Psyllid ID: psy11409

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320

MLANLVEILGGRSPYISAGLDDASLLDDFLLLLSRALVPNLGPNDILKLSFPSPPQFPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDEDKCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKPLVKEGAYDSLQTRTRVSQTSSEGRSG

ccccHHHccccccccccccccccccHHHHHHHHcccccccccccccccccccccccEEEcccccccHHHHHHHHHccccEEEEcccccccccccccccEEEEEEEcHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHccEEcccccccEEEEEcccccccccccccccccccccccEEEcccccHHHHccHHHHHHHHcccccccccccccccccccccccccccccccccccc

cHHHHHHHHccccHHHHcccccccccccccEcccEEcccccccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEccccccccccccccEEEEEEEccHHHHHHHHHHHccccccEEEEEEccccccccEEEEEEEEcccccccccccccccccEEEEccccccccHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEccHHHHHHHHHHcEEEEEcccccEEEEEccEEEcHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccccccccccc

MLANLVEIlggrspyisaglddasLLDDFLLLLSRAlvpnlgpndilklsfpsppqfplqgtphydheeitasfrrfgplvvdwphkaesksyfppkgyaflLFQDESSVQQLIDACivdedkcylcvssptikdkpvqirpwkltdadfvldasmpldprktvfvggvprpLKALELAMIMDRLYGgvcyagidtdpelkypkgagrvaFASQASYIAAISARFVQLQhgeidkrvevkpyvlddqmcdecqgvrcggkfapffcanvcclqYYCEHCWatihskpgrefhkplvkegaydslqtrtrvsqtssegrsg

MLANLVEILGGRSPYISAGLDDASLLDDFLLLLSRALVPNLGPNDILKLSFPSPPQFPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDEDKCYLCVSsptikdkpvqirpWKLTDADFVLDasmpldprktvfvggvpRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKPLVkegaydslqtrtrvsqtssegrsg

MLANLVEILGGRSPYIsaglddasllddfllllsralVPNLGPNDILKLSFPSPPQFPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDEDKCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVafasqasyiaaisaRFVQLQHGEIDKRVEVKPYVLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKPLVKEGAYDSLQTRTRVSQTSSEGRSG

****LVEILGGRSPYISAGLDDASLLDDFLLLLSRALVPNLGPNDILKLSFP****FPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDEDKCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKP*********************************

***NL**ILGGRSPYISAGLDD**********************************FPLQGTPHYDHEEITASFRRFGPLVVDWP*************YAFLLFQDESSVQQLIDACIVDEDKCYLC***********************************TVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKP**************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		320	2.2.26 [Sep-21-2011]
Q9VSR3		704	Probable RNA-binding prot	yes	N/A	0.743	0.338	0.894	1e-129
Q17RY0		729	Cytoplasmic polyadenylati	yes	N/A	0.743	0.326	0.869	1e-127
Q7TN98		729	Cytoplasmic polyadenylati	yes	N/A	0.743	0.326	0.869	1e-127
Q812E0		521	Cytoplasmic polyadenylati	no	N/A	0.743	0.456	0.873	1e-126
Q7Z5Q1		589	Cytoplasmic polyadenylati	no	N/A	0.771	0.419	0.850	1e-125
Q28CH2		632	Cytoplasmic polyadenylati	yes	N/A	0.743	0.376	0.861	1e-125
Q7TN99		716	Cytoplasmic polyadenylati	no	N/A	0.743	0.332	0.861	1e-125
Q8NE35		698	Cytoplasmic polyadenylati	no	N/A	0.743	0.340	0.861	1e-125
Q7SXN4		635	Cytoplasmic polyadenylati	yes	N/A	0.743	0.374	0.861	1e-125
Q6E3C9		594	Cytoplasmic polyadenylati	N/A	N/A	0.725	0.390	0.5	1e-71

>sp\|Q9VSR3\|ORB2_DROME Probable RNA-binding protein orb2 OS=Drosophila melanogaster GN=orb2 PE=1 SV=1	Back alignment and function desciption

 Score =  462 bits (1189), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 224/238 (94%)

Query: 63  PHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDED 122
           P  D +EIT SFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLID+CI DED
Sbjct: 456 PDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDED 515

Query: 123 KCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIM 182
           K YLCVSSPTIKDK VQIRPW+L DAD+VLDA+M LDPRKTVFVGGVPRPLKA ELAMIM
Sbjct: 516 KLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIM 575

Query: 183 DRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYIAAISARFVQLQHGEIDKRVEVKPY 242
           DRLYGGVCYAGIDTDPELKYPKGAGRVAF++Q SYIAAISARFVQLQHG+IDKRVEVKPY
Sbjct: 576 DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPY 635

Query: 243 VLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKPLVKEGA 300
           VLDDQMCDEC+G RCGGKFAPFFCANV CLQYYCEHCWA IHS+PGRE+HKPLVKEGA
Sbjct: 636 VLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGA 693

Drosophila melanogaster (taxid: 7227)

>sp\|Q17RY0\|CPEB4_HUMAN Cytoplasmic polyadenylation element-binding protein 4 OS=Homo sapiens GN=CPEB4 PE=1 SV=1	Back alignment and function description

>sp\|Q7TN98\|CPEB4_MOUSE Cytoplasmic polyadenylation element-binding protein 4 OS=Mus musculus GN=Cpeb4 PE=2 SV=1	Back alignment and function description

>sp\|Q812E0\|CPEB2_MOUSE Cytoplasmic polyadenylation element-binding protein 2 OS=Mus musculus GN=Cpeb2 PE=1 SV=1	Back alignment and function description

>sp\|Q7Z5Q1\|CPEB2_HUMAN Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens GN=CPEB2 PE=2 SV=3	Back alignment and function description

>sp\|Q28CH2\|CPEB3_XENTR Cytoplasmic polyadenylation element-binding protein 3 OS=Xenopus tropicalis GN=cpeb3 PE=2 SV=1	Back alignment and function description

>sp\|Q7TN99\|CPEB3_MOUSE Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus GN=Cpeb3 PE=1 SV=1	Back alignment and function description

>sp\|Q8NE35\|CPEB3_HUMAN Cytoplasmic polyadenylation element-binding protein 3 OS=Homo sapiens GN=CPEB3 PE=1 SV=2	Back alignment and function description

>sp\|Q7SXN4\|CPEB4_DANRE Cytoplasmic polyadenylation element-binding protein 4 OS=Danio rerio GN=cpeb4 PE=2 SV=1	Back alignment and function description

>sp\|Q6E3C9\|CPB1_CAERE Cytoplasmic polyadenylation element-binding protein 1 OS=Caenorhabditis remanei GN=cpb-1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		320
189233716		629	PREDICTED: similar to orb2 CG5735-PB [Tr	0.743	0.378	0.924	1e-131
322802961		346	hypothetical protein SINV_05254 [Solenop	0.743	0.687	0.928	1e-129
307206969		344	Probable RNA-binding protein orb2 [Harpe	0.743	0.691	0.928	1e-129
307170121		330	Probable RNA-binding protein orb2 [Campo	0.743	0.721	0.928	1e-129
332029245		333	Putative RNA-binding protein orb2 [Acrom	0.743	0.714	0.928	1e-128
427792633		647	Putative rna-binding protein rrm superfa	0.887	0.438	0.794	1e-128
270015159		324	orb2 [Tribolium castaneum]	0.743	0.734	0.924	1e-128
340717082		426	PREDICTED: probable RNA-binding protein	0.743	0.558	0.915	1e-128
242014017		658	cytoplasmic polyadenylation element bind	0.743	0.361	0.899	1e-128
195428447		753	GK17460 [Drosophila willistoni] gi\|19415	0.743	0.316	0.894	1e-128

>gi\|189233716\|ref\|XP_969331.2\| PREDICTED: similar to orb2 CG5735-PB [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/238 (92%), Positives = 229/238 (96%)

Query: 63  PHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDED 122
           P  D +EITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDE+SVQ LIDACI DED
Sbjct: 381 PDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDENSVQSLIDACITDED 440

Query: 123 KCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIM 182
           K YLCVSSPTIKDKPVQIRPW+L+DADFVLDASMPLDPRKTVFVGGVPRPLKA+ELAMIM
Sbjct: 441 KLYLCVSSPTIKDKPVQIRPWRLSDADFVLDASMPLDPRKTVFVGGVPRPLKAVELAMIM 500

Query: 183 DRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYIAAISARFVQLQHGEIDKRVEVKPY 242
           DRLYGGVCYAGIDTDPELKYPKGAGRVAF++Q SYIAAISARFVQLQHG+IDKRVEVKPY
Sbjct: 501 DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPY 560

Query: 243 VLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKPLVKEGA 300
           VLDDQMCDECQG RCGGKFAPFFCANV CLQYYCEHCWATIHS+PGREFHKPLVKEGA
Sbjct: 561 VLDDQMCDECQGQRCGGKFAPFFCANVTCLQYYCEHCWATIHSRPGREFHKPLVKEGA 618

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|322802961\|gb\|EFZ23098.1\| hypothetical protein SINV_05254 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|307206969\|gb\|EFN84808.1\| Probable RNA-binding protein orb2 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|307170121\|gb\|EFN62539.1\| Probable RNA-binding protein orb2 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|332029245\|gb\|EGI69228.1\| Putative RNA-binding protein orb2 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|427792633\|gb\|JAA61768.1\| Putative rna-binding protein rrm superfamily, partial [Rhipicephalus pulchellus]	Back alignment and taxonomy information

>gi\|270015159\|gb\|EFA11607.1\| orb2 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|340717082\|ref\|XP_003397017.1\| PREDICTED: probable RNA-binding protein orb2-like isoform 2 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|242014017\|ref\|XP_002427695.1\| cytoplasmic polyadenylation element binding protein, putative [Pediculus humanus corporis] gi\|212512125\|gb\|EEB14957.1\| cytoplasmic polyadenylation element binding protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|195428447\|ref\|XP_002062284.1\| GK17460 [Drosophila willistoni] gi\|194158369\|gb\|EDW73270.1\| GK17460 [Drosophila willistoni]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		320
FB\|FBgn0264307		704	orb2 [Drosophila melanogaster	0.743	0.338	0.848	2.5e-113
UNIPROTKB\|F1N436		529	F1N436 "Uncharacterized protei	0.743	0.449	0.827	5.5e-113
UNIPROTKB\|E1BT34		649	CPEB3 "Uncharacterized protein	0.740	0.365	0.818	1e-111
UNIPROTKB\|A7Z087		322	CPEB4 "CPEB4 protein" [Bos tau	0.740	0.736	0.827	5.3e-111
UNIPROTKB\|J9PAN6		721	CPEB4 "Uncharacterized protein	0.740	0.328	0.827	5.3e-111
UNIPROTKB\|B7ZLQ8		704	CPEB4 "Cytoplasmic polyadenyla	0.740	0.336	0.827	5.3e-111
UNIPROTKB\|E5RFP2		339	CPEB4 "Cytoplasmic polyadenyla	0.740	0.699	0.827	5.3e-111
UNIPROTKB\|Q17RY0		729	CPEB4 "Cytoplasmic polyadenyla	0.740	0.325	0.827	5.3e-111
UNIPROTKB\|F1SJZ5		721	CPEB4 "Uncharacterized protein	0.740	0.328	0.827	5.3e-111
MGI\|MGI:1914829		729	Cpeb4 "cytoplasmic polyadenyla	0.740	0.325	0.827	5.3e-111

FB\|FBgn0264307 orb2 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1118 (398.6 bits), Expect = 2.5e-113, P = 2.5e-113
 Identities = 202/238 (84%), Positives = 211/238 (88%)

Query:    63 PHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDED 122
             P  D +EIT SFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLID+CI DED
Sbjct:   456 PDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDED 515

Query:   123 KCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIM 182
             K YLCVSSPTIKDK VQIRPW+L DAD+VLDA+M LDPRKTVFVGGVPRPLKA ELAMIM
Sbjct:   516 KLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIM 575

Query:   183 DRLYGGVCYAGIDTDPELKYPKGAGRVXXXXXXXXXXXXXXRFVQLQHGEIDKRVEVKPY 242
             DRLYGGVCYAGIDTDPELKYPKGAGRV              RFVQLQHG+IDKRVEVKPY
Sbjct:   576 DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPY 635

Query:   243 VLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGREFHKPLVKEGA 300
             VLDDQMCDEC+G RCGGKFAPFFCANV CLQYYCEHCWA IHS+PGRE+HKPLVKEGA
Sbjct:   636 VLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGA 693

GO:0003729 "mRNA binding" evidence=ISS

GO:0000166 "nucleotide binding" evidence=IEA

GO:0007616 "long-term memory" evidence=IMP

GO:0008049 "male courtship behavior" evidence=IMP

GO:0003723 "RNA binding" evidence=ISM

GO:0003730 "mRNA 3'-UTR binding" evidence=IDA

GO:0017148 "negative regulation of translation" evidence=IDA

GO:0000900 "translation repressor activity, nucleic acid binding" evidence=IDA

GO:0044292 "dendrite terminus" evidence=IDA

GO:0043679 "axon terminus" evidence=IDA

GO:0044297 "cell body" evidence=IDA

GO:0008356 "asymmetric cell division" evidence=IMP

GO:0045202 "synapse" evidence=IDA

UNIPROTKB\|F1N436 F1N436 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BT34 CPEB3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|A7Z087 CPEB4 "CPEB4 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|J9PAN6 CPEB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|B7ZLQ8 CPEB4 "Cytoplasmic polyadenylation element-binding protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E5RFP2 CPEB4 "Cytoplasmic polyadenylation element-binding protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q17RY0 CPEB4 "Cytoplasmic polyadenylation element-binding protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SJZ5 CPEB4 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:1914829 Cpeb4 "cytoplasmic polyadenylation element binding protein 4" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q7TN98	CPEB4_MOUSE	No assigned EC number	0.8697	0.7437	0.3264	yes	N/A
Q9VSR3	ORB2_DROME	No assigned EC number	0.8949	0.7437	0.3380	yes	N/A
Q28CH2	CPEB3_XENTR	No assigned EC number	0.8613	0.7437	0.3765	yes	N/A
Q7SXN4	CPEB4_DANRE	No assigned EC number	0.8613	0.7437	0.3748	yes	N/A
Q17RY0	CPEB4_HUMAN	No assigned EC number	0.8697	0.7437	0.3264	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		320
cd12724		92	cd12724, RRM1_CPEB2_like, RNA recognition motif 1	4e-55
cd12726		81	cd12726, RRM2_CPEB2_like, RNA recognition motif 2	1e-52
cd12445		81	cd12445, RRM2_CPEBs, RNA recognition motif 2 in cy	8e-39
cd12444		112	cd12444, RRM1_CPEBs, RNA recognition motif 1 in cy	6e-30
cd12725		86	cd12725, RRM2_CPEB1, RNA recognition motif 2 in cy	6e-26
cd12723		100	cd12723, RRM1_CPEB1, RNA recognition motif 1 in cy	2e-17
smart00360		73	smart00360, RRM, RNA recognition motif	1e-04
cd12327		80	cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D	6e-04
cd12415		82	cd12415, RRM3_RBM28_like, RNA recognition motif 3	0.001
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	0.002
smart00360		73	smart00360, RRM, RNA recognition motif	0.003

>gnl\|CDD\|241168 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-2, CPEB-3, CPEB-4 and similar protiens	Back alignment and domain information

 Score =  174 bits (442), Expect = 4e-55
 Identities = 72/83 (86%), Positives = 76/83 (91%)

Query: 63  PHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDED 122
           P  D +EITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQ+ESSVQ LIDACI ++D
Sbjct: 10  PDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDD 69

Query: 123 KCYLCVSSPTIKDKPVQIRPWKL 145
           K YLCVSSPTIKDKPVQIRPW L
Sbjct: 70  KLYLCVSSPTIKDKPVQIRPWNL 92

This subgroup corresponds to the RRM1 of the paralog proteins CPEB-2, CPEB-3 and CPEB-4, all well-conserved in both, vertebrates and invertebrates. Due to the high sequence similarity, members in this family may share similar expression patterns and functions. CPEB-2 is an RNA-binding protein that is abundantly expressed in testis and localized in cytoplasm in transfected HeLa cells. It preferentially binds to poly(U) RNA oligomers and may regulate the translation of stored mRNAs during spermiogenesis. Moreover, CPEB-2 impedes target RNA translation at elongation; it directly interacts with the elongation factor, eEF2, to reduce eEF2/ribosome-activated GTP hydrolysis in vitro and inhibit peptide elongation of CPEB2-bound RNA in vivo. CPEB-3 is a sequence-specific translational regulatory protein that regulates translation in a polyadenylation-independent manner. It functions as a translational repressor that governs the synthesis of the AMPA receptor GluR2 through binding GluR2 mRNA. It also represses translation of a reporter RNA in transfected neurons and stimulates translation in response to NMDA. CPEB-4 is an RNA-binding protein that mediates meiotic mRNA cytoplasmic polyadenylation and translation. It is essential for neuron survival and present on the endoplasmic reticulum (ER). It is accumulated in the nucleus upon ischemia or the depletion of ER calcium. CPEB-4 is overexpressed in a large variety of tumors and is associated with many mRNAs in cancer cells. All family members contain an N-terminal unstructured region, two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a Zn-finger motif. In addition, they do have conserved nuclear export signals that are not present in CPEB-1. . Length = 92

>gnl\|CDD\|241170 cd12726, RRM2_CPEB2_like, RNA recognition motif 2 found in cytoplasmic polyadenylation element-binding protein CPEB-2, CPEB-3, CPEB-4 and similar protiens	Back alignment and domain information

>gnl\|CDD\|240891 cd12445, RRM2_CPEBs, RNA recognition motif 2 in cytoplasmic polyadenylation element-binding protein CPEB-1, CPEB-2, CPEB-3, CPEB-4 and similar protiens	Back alignment and domain information

>gnl\|CDD\|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-1, CPEB-2, CPEB-3, CPEB-4 and similar protiens	Back alignment and domain information

>gnl\|CDD\|241169 cd12725, RRM2_CPEB1, RNA recognition motif 2 in cytoplasmic polyadenylation element-binding protein 1 (CPEB-1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241167 cd12723, RRM1_CPEB1, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein 1 (CPEB-1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		320
KOG0129\|consensus		520		100.0
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.96
KOG4205\|consensus		311		99.96
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.95
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.95
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.94
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.93
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.92
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.92
KOG0144\|consensus		510		99.92
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.91
KOG0148\|consensus		321		99.9
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.89
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.88
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.87
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.85
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.85
KOG0131\|consensus		203		99.85
KOG0127\|consensus		678		99.84
KOG0127\|consensus		678		99.84
KOG0145\|consensus		360		99.83
KOG0109\|consensus		346		99.82
KOG0117\|consensus		506		99.81
KOG0145\|consensus		360		99.81
KOG0124\|consensus		544		99.81
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.77
KOG0123\|consensus		369		99.77
KOG0123\|consensus		369		99.76
KOG0147\|consensus		549		99.74
KOG0117\|consensus		506		99.71
KOG0149\|consensus		247		99.69
KOG0110\|consensus		725		99.64
KOG0105\|consensus		241		99.64
KOG0144\|consensus		510		99.61
KOG0148\|consensus		321		99.6
KOG0149\|consensus		247		99.59
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.59
KOG0146\|consensus		371		99.57
KOG4211\|consensus		510		99.54
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.51
COG0724		306	RNA-binding proteins (RRM domain) [General functio	99.49
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.47
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.45
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.42
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	99.38
KOG0113\|consensus		335		99.32
PLN03120		260	nucleic acid binding protein; Provisional	99.32
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	99.3
KOG4206\|consensus		221		99.3
KOG4205\|consensus		311		99.25
KOG0125\|consensus		376		99.24
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.24
PLN03120		260	nucleic acid binding protein; Provisional	99.24
KOG4212\|consensus		608		99.23
smart00362		72	RRM_2 RNA recognition motif.	99.23
PLN03121		243	nucleic acid binding protein; Provisional	99.22
COG0724		306	RNA-binding proteins (RRM domain) [General functio	99.21
KOG0122\|consensus		270		99.2
smart00360		71	RRM RNA recognition motif.	99.2
PLN03121		243	nucleic acid binding protein; Provisional	99.17
KOG0106\|consensus		216		99.17
KOG0126\|consensus		219		99.15
KOG0113\|consensus		335		99.14
smart00362		72	RRM_2 RNA recognition motif.	99.14
KOG0107\|consensus		195		99.12
KOG0107\|consensus		195		99.11
PLN03213		759	repressor of silencing 3; Provisional	99.11
KOG0110\|consensus		725		99.1
KOG0125\|consensus		376		99.1
smart00360		71	RRM RNA recognition motif.	99.09
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	99.07
KOG4210\|consensus		285		99.05
KOG0121\|consensus		153		99.02
KOG0128\|consensus		881		99.02
KOG0122\|consensus		270		99.01
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	99.0
PLN03213		759	repressor of silencing 3; Provisional	99.0
KOG0131\|consensus		203		99.0
KOG0126\|consensus		219		99.0
KOG0147\|consensus		549		98.98
KOG1457\|consensus		284		98.98
KOG0108\|consensus		435		98.98
KOG4207\|consensus		256		98.96
KOG1365\|consensus		508		98.93
KOG0121\|consensus		153		98.86
KOG0114\|consensus		124		98.85
KOG0111\|consensus		298		98.84
KOG0130\|consensus		170		98.81
smart00361		70	RRM_1 RNA recognition motif.	98.8
KOG4454\|consensus		267		98.76
KOG0111\|consensus		298		98.72
KOG0146\|consensus		371		98.72
KOG0108\|consensus		435		98.71
KOG0114\|consensus		124		98.69
KOG4212\|consensus		608		98.69
KOG4211\|consensus		510		98.68
KOG1190\|consensus		492		98.62
KOG1548\|consensus		382		98.61
smart00361		70	RRM_1 RNA recognition motif.	98.58
KOG0226\|consensus		290		98.55
KOG0105\|consensus		241		98.55
KOG4207\|consensus		256		98.5
KOG0153\|consensus		377		98.49
KOG0120\|consensus		500		98.46
KOG0415\|consensus		479		98.43
KOG0109\|consensus		346		98.4
KOG0124\|consensus		544		98.35
KOG0116\|consensus		419		98.34
KOG4208\|consensus		214		98.32
KOG0132\|consensus		894		98.31
KOG0153\|consensus		377		98.3
KOG0120\|consensus		500		98.29
KOG0132\|consensus		894		98.23
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.22
KOG4208\|consensus		214		98.2
KOG0116\|consensus		419		98.17
KOG0130\|consensus		170		98.17
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.13
KOG0129\|consensus		520		98.12
KOG4209\|consensus		231		98.11
KOG0533\|consensus		243		98.02
KOG4206\|consensus		221		98.02
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	98.01
KOG1365\|consensus		508		97.96
KOG1456\|consensus		494		97.9
KOG4454\|consensus		267		97.89
KOG0415\|consensus		479		97.89
KOG0112\|consensus		975		97.86
KOG4661\|consensus		940		97.84
KOG0226\|consensus		290		97.8
KOG0151\|consensus		877		97.74
KOG4660\|consensus		549		97.62
KOG0151\|consensus		877		97.62
KOG1457\|consensus		284		97.53
KOG4307\|consensus		944		97.52
KOG4209\|consensus		231		97.46
KOG4661\|consensus		940		97.42
KOG1190\|consensus		492		97.39
KOG0533\|consensus		243		97.37
KOG4660\|consensus		549		97.37
KOG1995\|consensus		351		97.31
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	97.23
KOG1548\|consensus		382		97.22
KOG4210\|consensus		285		96.96
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	96.91
KOG0128\|consensus		881		96.89
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	96.81
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	96.54
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	96.49
KOG0106\|consensus		216		96.42
KOG1456\|consensus		494		96.18
KOG4849\|consensus		498		96.15
KOG2314\|consensus		698		96.11
KOG1995\|consensus		351		95.94
KOG0115\|consensus		275		95.79
COG5175		480	MOT2 Transcriptional repressor [Transcription]	95.71
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	95.64
KOG4676\|consensus		479		95.41
KOG1855\|consensus		484		95.3
PF08675		87	RNA_bind: RNA binding domain; InterPro: IPR014789	95.16
PF05172		100	Nup35_RRM: Nup53/35/40-type RNA recognition motif;	94.95
KOG1855\|consensus		484		94.44
KOG2193\|consensus		584		94.31
KOG4849\|consensus		498		93.86
KOG0115\|consensus		275		93.73
PF08952		146	DUF1866: Domain of unknown function (DUF1866) ; In	93.34
PF07292		88	NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909	92.93
KOG2314\|consensus		698		92.93
COG5175		480	MOT2 Transcriptional repressor [Transcription]	92.85
PF05172		100	Nup35_RRM: Nup53/35/40-type RNA recognition motif;	92.57
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	92.44
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	92.1
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	91.29
KOG3152\|consensus		278		90.71
KOG4307\|consensus		944		90.29
KOG0112\|consensus		975		90.16
PF08675		87	RNA_bind: RNA binding domain; InterPro: IPR014789	89.79
PF03467		176	Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120	89.0
KOG2068\|consensus		327		88.39
KOG2193\|consensus		584		87.34
PF07292		88	NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909	85.23
KOG4676\|consensus		479		83.63
PF03467		176	Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120	83.36
PF15023		166	DUF4523: Protein of unknown function (DUF4523)	82.48
KOG3152\|consensus		278		82.35
KOG2202\|consensus		260		81.09
KOG2253\|consensus		668		80.68
KOG2068\|consensus		327		80.11

>KOG0129\|consensus	Back alignment and domain information

Probab=100.00  E-value=5.7e-83  Score=624.88  Aligned_cols=259  Identities=63%  Similarity=1.106  Sum_probs=252.8

Q ss_pred             CCcEEEcCCCCCCCHHHHHHHhccCCCeEEecccccCCCCCCCCcc---eEEEEeCCHHHHHHHHHhCccCCCceEEEec
Q psy11409         53 SPPQFPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKG---YAFLLFQDESSVQQLIDACIVDEDKCYLCVS  129 (320)
Q Consensus        53 ~~kvFVGgLp~dvtEe~L~~~Fs~FG~V~v~~p~k~~~~~tg~skG---ygFV~F~~eesv~kaL~~~~~~~~~~~vkis  129 (320)
                      ++||||||||||++|+.|...|.+||++.++||.|......-.++|   |+|++|++|.+|+++|.+|.+..+++|++++
T Consensus       259 S~KVFvGGlp~dise~~i~~~F~~FGs~~VdWP~k~~~~~~~ppkGs~~YvflvFe~E~sV~~Ll~aC~~~~~~~yf~vs  338 (520)
T KOG0129|consen  259 SRKVFVGGLPWDITEAQINASFGQFGSVKVDWPGKANSRGRAPPKGSYGYVFLVFEDERSVQSLLSACSEGEGNYYFKVS  338 (520)
T ss_pred             ccceeecCCCccccHHHHHhhcccccceEeecCCCccccccCCCCCcccEEEEEecchHHHHHHHHHHhhcccceEEEEe
Confidence            6799999999999999999999999999999999876555567888   9999999999999999999999999999999


Q ss_pred             CCCccCCCccccccccCCcccccCCCCCCCCCCeEEEcCCCccchHHHHHHHHhhhCCCeeEEEEecCCCCCCcceEEEE
Q psy11409        130 SPTIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRV  209 (320)
Q Consensus       130 ~~~~~~K~vqvrPw~~~d~~y~~~~~~~~~~~~tVFVGnLp~~~TeedL~~~F~~~fG~V~~v~I~~D~~tg~pkGfgfV  209 (320)
                      +++++.|.||||||+++|++|+++.++++||++||||||||+++|+++|+.||+++||.|++|.|+||++.|||||.|+|
T Consensus       339 s~~~k~k~VQIrPW~laDs~fv~d~sq~lDprrTVFVGgvprpl~A~eLA~imd~lyGgV~yaGIDtD~k~KYPkGaGRV  418 (520)
T KOG0129|consen  339 SPTIKDKEVQIRPWVLADSDFVLDHNQPIDPRRTVFVGGLPRPLTAEELAMIMEDLFGGVLYVGIDTDPKLKYPKGAGRV  418 (520)
T ss_pred             cCcccccceeEEeeEeccchhhhccCcccCccceEEecCCCCcchHHHHHHHHHHhcCceEEEEeccCcccCCCCCccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCHHHHHHHHHhcccccccCccceEEEeccccccccccccccCcccCCCcccccCCccchhhhcchhhhhhhhCCCCC
Q psy11409        210 AFASQASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMCDECQGVRCGGKFAPFFCANVCCLQYYCEHCWATIHSKPGR  289 (320)
Q Consensus       210 tF~~~esa~kAi~~~~~~i~~~~~~k~v~ikpy~~~~~~c~~c~~~~~~~~~~~y~c~~~~c~~y~c~~cw~~~h~~~~~  289 (320)
                      ||.+..+|.+||+++||+|++.+++|+||||||||||++|+||++++|+|+++||||++.+|||||||.||+++|+++++
T Consensus       419 tFsnqqsYi~AIsarFvql~h~d~~KRVEIkPYv~eDq~CdeC~g~~c~~q~aPfFC~n~~C~QYYCe~CWa~~HS~~~r  498 (520)
T KOG0129|consen  419 TFSNQQAYIKAISARFVQLDHTDIDKRVEIKPYVMEDQLCDECGGRRCGGQFAPFFCRNATCFQYYCESCWAKIHSGPGR  498 (520)
T ss_pred             eecccHHHHHHHhhheEEEeccccceeeeecceeccccchhhhcCeeccCccCCcccCCccHHhhhchHHHHHhhcCCch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccccCCCCcccccceee
Q psy11409        290 EFHKPLVKEGAYDSLQTRTRVS  311 (320)
Q Consensus       290 ~~h~p~~~~~~~~~~~~~~~~~  311 (320)
                      .+|+||+|+++.+++.+++||+
T Consensus       499 ~~HkPlvr~~~dr~~~~~~r~~  520 (520)
T KOG0129|consen  499 EHHKPLVRPGKDRPRHLPFRWS  520 (520)
T ss_pred             hcCCceecccccCCCcCCcCCC
Confidence            9999999999999999999995

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG4205\|consensus	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0144\|consensus	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0148\|consensus	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG0131\|consensus	Back alignment and domain information

>KOG0127\|consensus	Back alignment and domain information

>KOG0127\|consensus	Back alignment and domain information

>KOG0145\|consensus	Back alignment and domain information

>KOG0109\|consensus	Back alignment and domain information

>KOG0117\|consensus	Back alignment and domain information

>KOG0145\|consensus	Back alignment and domain information

>KOG0124\|consensus	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>KOG0123\|consensus	Back alignment and domain information

>KOG0123\|consensus	Back alignment and domain information

>KOG0147\|consensus	Back alignment and domain information

>KOG0117\|consensus	Back alignment and domain information

>KOG0149\|consensus	Back alignment and domain information

>KOG0110\|consensus	Back alignment and domain information

>KOG0105\|consensus	Back alignment and domain information

>KOG0144\|consensus	Back alignment and domain information

>KOG0148\|consensus	Back alignment and domain information

>KOG0149\|consensus	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG0146\|consensus	Back alignment and domain information

>KOG4211\|consensus	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG0113\|consensus	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG4206\|consensus	Back alignment and domain information

>KOG4205\|consensus	Back alignment and domain information

>KOG0125\|consensus	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG4212\|consensus	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG0122\|consensus	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0106\|consensus	Back alignment and domain information

>KOG0126\|consensus	Back alignment and domain information

>KOG0113\|consensus	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>KOG0107\|consensus	Back alignment and domain information

>KOG0107\|consensus	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>KOG0110\|consensus	Back alignment and domain information

>KOG0125\|consensus	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG4210\|consensus	Back alignment and domain information

>KOG0121\|consensus	Back alignment and domain information

>KOG0128\|consensus	Back alignment and domain information

>KOG0122\|consensus	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>KOG0131\|consensus	Back alignment and domain information

>KOG0126\|consensus	Back alignment and domain information

>KOG0147\|consensus	Back alignment and domain information

>KOG1457\|consensus	Back alignment and domain information

>KOG0108\|consensus	Back alignment and domain information

>KOG4207\|consensus	Back alignment and domain information

>KOG1365\|consensus	Back alignment and domain information

>KOG0121\|consensus	Back alignment and domain information

>KOG0114\|consensus	Back alignment and domain information

>KOG0111\|consensus	Back alignment and domain information

>KOG0130\|consensus	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG4454\|consensus	Back alignment and domain information

>KOG0111\|consensus	Back alignment and domain information

>KOG0146\|consensus	Back alignment and domain information

>KOG0108\|consensus	Back alignment and domain information

>KOG0114\|consensus	Back alignment and domain information

>KOG4212\|consensus	Back alignment and domain information

>KOG4211\|consensus	Back alignment and domain information

>KOG1190\|consensus	Back alignment and domain information

>KOG1548\|consensus	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0226\|consensus	Back alignment and domain information

>KOG0105\|consensus	Back alignment and domain information

>KOG4207\|consensus	Back alignment and domain information

>KOG0153\|consensus	Back alignment and domain information

>KOG0120\|consensus	Back alignment and domain information

>KOG0415\|consensus	Back alignment and domain information

>KOG0109\|consensus	Back alignment and domain information

>KOG0124\|consensus	Back alignment and domain information

>KOG0116\|consensus	Back alignment and domain information

>KOG4208\|consensus	Back alignment and domain information

>KOG0132\|consensus	Back alignment and domain information

>KOG0153\|consensus	Back alignment and domain information

>KOG0120\|consensus	Back alignment and domain information

>KOG0132\|consensus	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG4208\|consensus	Back alignment and domain information

>KOG0116\|consensus	Back alignment and domain information

>KOG0130\|consensus	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG0129\|consensus	Back alignment and domain information

>KOG4209\|consensus	Back alignment and domain information

>KOG0533\|consensus	Back alignment and domain information

>KOG4206\|consensus	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>KOG1365\|consensus	Back alignment and domain information

>KOG1456\|consensus	Back alignment and domain information

>KOG4454\|consensus	Back alignment and domain information

>KOG0415\|consensus	Back alignment and domain information

>KOG0112\|consensus	Back alignment and domain information

>KOG4661\|consensus	Back alignment and domain information

>KOG0226\|consensus	Back alignment and domain information

>KOG0151\|consensus	Back alignment and domain information

>KOG4660\|consensus	Back alignment and domain information

>KOG0151\|consensus	Back alignment and domain information

>KOG1457\|consensus	Back alignment and domain information

>KOG4307\|consensus	Back alignment and domain information

>KOG4209\|consensus	Back alignment and domain information

>KOG4661\|consensus	Back alignment and domain information

>KOG1190\|consensus	Back alignment and domain information

>KOG0533\|consensus	Back alignment and domain information

>KOG4660\|consensus	Back alignment and domain information

>KOG1995\|consensus	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG1548\|consensus	Back alignment and domain information

>KOG4210\|consensus	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG0128\|consensus	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>KOG0106\|consensus	Back alignment and domain information

>KOG1456\|consensus	Back alignment and domain information

>KOG4849\|consensus	Back alignment and domain information

>KOG2314\|consensus	Back alignment and domain information

>KOG1995\|consensus	Back alignment and domain information

>KOG0115\|consensus	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>KOG4676\|consensus	Back alignment and domain information

>KOG1855\|consensus	Back alignment and domain information

>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN)	Back alignment and domain information

>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []	Back alignment and domain information

>KOG1855\|consensus	Back alignment and domain information

>KOG2193\|consensus	Back alignment and domain information

>KOG4849\|consensus	Back alignment and domain information

>KOG0115\|consensus	Back alignment and domain information

>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function	Back alignment and domain information

>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi)	Back alignment and domain information

>KOG2314\|consensus	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>KOG3152\|consensus	Back alignment and domain information

>KOG4307\|consensus	Back alignment and domain information

>KOG0112\|consensus	Back alignment and domain information

>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN)	Back alignment and domain information

>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons	Back alignment and domain information

>KOG2068\|consensus	Back alignment and domain information

>KOG2193\|consensus	Back alignment and domain information

>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi)	Back alignment and domain information

>KOG4676\|consensus	Back alignment and domain information

>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons	Back alignment and domain information

>PF15023 DUF4523: Protein of unknown function (DUF4523)	Back alignment and domain information

>KOG3152\|consensus	Back alignment and domain information

>KOG2202\|consensus	Back alignment and domain information

>KOG2253\|consensus	Back alignment and domain information

>KOG2068\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		320
2dnl_A		114	Solution Structure Of Rna Binding Domain In Cytopla		4e-40

>pdb|2DNL|A Chain A, Solution Structure Of Rna Binding Domain In Cytoplasmic Polyadenylation Element Binding Protein 3 Length = 114

Back alignment and structure

Iteration: 1

Score = 161 bits (408), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 75/92 (81%), Positives = 84/92 (91%) Query: 63 PHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDED 122 P D +EITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQ+ESSVQ LIDAC+ ++ Sbjct: 18 PDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDG 77 Query: 123 KCYLCVSSPTIKDKPVQIRPWKLTDADFVLDA 154 K YLCVSSPTIKDKPVQIRPW L+D+DFV+D+ Sbjct: 78 KLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDS 109

PyMOL of 2dnl

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		320
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	9e-30
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	6e-06
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	1e-05
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	7e-04
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	2e-05
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	4e-05
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	3e-04
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	4e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-04
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	7e-04
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	9e-04

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

 Score =  108 bits (272), Expect = 9e-30
 Identities = 75/95 (78%), Positives = 84/95 (88%)

Query: 63  PHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDED 122
           P  D +EITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQ+ESSVQ LIDAC+ ++ 
Sbjct: 18  PDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDG 77

Query: 123 KCYLCVSSPTIKDKPVQIRPWKLTDADFVLDASMP 157
           K YLCVSSPTIKDKPVQIRPW L+D+DFV+D+   
Sbjct: 78  KLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDSGPS 112

PyMOL of 2dnl

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		320
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	100.0
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.98
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.97
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.97
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.97
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.97
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.97
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.96
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.96
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.96
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.95
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.95
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.95
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.95
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.94
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.94
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.93
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.93
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.93
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.93
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	99.85
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.82
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.79
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.72
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.72
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.7
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	99.7
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	99.7
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.7
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	99.69
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.68
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.68
2div_A		99	TRNA selenocysteine associated protein; structural	99.68
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	99.68
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	99.67
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.67
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	99.67
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.67
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	99.67
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.66
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	99.66
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.66
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.66
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.66
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	99.66
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.65
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.65
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.65
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.65
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.65
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.65
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.65
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.64
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.64
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.64
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	99.64
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.64
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.64
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.63
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.63
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.63
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	99.63
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.63
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.63
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.63
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.63
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.63
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.63
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.63
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.63
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.63
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.63
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.63
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.63
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.62
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.62
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.62
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.62
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.62
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.62
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.62
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	99.62
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.62
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.61
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	99.61
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.61
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	99.61
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.61
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.61
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.6
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.6
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.6
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.6
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.6
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.6
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	99.6
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.6
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.6
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	99.6
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	99.6
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.6
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.59
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.59
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	99.59
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	99.59
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	99.59
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	99.59
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.59
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.59
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.58
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.58
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.58
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.58
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.58
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.58
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.58
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.58
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.58
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	99.58
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.58
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	99.58
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.58
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.58
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.58
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	99.58
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.58
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.57
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.57
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	99.57
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	99.57
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	99.57
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.57
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	99.57
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.57
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.57
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.57
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	99.57
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.57
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.57
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.57
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.57
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.57
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.57
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.57
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.56
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.56
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.56
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.56
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.56
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	99.56
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.56
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.56
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.56
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.55
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.55
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.55
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.55
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	99.55
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	99.55
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.55
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	99.55
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.55
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.55
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.55
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.54
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.54
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.54
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.54
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.54
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.54
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.54
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	99.54
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	99.54
2div_A		99	TRNA selenocysteine associated protein; structural	99.54
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.54
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.54
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.54
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	99.54
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.54
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.54
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.54
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.53
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.53
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.53
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.53
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.53
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.53
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.53
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	99.53
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	99.53
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.52
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.52
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.52
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.52
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.52
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.52
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.52
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.52
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.52
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.52
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.52
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.52
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.52
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	99.52
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.52
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.52
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	99.52
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.52
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.52
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.52
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	99.51
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.51
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	99.51
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	99.51
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.51
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.51
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.51
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.51
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.51
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	99.51
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.51
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.51
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.51
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.51
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.51
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	99.5
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	99.5
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.5
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.5
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.5
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.5
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.5
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.5
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.5
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.5
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.49
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	99.49
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	99.49
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.49
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.49
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.49
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.49
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.49
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.48
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	99.22
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	99.48
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.48
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.48
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.48
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.48
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	99.48
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.48
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.48
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.48
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	99.48
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	99.48
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.47
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.47
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	99.47
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.47
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	99.47
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.47
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.47
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.46
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.46
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.46
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	99.46
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.45
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.45
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.45
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.45
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.45
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.44
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.44
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.44
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.44
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	99.44
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.44
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	99.44
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	99.44
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.44
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.44
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.44
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.44
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.44
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.43
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.43
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.43
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.43
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	99.43
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.43
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.42
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.42
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	99.42
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.42
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	99.42
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.42
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.42
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	99.42
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	99.41
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	99.41
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.41
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	99.41
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	99.41
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.41
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.4
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	99.4
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	99.4
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.4
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.4
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	99.4
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	99.4
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.39
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	99.39
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.38
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	99.38
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	99.07
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	99.38
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.37
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.37
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	99.37
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	99.37
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	99.37
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.36
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.36
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	99.36
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.36
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	99.35
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	99.35
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	99.35
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.35
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	99.34
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	99.34
1x5p_A		97	Negative elongation factor E; structure genomics,	99.34
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.34
1x5p_A		97	Negative elongation factor E; structure genomics,	99.3
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	99.3
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	99.3
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.3
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.29
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.28
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	99.28
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.27
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.26
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	99.25
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.25
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	99.25
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	99.25
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	99.24
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.24
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	99.23
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	99.2
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	99.19
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.19
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	99.18
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	99.14
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	99.12
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	99.12
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.11
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	99.11
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	99.11
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	99.08
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	99.07
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	99.0
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	98.99
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	98.98
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	98.96
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	98.95
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	98.9
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.79
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	98.74
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.57
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.54
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	98.49
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.35
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	98.34
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.17
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	97.95
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	97.9
2dhx_A		104	Poly (ADP-ribose) polymerase family, member 10 var	97.86
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	97.8
1whv_A		100	Poly(A)-specific ribonuclease; RNA recognition mot	97.38
3ctr_A		101	Poly(A)-specific ribonuclease PARN; protein-RNA-co	97.11
2dhx_A		104	Poly (ADP-ribose) polymerase family, member 10 var	97.04
1uw4_A		91	UPF3X; nonsense mediated mRNA decay protein, RNA-b	96.08
3pq1_A		464	Poly(A) RNA polymerase; nucleotidyl transferase, R	95.74
3pq1_A		464	Poly(A) RNA polymerase; nucleotidyl transferase, R	95.74
2l9w_A		117	U4/U6 snRNA-associated-splicing factor PRP24; RRM,	95.73
1uw4_A		91	UPF3X; nonsense mediated mRNA decay protein, RNA-b	95.49
1whv_A		100	Poly(A)-specific ribonuclease; RNA recognition mot	95.3
3ctr_A		101	Poly(A)-specific ribonuclease PARN; protein-RNA-co	93.95
1wwh_A		119	Nucleoporin 35, nucleoporin; structural genomics,	93.76
2l08_A		97	Regulator of nonsense transcripts 3A; NESG, nonsen	93.75
2l08_A		97	Regulator of nonsense transcripts 3A; NESG, nonsen	93.41
2l9w_A		117	U4/U6 snRNA-associated-splicing factor PRP24; RRM,	92.93
3p3d_A		132	Nucleoporin 53; structural genomics, PSI-2, protei	92.63
1wwh_A		119	Nucleoporin 35, nucleoporin; structural genomics,	91.57
3p3d_A		132	Nucleoporin 53; structural genomics, PSI-2, protei	89.58
3d45_A		507	Poly(A)-specific ribonuclease PARN; CAP analogue,	88.71
2d8v_A		67	Zinc finger FYVE domain-containing protein 19; zfy	84.87
3d45_A		507	Poly(A)-specific ribonuclease PARN; CAP analogue,	80.23

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

Probab=100.00  E-value=2e-32  Score=237.98  Aligned_cols=176  Identities=16%  Similarity=0.186  Sum_probs=133.4

Q ss_pred             CCCcEEEcCCCCCCCHHHHHHHhccCCCeEEecccccCCCCCCCCcceEEEEeCCHHHHHHHHHhCccCCCceEEEecCC
Q psy11409         52 PSPPQFPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDEDKCYLCVSSP  131 (320)
Q Consensus        52 ~~~kvFVGgLp~dvtEe~L~~~Fs~FG~V~v~~p~k~~~~~tg~skGygFV~F~~eesv~kaL~~~~~~~~~~~vkis~~  131 (320)
                      +.++|||||||+++|+++|+++|++||+|..+.+.++.  .+++++|||||.|.++++|++||+......++..+.+...
T Consensus        12 ~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~--~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v~~~   89 (196)
T 1l3k_A           12 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDP--NTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRA   89 (196)
T ss_dssp             GGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECT--TTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEEC
T ss_pred             CCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcC--CCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeeeecc
Confidence            46799999999999999999999999999977776653  4689999999999999999999987444333333333211


Q ss_pred             CccCCCccccccccCCcccccCCCCCCCCCCeEEEcCCCccchHHHHHHHHhhhCCCeeEEEEecCCCCCCcceEEEEEe
Q psy11409        132 TIKDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAF  211 (320)
Q Consensus       132 ~~~~K~vqvrPw~~~d~~y~~~~~~~~~~~~tVFVGnLp~~~TeedL~~~F~~~fG~V~~v~I~~D~~tg~pkGfgfVtF  211 (320)
                      ..  +...             .......+.++|||+|||.++|+++|+++|++ ||.|..+.|+.|+.++.++|||||+|
T Consensus        90 ~~--~~~~-------------~~~~~~~~~~~l~V~nLp~~~t~~~l~~~F~~-~G~i~~v~i~~~~~~g~~~g~afV~F  153 (196)
T 1l3k_A           90 VS--REDS-------------QRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQ-YGKIEVIEIMTDRGSGKKRGFAFVTF  153 (196)
T ss_dssp             CC--------------------------CCSEEEEECCTTTCCHHHHHHHHTT-TSCEEEEEEEECTTTCCEEEEEEEEE
T ss_pred             cC--cccc-------------cccccCCCcceEEEeCCCCCCCHHHHHHHHhc-CCCeEEEEEeecCCCCCccceEEEEE
Confidence            00  0000             00112234589999999999999999999998 99999999999999999999999999


Q ss_pred             cCHHHHHHHHHhcccccccCccceEEEecccccccccc
Q psy11409        212 ASQASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMC  249 (320)
Q Consensus       212 ~~~esa~kAi~~~~~~i~~~~~~k~v~ikpy~~~~~~c  249 (320)
                      .+.++|.+||+.....+.+    +.|+|+...+++++.
T Consensus       154 ~~~~~A~~A~~~~~~~~~G----~~i~v~~a~~k~~~~  187 (196)
T 1l3k_A          154 DDHDSVDKIVIQKYHTVNG----HNCEVRKALSKQEMA  187 (196)
T ss_dssp             SSHHHHHHHHHCSCCEETT----EECEEEECC------
T ss_pred             CCHHHHHHHHHhCCcEECC----EEEEEEecCChhHhc
Confidence            9999999999865444543    577888776666543

PyMOL of 1l3k

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A*	Back alignment and structure

>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens}	Back alignment and structure

>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4	Back alignment and structure

>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens}	Back alignment and structure

>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens}	Back alignment and structure

>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4	Back alignment and structure

>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A*	Back alignment and structure

>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens}	Back alignment and structure

>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii}	Back alignment and structure

>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii}	Back alignment and structure

>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus}	Back alignment and structure

>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1	Back alignment and structure

>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		320
d1x4ba1		103	d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle	3e-04
d2cqba1		89	d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer	9e-04
d1nu4a_		91	d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo	0.001
d1u1qa_		183	d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1	0.003
d2cqca1		83	d.58.7.1 (A:109-191) Arginine/serine-rich splicing	0.003
d2f9da1		114	d.58.7.1 (A:12-125) Pre-mRNA branch site protein p	0.004

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Heterogeneous nuclear ribonucleoproteins A2/B1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.4 bits (86), Expect = 3e-04
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 159 DPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFASQASYI 218
           +  + +F+GG+        L    ++ +G +    +  DP  K  +G G V F+S A   
Sbjct: 18  EQFRKLFIGGLSFETTEESLRNYYEQ-WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVD 76

Query: 219 AAISARFVQLQHGEIDKRVEVKP 241
           AA++AR   +      + VE K 
Sbjct: 77  AAMAARPHSID----GRVVEPKR 95

PyMOL of d1x4ba1

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		320
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	100.0
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.81
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	99.8
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.79
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	99.78
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	99.77
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.76
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.74
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	99.74
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.74
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.73
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	99.72
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.72
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.72
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.72
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.71
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	99.71
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	99.71
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.71
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.7
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.7
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.69
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.69
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.69
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.69
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.68
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.68
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.68
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	99.68
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.68
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.68
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.68
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.67
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.67
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.67
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.67
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	99.66
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.66
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.66
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.66
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.66
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.65
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.65
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.65
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.65
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.64
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.64
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	99.64
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.64
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.64
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.63
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.63
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.63
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.63
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.63
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	99.63
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.62
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.62
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.62
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.62
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.62
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.62
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.62
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.62
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.61
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.61
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.61
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.61
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.61
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.61
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.6
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.6
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.59
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.59
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	99.59
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.58
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.58
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.58
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.58
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.58
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.58
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	99.57
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.57
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.57
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.57
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.57
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.56
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.56
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.56
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	99.56
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.55
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.55
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.55
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.55
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	99.54
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	99.54
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.54
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	99.54
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	99.53
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.52
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.52
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	99.5
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.5
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.5
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.5
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.49
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	99.49
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	99.48
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.48
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.48
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	99.48
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.47
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.47
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.47
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	99.47
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.47
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.47
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.47
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.46
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.46
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.46
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.46
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.46
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.46
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.46
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.46
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.45
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.45
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.45
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.45
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.45
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.45
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.45
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.44
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	99.44
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.44
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	99.43
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.43
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.43
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.43
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	99.42
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.41
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.41
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.41
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.41
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.39
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.39
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	99.39
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	99.39
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.38
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	99.38
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	99.37
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.36
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.35
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.35
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.31
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.31
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.3
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	99.28
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	99.26
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.26
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	99.25
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.21
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	99.19
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	99.13
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	99.06
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	99.01
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	98.97
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	98.89
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.76
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	98.68
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.63
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	96.17
d1ufwa_		95	Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]	95.79
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	95.08
d1whva_		100	Poly(A)-specific ribonuclease PARN {Mouse (Mus mus	94.77
d1ufwa_		95	Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]	91.71
d1whva_		100	Poly(A)-specific ribonuclease PARN {Mouse (Mus mus	88.98

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.8e-33  Score=238.60  Aligned_cols=172  Identities=16%  Similarity=0.184  Sum_probs=137.0

Q ss_pred             CcEEEcCCCCCCCHHHHHHHhccCCCeEEecccccCCCCCCCCcceEEEEeCCHHHHHHHHHhCccCCCceEEEecCCCc
Q psy11409         54 PPQFPLQGTPHYDHEEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDACIVDEDKCYLCVSSPTI  133 (320)
Q Consensus        54 ~kvFVGgLp~dvtEe~L~~~Fs~FG~V~v~~p~k~~~~~tg~skGygFV~F~~eesv~kaL~~~~~~~~~~~vkis~~~~  133 (320)
                      ++|||||||+++||++|+++|++||+|..+.+.++.  .+++++|||||.|.++++|++|+.......+...+.+.....
T Consensus         7 r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~--~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           7 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDP--NTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECT--TTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCC
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecc--cCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhhhh
Confidence            489999999999999999999999999977766654  478999999999999999999998876543332222211100


Q ss_pred             cCCCccccccccCCcccccCCCCCCCCCCeEEEcCCCccchHHHHHHHHhhhCCCeeEEEEecCCCCCCcceEEEEEecC
Q psy11409        134 KDKPVQIRPWKLTDADFVLDASMPLDPRKTVFVGGVPRPLKALELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFAS  213 (320)
Q Consensus       134 ~~K~vqvrPw~~~d~~y~~~~~~~~~~~~tVFVGnLp~~~TeedL~~~F~~~fG~V~~v~I~~D~~tg~pkGfgfVtF~~  213 (320)
                        +.     +.        .......+.++|||||||+.+|+++|+++|+. ||.|..+.|++|+.++.++|+|||+|.+
T Consensus        85 --~~-----~~--------~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~-~G~v~~~~i~~~~~~~~~~g~~fV~f~~  148 (183)
T d1u1qa_          85 --RE-----DS--------QRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQ-YGKIEVIEIMTDRGSGKKRGFAFVTFDD  148 (183)
T ss_dssp             --TT-----GG--------GSTTTTCCCSEEEEECCCTTCCHHHHHHHHGG-GSCEEEEEEEECTTTCCEEEEEEEEESC
T ss_pred             --cc-----cc--------cccccccccceeEEccCCCcCCHHHHhhhhcc-CCceeeeeeecccccCccceeEEEEECC
Confidence              00     00        01122345689999999999999999999999 9999999999999999999999999999


Q ss_pred             HHHHHHHHHhcccccccCccceEEEecccccccc
Q psy11409        214 QASYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ  247 (320)
Q Consensus       214 ~esa~kAi~~~~~~i~~~~~~k~v~ikpy~~~~~  247 (320)
                      +++|.+||+.....+.    .++|.|+++.++.+
T Consensus       149 ~e~A~~Al~~~~~~~~----G~~i~V~~A~~k~e  178 (183)
T d1u1qa_         149 HDSVDKIVIQKYHTVN----GHNCEVRKALSKQE  178 (183)
T ss_dssp             HHHHHHHHTSSCEEET----TEEEEEEECCCHHH
T ss_pred             HHHHHHHHHhCCCeEC----CEEEEEEecCCccc
Confidence            9999999986555554    36888988876544

PyMOL of d1u1qa_

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure