chain B, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 294 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 5e-71
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Length = 274 Back     alignment and structure
 Score =  214 bits (545), Expect = 5e-71
 Identities = 89/148 (60%), Positives = 114/148 (77%)

Query: 8   ETTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQ 67
             T + +  GL+G  KRE WLQLRAE+E++TD WL+ ++K L LIN RP+C NV+V TTQ
Sbjct: 127 YNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQ 186

Query: 68  LIPALSKIMLFGLSGIFDVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAA 127
           LIPAL+K++L+GL  +F +ENIYS+TK GK+SCFERI+ RFGRK  YVVIGDG +EE  A
Sbjct: 187 LIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGA 246

Query: 128 KQRNFPFWRISSRSDLAALYHALDNGFL 155
           K+ N PFWRIS  +DL AL HAL+  +L
Sbjct: 247 KKHNMPFWRISCHADLEALRHALELEYL 274

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 100.0
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.77
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.5
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 97.49
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.48
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 97.48
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 97.47
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 97.37
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.31
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.27
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 97.23
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 97.22
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 97.21
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.21
3sd7_A240 Putative phosphatase; structural genomics, haloaci 97.2
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 97.16
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 97.12
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 97.11
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.1
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 97.1
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 97.1
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 97.1
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 97.04
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.03
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 97.02
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 97.01
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 96.98
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 96.97
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 96.95
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 96.94
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 96.94
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 96.92
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 96.91
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 96.91
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 96.84
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 96.78
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 96.77
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 96.76
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 96.76
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 96.72
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 96.72
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 96.71
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 96.71
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 96.7
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 96.61
2zg6_A220 Putative uncharacterized protein ST2620, probable 96.58
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 96.55
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 96.53
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 96.53
1te2_A226 Putative phosphatase; structural genomics, phospha 96.49
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 96.47
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 96.46
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 96.43
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 96.36
2hsz_A243 Novel predicted phosphatase; structural genomics, 96.31
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 96.28
3mn1_A189 Probable YRBI family phosphatase; structural genom 96.22
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 96.18
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 96.13
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 96.13
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 96.12
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 96.09
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 96.04
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 96.03
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 96.03
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 96.03
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 96.02
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 96.02
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 96.0
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 95.9
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 95.79
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 95.54
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 95.5
2p11_A231 Hypothetical protein; putative haloacid dehalogena 95.42
3mmz_A176 Putative HAD family hydrolase; structural genomics 95.4
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 95.3
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 95.08
3fvv_A232 Uncharacterized protein; unknown function, structu 94.88
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 94.83
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 94.66
2o2x_A218 Hypothetical protein; structural genomics, joint c 94.0
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 93.78
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 93.6
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 93.38
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 93.08
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 93.03
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 92.76
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 91.39
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 91.09
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 90.86
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 90.31
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 89.55
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 88.32
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 88.18
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 87.75
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 87.69
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 86.16
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 85.66
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 84.73
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 83.96
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 83.83
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 80.68
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 80.13
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Back     alignment and structure
Probab=100.00  E-value=2.6e-84  Score=549.22  Aligned_cols=151  Identities=59%  Similarity=1.021  Sum_probs=150.0

Q ss_pred             CcchhhhhhcccccCChhhHHHHHHHHHHhHHhhhHHHHHHHHHHhhhhcCCCceEEEEeCCCchHHHHHHHHhhccccc
Q psy11337          5 PPNETTARLDACGLLGPAKREEWLQLRAEIESVTDNWLSLAIKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIF   84 (155)
Q Consensus         5 ~~~y~~Y~~nv~~Ll~~~~r~~w~~lr~e~e~~Td~WLs~A~k~L~~i~~r~~~vNVLVTt~qLVpaLaK~LLygL~~~f   84 (155)
                      +|+||+|||||+||||+++|++|++||+|||.+||+|||+|+|||++|++|+||+||||||||||||||||||||||++|
T Consensus       124 keiY~~y~~nv~~LL~~~~r~~w~~lr~e~e~~Td~WLs~a~k~L~~i~sr~~~vNVLVTs~qLVPaLaK~LLygL~~~f  203 (274)
T 3geb_A          124 KEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVF  203 (274)
T ss_dssp             HHHHHHHTTCHHHHHCTTHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHSTTEEEEEEESSCHHHHHHHHHHTTCTTTS
T ss_pred             HHHHhhhhcccccccCchhHHHHHHHHHHHHHHHhHHHHHHHHHHHhhccCCceeEEEEecCchHHHHHHHHHhhcccce
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCccccccccChhhHHHHHHHHhCCCceEEEecCCHHHHHHHHHcCCceeEecccccHHHHHHHhhcCCC
Q psy11337         85 DVENIYSSTKIGKDSCFERIVTRFGRKCTYVVIGDGQDEEAAAKQRNFPFWRISSRSDLAALYHALDNGFL  155 (155)
Q Consensus        85 pieNIYSa~k~GKescFerI~~RFG~k~~yvvIGDG~eEe~aAk~~~~PFwrI~~~~Dl~~L~~al~~~~l  155 (155)
                      ||||||||+|+|||||||||++||||||+|||||||+|||+|||+||||||||++|||+.+||+|||++||
T Consensus       204 pieNIYSa~kiGKesCFerI~~RFG~k~~yvvIGDG~eEe~AAk~~n~PFwrI~~h~Dl~~l~~al~l~~l  274 (274)
T 3geb_A          204 PIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL  274 (274)
T ss_dssp             CGGGEEETTTTCHHHHHHHHHHHHCTTSEEEEEESSHHHHHHHHHTTCCEEECCSHHHHHHHHHHHHHEEC
T ss_pred             ecccccchhhcCHHHHHHHHHHHhCCCceEEEECCCHHHHHHHHHcCCCeEEeecCccHHHHHHhhccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 97.98
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.79
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 97.71
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.61
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.46
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.33
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 97.23
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 97.22
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 97.11
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.97
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 96.88
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 96.82
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 96.57
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 96.46
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 96.39
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 96.32
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 96.05
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 95.62
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 93.83
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 93.54
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 93.37
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 89.95
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 82.82
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 82.53
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 81.81
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 81.77
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphonoacetaldehyde hydrolase-like
domain: Putative hydrolase SP0805
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=97.98  E-value=3.3e-05  Score=55.21  Aligned_cols=92  Identities=14%  Similarity=0.121  Sum_probs=68.1

Q ss_pred             HHHHhhhhcCCCceEEEEeCCCchHHHHHHHHhhcccccccCccccccccC--h--hhHHHHHHHHhCCCceEEEecCCH
Q psy11337         46 IKCLTLINQRPSCTNVIVITTQLIPALSKIMLFGLSGIFDVENIYSSTKIG--K--DSCFERIVTRFGRKCTYVVIGDGQ  121 (155)
Q Consensus        46 ~k~L~~i~~r~~~vNVLVTt~qLVpaLaK~LLygL~~~fpieNIYSa~k~G--K--escFerI~~RFG~k~~yvvIGDG~  121 (155)
                      .+.|..+.++ +..-+++|++. -..+-.+--++++.+|.  .|+++..++  |  ..+|+.+.++||.+. -++|||..
T Consensus        85 ~~~l~~l~~~-g~~~~i~Sn~~-~~~~~~l~~~~l~~~fd--~i~~~~~~~~~KP~p~~~~~~~~~~~~~~-~l~vgDs~  159 (187)
T d2fi1a1          85 SDLLEDISNQ-GGRHFLVSHRN-DQVLEILEKTSIAAYFT--EVVTSSSGFKRKPNPESMLYLREKYQISS-GLVIGDRP  159 (187)
T ss_dssp             HHHHHHHHHT-TCEEEEECSSC-THHHHHHHHTTCGGGEE--EEECGGGCCCCTTSCHHHHHHHHHTTCSS-EEEEESSH
T ss_pred             HHHHHHHHhh-hccccccccCc-cchhhhhhhhccccccc--cccccccccccCCCHHHHHHHHHHcCCCC-eEEEeCCH
Confidence            3444445554 67777788764 34444444788888876  588876655  4  579999999999876 48899999


Q ss_pred             HHHHHHHHcCCceeEeccccc
Q psy11337        122 DEEAAAKQRNFPFWRISSRSD  142 (155)
Q Consensus       122 eEe~aAk~~~~PFwrI~~~~D  142 (155)
                      ..-+||++.|+++.-++.-..
T Consensus       160 ~Di~aA~~aG~~~i~v~~~~~  180 (187)
T d2fi1a1         160 IDIEAGQAAGLDTHLFTSIVN  180 (187)
T ss_dssp             HHHHHHHHTTCEEEECSCHHH
T ss_pred             HHHHHHHHcCCEEEEECCCCC
Confidence            999999999999998875433
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure