Psyllid ID: psy11412


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLV
cEEcccccEEEEEEEEEccccccccccccccccEEEEEEEEccccEEEEEEccccEEEEEEcccccccEEEEEEEEcEEEcccccEEEEccccccccccccEEccEEccccccEEEEcccccEEEEEEccccccccccccccccccHHcccccccEEEccccccccccccccccccccccccEEEEEEccccEEEEEEccccEEEEEEcccccccEEEEEEEEccEEcccccEEEEcccccccccccEEEccEEccccccEEEEcccccEEEEEcccccccccccccccc
ccccccccEEEEEEEEccccccccccccccccccEEEEEEEccccEEEEEccccccEEEEEccccccccEEEEEEEEEEEEccccEEEEcccccccccccccccccEccccccEEEEEccccEEEEEccccccHHHHHccccccccccEcHHEEEEccccccccccccHccccccccccccccEEEEEccccEEEEEccccccEEEEEccccccccEEEEEEEEEEEEccccEEEEcccccccccccccccccEccccccEEEEEccccEEEEEccccccHHHccccccc
fyrqsdgtykadkvidipakqvqgypggdkvpAMVTDILISLddrylytsnwmhgdirqydirdtahpvlVGQIflggkiqsdsgvtviddpeldkqpdpviikgrrftgssQMFQLSldgkriyvssslfspwdkeiypdlvktdaafgsdEIMEFIQRNemrsmplsslgswkyparsmVTDILISLddrylytsnwmhgdirqydirdtahpvlVGQIflggkiqsdsgvtviddpeldkqpdpviikgrrftgssQMFQLSldgkriyvssslfspwdkeiypdlv
fyrqsdgtykadkvidipakqvqgypggdkvPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLggkiqsdsgvtviddpeldkqpdpviikgrrftgssQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLggkiqsdsgvtviddpeldkqpdpviikgrrftgssQMFQLSLDGKRIyvssslfspwdkeiypdlv
FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLV
************KVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVID*********PVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNE****PLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVID**********VIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEI*****
FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSG**********KQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDS***************PVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLV
********YKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLV
FY**SDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query290 2.2.26 [Sep-21-2011]
Q52KZ7472 Selenium-binding protein N/A N/A 0.510 0.313 0.617 2e-48
Q569D5472 Selenium-binding protein yes N/A 0.493 0.302 0.590 5e-46
Q6DCH7472 Selenium-binding protein N/A N/A 0.510 0.313 0.577 3e-45
P17563472 Selenium-binding protein yes N/A 0.486 0.298 0.541 3e-43
Q2KJ32472 Selenium-binding protein yes N/A 0.486 0.298 0.547 8e-43
Q63836472 Selenium-binding protein yes N/A 0.486 0.298 0.541 1e-42
Q8VIF7472 Selenium-binding protein yes N/A 0.486 0.298 0.541 1e-42
Q13228472 Selenium-binding protein yes N/A 0.486 0.298 0.534 1e-42
Q5RF48472 Selenium-binding protein yes N/A 0.486 0.298 0.534 2e-42
Q6PHD9457 Selenium-binding protein yes N/A 0.437 0.277 0.513 9e-36
>sp|Q52KZ7|SBP1A_XENLA Selenium-binding protein 1-A OS=Xenopus laevis GN=selenbp1-a PE=2 SV=1 Back     alignment and function desciption
 Score =  193 bits (490), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 117/149 (78%), Gaps = 1/149 (0%)

Query: 1   FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQY 60
           FY++ DG + A+KVI +P+K+V+G+P   ++P ++TDILISLDDR+LY SNW+HGDIRQY
Sbjct: 277 FYKEKDGKWAAEKVIQVPSKKVEGWPM-PEMPGLITDILISLDDRFLYFSNWLHGDIRQY 335

Query: 61  DIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLD 120
           DI DT +P LVGQIFLGG IQ    VTV++D EL+ QPDPV +KG+   G  QM QLSLD
Sbjct: 336 DITDTRNPKLVGQIFLGGSIQRGGPVTVLEDKELECQPDPVTVKGKIIPGGPQMIQLSLD 395

Query: 121 GKRIYVSSSLFSPWDKEIYPDLVKTDAAF 149
           GKRIYV+SSL+S WDK+ YPDL+K  A  
Sbjct: 396 GKRIYVTSSLYSIWDKQFYPDLLKEGAVM 424




Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport.
Xenopus laevis (taxid: 8355)
>sp|Q569D5|SBP1_XENTR Selenium-binding protein 1 OS=Xenopus tropicalis GN=selenbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DCH7|SBP1B_XENLA Selenium-binding protein 1-B OS=Xenopus laevis GN=selenbp1-b PE=2 SV=1 Back     alignment and function description
>sp|P17563|SBP1_MOUSE Selenium-binding protein 1 OS=Mus musculus GN=Selenbp1 PE=1 SV=2 Back     alignment and function description
>sp|Q2KJ32|SBP1_BOVIN Selenium-binding protein 1 OS=Bos taurus GN=SELENBP1 PE=1 SV=1 Back     alignment and function description
>sp|Q63836|SBP2_MOUSE Selenium-binding protein 2 OS=Mus musculus GN=Selenbp2 PE=1 SV=2 Back     alignment and function description
>sp|Q8VIF7|SBP1_RAT Selenium-binding protein 1 OS=Rattus norvegicus GN=Selenbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q13228|SBP1_HUMAN Selenium-binding protein 1 OS=Homo sapiens GN=SELENBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RF48|SBP1_PONAB Selenium-binding protein 1 OS=Pongo abelii GN=SELENBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q6PHD9|SBP1_DANRE Selenium-binding protein 1 OS=Danio rerio GN=selenbp1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
91092064 476 PREDICTED: similar to selenium-binding p 0.506 0.308 0.635 1e-49
345485514 480 PREDICTED: selenium-binding protein 1-A- 0.493 0.297 0.625 7e-47
148224943 472 selenium-binding protein 1-A [Xenopus la 0.510 0.313 0.617 9e-47
242012213 479 Selenium-binding protein, putative [Pedi 0.5 0.302 0.618 2e-46
332372634 475 unknown [Dendroctonus ponderosae] 0.496 0.303 0.590 2e-46
291236087 486 PREDICTED: selenium-binding protein 1-li 0.486 0.290 0.609 4e-46
157125400 481 selenium-binding protein [Aedes aegypti] 0.496 0.299 0.623 1e-45
170056259 480 selenium-binding protein 2 [Culex quinqu 0.496 0.3 0.630 4e-45
387018518 466 Selenium binding protein 1 [Crotalus ada 0.493 0.306 0.618 4e-45
307194695 489 Selenium-binding protein 1 [Harpegnathos 0.486 0.288 0.595 4e-45
>gi|91092064|ref|XP_970689.1| PREDICTED: similar to selenium-binding protein [Tribolium castaneum] gi|270004695|gb|EFA01143.1| hypothetical protein TcasGA2_TC010368 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/148 (63%), Positives = 118/148 (79%), Gaps = 1/148 (0%)

Query: 1   FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQY 60
           FY++SDGT+  DKVIDIPAK+V G+  GD +  M+TDIL+SLDD+YLY +NW+HGD+RQY
Sbjct: 278 FYQKSDGTWAVDKVIDIPAKKVSGW-DGDYINGMITDILLSLDDKYLYLNNWLHGDVRQY 336

Query: 61  DIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLD 120
           DI D AHP L GQ+FLGGKI  DS + V++D EL +QPDPV IKGRR  G  QM QLSLD
Sbjct: 337 DISDPAHPKLTGQLFLGGKILKDSKIKVLEDKELKEQPDPVYIKGRRILGGPQMMQLSLD 396

Query: 121 GKRIYVSSSLFSPWDKEIYPDLVKTDAA 148
           GKR+Y+SSSLFSPWD++ YP+ ++  A 
Sbjct: 397 GKRLYISSSLFSPWDRQFYPETIEKGAT 424




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345485514|ref|XP_001606344.2| PREDICTED: selenium-binding protein 1-A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|148224943|ref|NP_001089396.1| selenium-binding protein 1-A [Xenopus laevis] gi|82177910|sp|Q52KZ7.1|SBP1A_XENLA RecName: Full=Selenium-binding protein 1-A gi|62740105|gb|AAH94129.1| MGC115145 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|242012213|ref|XP_002426828.1| Selenium-binding protein, putative [Pediculus humanus corporis] gi|212511041|gb|EEB14090.1| Selenium-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332372634|gb|AEE61459.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|291236087|ref|XP_002737973.1| PREDICTED: selenium-binding protein 1-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|157125400|ref|XP_001654322.1| selenium-binding protein [Aedes aegypti] gi|108882686|gb|EAT46911.1| AAEL001937-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170056259|ref|XP_001863949.1| selenium-binding protein 2 [Culex quinquefasciatus] gi|167876018|gb|EDS39401.1| selenium-binding protein 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|387018518|gb|AFJ51377.1| Selenium binding protein 1 [Crotalus adamanteus] Back     alignment and taxonomy information
>gi|307194695|gb|EFN76954.1| Selenium-binding protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
UNIPROTKB|H9KYX6472 LOC100857226 "Uncharacterized 0.493 0.302 0.611 7.1e-45
ZFIN|ZDB-GENE-040426-1436473 selenbp1 "selenium binding pro 0.493 0.302 0.583 3.1e-44
UNIPROTKB|F1ST01472 SELENBP1 "Uncharacterized prot 0.493 0.302 0.541 1.9e-42
UNIPROTKB|Q13228472 SELENBP1 "Selenium-binding pro 0.493 0.302 0.534 4e-42
MGI|MGI:96825472 Selenbp1 "selenium binding pro 0.493 0.302 0.541 4e-42
UNIPROTKB|Q2KJ32472 SELENBP1 "Selenium-binding pro 0.493 0.302 0.548 5.2e-42
MGI|MGI:104859472 Selenbp2 "selenium binding pro 0.493 0.302 0.541 5.2e-42
UNIPROTKB|F1PNH6502 SELENBP1 "Uncharacterized prot 0.493 0.284 0.534 6.6e-42
RGD|620571472 Selenbp1 "selenium binding pro 0.493 0.302 0.541 1.4e-41
UNIPROTKB|Q8VIF7472 Selenbp1 "Selenium-binding pro 0.493 0.302 0.541 1.4e-41
UNIPROTKB|H9KYX6 LOC100857226 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 472 (171.2 bits), Expect = 7.1e-45, P = 7.1e-45
 Identities = 88/144 (61%), Positives = 111/144 (77%)

Query:     1 FYRQSDGTYKADKVIDIPAKQVQGYPGGDKVPAMVTDILISLDDRYLYTSNWMHGDIRQY 60
             FY+   G + A+KVI++P K+VQG+   D +P ++TDILISLDDR+LY SNW+HGDIRQY
Sbjct:   277 FYKTEKGDWAAEKVIEVPRKKVQGWLLPD-MPGLITDILISLDDRFLYFSNWLHGDIRQY 335

Query:    61 DIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLD 120
             DI +T  P LVGQ+FLGG I     VTV++D EL  QP+P +IKG+R  G  QM QLSLD
Sbjct:   336 DISNTRQPKLVGQVFLGGSIVRGGPVTVVEDKELQCQPEPFVIKGKRVQGGPQMIQLSLD 395

Query:   121 GKRIYVSSSLFSPWDKEIYPDLVK 144
             GKR+YVS+SL+S WDK+ YPDLVK
Sbjct:   396 GKRLYVSTSLYSGWDKQFYPDLVK 419


GO:0008430 "selenium binding" evidence=IEA
ZFIN|ZDB-GENE-040426-1436 selenbp1 "selenium binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST01 SELENBP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q13228 SELENBP1 "Selenium-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96825 Selenbp1 "selenium binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ32 SELENBP1 "Selenium-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:104859 Selenbp2 "selenium binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNH6 SELENBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|620571 Selenbp1 "selenium binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8VIF7 Selenbp1 "Selenium-binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q13228SBP1_HUMANNo assigned EC number0.53420.48620.2987yesN/A
Q569D5SBP1_XENTRNo assigned EC number0.59020.49310.3029yesN/A
Q5RF48SBP1_PONABNo assigned EC number0.53420.48620.2987yesN/A
Q6PHD9SBP1_DANRENo assigned EC number0.51380.43790.2778yesN/A
P17563SBP1_MOUSENo assigned EC number0.54100.48620.2987yesN/A
Q63836SBP2_MOUSENo assigned EC number0.54100.48620.2987yesN/A
Q8VIF7SBP1_RATNo assigned EC number0.54100.48620.2987yesN/A
Q2KJ32SBP1_BOVINNo assigned EC number0.54790.48620.2987yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
pfam05694461 pfam05694, SBP56, 56kDa selenium binding protein ( 4e-58
pfam05694461 pfam05694, SBP56, 56kDa selenium binding protein ( 2e-45
>gnl|CDD|218697 pfam05694, SBP56, 56kDa selenium binding protein (SBP56) Back     alignment and domain information
 Score =  192 bits (490), Expect = 4e-58
 Identities = 73/153 (47%), Positives = 94/153 (61%), Gaps = 21/153 (13%)

Query: 1   FYRQSDGTYKADKVIDIPAKQVQGYP------GGDKVPAMVTDILISLDDRYLYTSNWMH 54
           +Y+  DG + A+KVI+IPA+ V+G+       G   VP +VTDIL+SLDDR+LY S W H
Sbjct: 274 WYKDDDGKWAAEKVIEIPAEPVEGWILPPMLKGFGAVPPLVTDILLSLDDRFLYVSCWGH 333

Query: 55  GDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQM 114
           GD+RQYDI D  +P L GQ+ LGG I+                     +KGRR  G  QM
Sbjct: 334 GDLRQYDISDPFNPKLTGQVRLGGIIRRA---------------PHPAVKGRRLNGGPQM 378

Query: 115 FQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDA 147
            QLSLDGKR+YV++SL+S WD + YPD VK   
Sbjct: 379 VQLSLDGKRLYVTNSLYSAWDDQFYPDGVKKGG 411


This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homologue of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport. Length = 461

>gnl|CDD|218697 pfam05694, SBP56, 56kDa selenium binding protein (SBP56) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.96
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.95
KOG0918|consensus476 99.9
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 99.9
PRK11028330 6-phosphogluconolactonase; Provisional 99.88
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.83
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 99.82
KOG0918|consensus476 99.8
PRK11028 330 6-phosphogluconolactonase; Provisional 99.79
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.7
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.67
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.64
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.61
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.53
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.53
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.49
PRK02888 635 nitrous-oxide reductase; Validated 99.48
PRK02888 635 nitrous-oxide reductase; Validated 99.42
COG3391381 Uncharacterized conserved protein [Function unknow 99.38
COG3391 381 Uncharacterized conserved protein [Function unknow 99.29
KOG0315|consensus311 99.21
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.16
KOG0315|consensus 311 99.03
KOG2096|consensus420 98.99
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.99
KOG0266|consensus456 98.93
KOG0639|consensus 705 98.9
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.88
PTZ00421 493 coronin; Provisional 98.85
KOG0291|consensus 893 98.82
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 98.79
KOG1446|consensus311 98.78
KOG0266|consensus 456 98.77
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.76
KOG1407|consensus313 98.76
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.72
KOG0318|consensus 603 98.71
PRK02889427 tolB translocation protein TolB; Provisional 98.69
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.69
PRK03629429 tolB translocation protein TolB; Provisional 98.68
KOG1539|consensus 910 98.66
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.66
PRK02889427 tolB translocation protein TolB; Provisional 98.66
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.65
PRK05137435 tolB translocation protein TolB; Provisional 98.65
PTZ00420 568 coronin; Provisional 98.65
PRK01742429 tolB translocation protein TolB; Provisional 98.65
PRK05137435 tolB translocation protein TolB; Provisional 98.61
KOG0272|consensus459 98.6
PRK04922433 tolB translocation protein TolB; Provisional 98.6
KOG2055|consensus514 98.59
PRK03629429 tolB translocation protein TolB; Provisional 98.59
PRK04792448 tolB translocation protein TolB; Provisional 98.58
KOG0263|consensus707 98.56
KOG0272|consensus459 98.56
KOG0291|consensus 893 98.56
KOG0282|consensus503 98.56
PRK00178430 tolB translocation protein TolB; Provisional 98.55
KOG0263|consensus707 98.54
PRK01742429 tolB translocation protein TolB; Provisional 98.54
KOG0318|consensus603 98.54
PRK04792448 tolB translocation protein TolB; Provisional 98.53
KOG0645|consensus312 98.51
KOG0279|consensus315 98.51
KOG1446|consensus311 98.5
KOG0639|consensus705 98.49
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.49
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.47
KOG1274|consensus 933 98.46
PRK04922433 tolB translocation protein TolB; Provisional 98.45
PRK01029428 tolB translocation protein TolB; Provisional 98.44
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.42
KOG0271|consensus 480 98.4
PTZ00420 568 coronin; Provisional 98.38
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 98.38
PRK00178430 tolB translocation protein TolB; Provisional 98.38
COG5276370 Uncharacterized conserved protein [Function unknow 98.36
KOG0310|consensus 487 98.34
PLN00181 793 protein SPA1-RELATED; Provisional 98.33
KOG0279|consensus315 98.32
PRK04043419 tolB translocation protein TolB; Provisional 98.31
KOG2055|consensus514 98.3
KOG2110|consensus391 98.29
KOG0283|consensus 712 98.29
KOG0771|consensus398 98.27
KOG0645|consensus312 98.26
KOG0772|consensus 641 98.26
PLN00181793 protein SPA1-RELATED; Provisional 98.25
PRK01029428 tolB translocation protein TolB; Provisional 98.25
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.23
KOG0973|consensus 942 98.23
KOG0293|consensus519 98.22
KOG0646|consensus 476 98.21
KOG2096|consensus420 98.21
KOG2919|consensus406 98.2
KOG0772|consensus 641 98.2
KOG0973|consensus 942 98.17
PTZ00421 493 coronin; Provisional 98.14
KOG0293|consensus 519 98.14
KOG0288|consensus459 98.12
KOG2139|consensus445 98.1
KOG0288|consensus459 98.1
KOG0285|consensus 460 98.1
KOG0289|consensus506 98.09
KOG0310|consensus 487 98.06
PRK04043419 tolB translocation protein TolB; Provisional 98.06
KOG0284|consensus 464 98.04
KOG0265|consensus338 98.0
KOG1274|consensus 933 98.0
COG5276370 Uncharacterized conserved protein [Function unknow 98.0
KOG2110|consensus 391 97.99
KOG1407|consensus313 97.98
KOG0271|consensus480 97.97
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 97.97
KOG0286|consensus343 97.97
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.96
KOG0643|consensus 327 97.94
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 97.91
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.89
KOG0282|consensus503 97.88
KOG0286|consensus343 97.86
KOG0319|consensus 775 97.85
KOG0306|consensus 888 97.83
KOG0640|consensus430 97.83
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.81
KOG0278|consensus334 97.8
KOG2394|consensus 636 97.77
KOG0275|consensus508 97.76
KOG0273|consensus524 97.74
KOG0267|consensus 825 97.74
KOG0302|consensus440 97.66
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.63
KOG0275|consensus508 97.61
KOG4378|consensus 673 97.6
KOG1539|consensus 910 97.59
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.54
KOG2106|consensus626 97.52
KOG0316|consensus307 97.52
KOG0273|consensus524 97.52
KOG0319|consensus 775 97.51
KOG0296|consensus 399 97.5
KOG1273|consensus 405 97.48
KOG0306|consensus 888 97.45
KOG0289|consensus506 97.45
KOG0285|consensus460 97.45
KOG0265|consensus338 97.44
KOG0296|consensus399 97.44
KOG0299|consensus479 97.43
KOG2048|consensus 691 97.42
KOG0278|consensus334 97.41
KOG0305|consensus484 97.4
KOG0294|consensus362 97.37
KOG1273|consensus 405 97.37
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.34
KOG2394|consensus 636 97.33
KOG0640|consensus430 97.32
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 97.29
KOG0643|consensus327 97.28
KOG0284|consensus464 97.27
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.26
KOG0771|consensus398 97.25
COG4946668 Uncharacterized protein related to the periplasmic 97.2
KOG2048|consensus 691 97.12
KOG0294|consensus 362 97.11
KOG2111|consensus346 97.09
KOG4497|consensus 447 97.06
KOG1445|consensus 1012 97.05
KOG0321|consensus 720 97.01
KOG0650|consensus 733 96.99
KOG0646|consensus476 96.97
COG4946 668 Uncharacterized protein related to the periplasmic 96.97
KOG3881|consensus412 96.95
KOG1063|consensus764 96.93
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.93
KOG0295|consensus406 96.91
KOG2315|consensus 566 96.9
KOG2111|consensus346 96.88
KOG4378|consensus 673 96.86
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.83
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.76
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.7
KOG1963|consensus 792 96.69
KOG0283|consensus712 96.66
KOG2919|consensus406 96.62
KOG0647|consensus347 96.59
KOG4497|consensus 447 96.58
KOG0264|consensus422 96.57
KOG0305|consensus484 96.55
KOG1445|consensus 1012 96.54
KOG0308|consensus 735 96.52
PF0830942 LVIVD: LVIVD repeat; InterPro: IPR013211 This repe 96.51
KOG0268|consensus433 96.48
KOG1408|consensus 1080 96.46
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.43
KOG0303|consensus 472 96.42
KOG0299|consensus 479 96.31
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.29
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 96.23
KOG1009|consensus 434 96.22
KOG0295|consensus406 96.19
KOG1036|consensus323 96.17
KOG0321|consensus 720 96.16
KOG2315|consensus566 96.13
KOG2321|consensus 703 96.09
KOG1034|consensus385 96.07
PF0830942 LVIVD: LVIVD repeat; InterPro: IPR013211 This repe 95.98
PRK13616591 lipoprotein LpqB; Provisional 95.93
KOG4328|consensus498 95.9
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.87
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.83
KOG0264|consensus422 95.82
KOG0277|consensus311 95.79
KOG0316|consensus307 95.78
KOG2139|consensus 445 95.77
KOG0269|consensus 839 95.76
KOG0322|consensus323 95.68
KOG0290|consensus364 95.65
KOG4227|consensus 609 95.61
KOG0307|consensus 1049 95.6
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 95.57
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.46
KOG0292|consensus 1202 95.4
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 95.32
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.25
KOG1963|consensus 792 95.22
KOG0649|consensus325 95.22
KOG1036|consensus323 95.15
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.14
KOG4328|consensus498 95.12
KOG3914|consensus 390 95.1
KOG0313|consensus423 95.06
KOG0641|consensus350 95.03
KOG0313|consensus423 94.99
KOG0268|consensus 433 94.87
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 94.78
KOG1063|consensus 764 94.68
KOG3881|consensus412 94.66
KOG0650|consensus733 94.65
KOG0269|consensus 839 94.65
KOG0322|consensus323 94.58
KOG0303|consensus472 94.55
KOG0292|consensus 1202 94.43
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.4
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 94.38
KOG1188|consensus376 94.31
COG2319 466 FOG: WD40 repeat [General function prediction only 94.27
PF13449 326 Phytase-like: Esterase-like activity of phytase 94.21
KOG1272|consensus 545 94.13
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 94.03
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 93.92
KOG1538|consensus 1081 93.87
KOG1523|consensus 361 93.82
COG2319466 FOG: WD40 repeat [General function prediction only 93.72
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 93.68
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 93.63
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 93.59
PRK13616 591 lipoprotein LpqB; Provisional 93.57
KOG0647|consensus 347 93.41
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 93.33
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.3
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.2
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 93.19
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 93.08
KOG0308|consensus 735 93.06
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 93.05
PF09826 521 Beta_propel: Beta propeller domain; InterPro: IPR0 92.97
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 92.92
PF05787524 DUF839: Bacterial protein of unknown function (DUF 92.74
KOG1408|consensus 1080 92.71
KOG2106|consensus626 92.4
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.4
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 92.4
KOG1332|consensus299 92.36
KOG2445|consensus361 92.25
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 92.08
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 91.66
KOG0267|consensus 825 91.41
KOG2314|consensus 698 91.39
KOG4283|consensus 397 91.35
KOG1034|consensus385 91.3
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 91.29
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 90.91
KOG1520|consensus376 90.47
KOG1272|consensus 545 90.28
COG3823262 Glutamine cyclotransferase [Posttranslational modi 90.11
KOG1007|consensus370 89.84
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 89.63
KOG4283|consensus397 89.62
KOG0301|consensus 745 89.36
KOG0276|consensus 794 89.3
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 89.22
KOG0300|consensus481 88.86
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 88.72
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 88.64
KOG4227|consensus 609 88.56
KOG0300|consensus481 88.47
KOG0281|consensus499 88.46
KOG4547|consensus 541 88.43
COG4590 733 ABC-type uncharacterized transport system, permeas 88.31
KOG0307|consensus 1049 88.12
KOG0301|consensus 745 87.54
KOG1214|consensus1289 87.44
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.36
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 87.33
KOG0276|consensus 794 86.57
KOG3914|consensus390 86.45
KOG0974|consensus 967 86.31
PF13449326 Phytase-like: Esterase-like activity of phytase 85.91
KOG1587|consensus555 85.24
KOG0274|consensus537 85.06
KOG4659|consensus 1899 84.75
KOG0642|consensus 577 84.53
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 84.07
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 83.82
COG3204316 Uncharacterized protein conserved in bacteria [Fun 83.34
KOG0277|consensus311 83.13
smart0032040 WD40 WD40 repeats. Note that these repeats are per 83.03
KOG1538|consensus 1081 82.56
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 82.55
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 82.22
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 81.66
KOG2314|consensus698 81.38
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 81.23
KOG4499|consensus310 80.97
KOG0290|consensus364 80.96
KOG4659|consensus 1899 80.92
PRK10115 686 protease 2; Provisional 80.8
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=99.96  E-value=3.3e-27  Score=215.55  Aligned_cols=200  Identities=20%  Similarity=0.303  Sum_probs=140.0

Q ss_pred             CCCC-ceEEEEEcCCCCEEEEEeCCCCeEEEEEcCCCCCcee-eeEEeeccc---------------ccCCCceEEe-cC
Q psy11412         30 KVPA-MVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVL-VGQIFLGGK---------------IQSDSGVTVI-DD   91 (290)
Q Consensus        30 ~v~~-~p~~va~SpDGr~Lyva~~~~g~V~v~dv~d~~~~~~-~~~i~~g~~---------------~~~~~~~~v~-~~   91 (290)
                      .+++ .||++++++||++|+++||..|.|+++.+.+.+.+.. ++.+...+.               .++.++..+. +.
T Consensus        85 ~~~g~~p~yvsvd~~g~~vf~AnY~~g~v~v~p~~~dG~l~~~v~~~~h~g~~p~~rQ~~~h~H~a~~tP~~~~l~v~DL  164 (346)
T COG2706          85 TLPGSPPCYVSVDEDGRFVFVANYHSGSVSVYPLQADGSLQPVVQVVKHTGSGPHERQESPHVHSANFTPDGRYLVVPDL  164 (346)
T ss_pred             ccCCCCCeEEEECCCCCEEEEEEccCceEEEEEcccCCccccceeeeecCCCCCCccccCCccceeeeCCCCCEEEEeec
Confidence            3444 4599999999999999999999999999976555543 333322221               1122322222 21


Q ss_pred             CC-------C-cCCCCcceeeccccCCCceEEEEccCCCEEEEEcCCCCCcceeecccccCCCceeecceeeeeeecccc
Q psy11412         92 PE-------L-DKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEM  163 (290)
Q Consensus        92 ~~-------~-~~~~~~~~~~~~~~g~gPr~vafsPdG~~lYv~nel~~~~d~~~~~~~~~~g~~~~~~~~~~~~~~~~i  163 (290)
                      ..       + +....+.......+|+|||||+|||+||.+|+++||.+++++..|..   ..+.+..++        .+
T Consensus       165 G~Dri~~y~~~dg~L~~~~~~~v~~G~GPRHi~FHpn~k~aY~v~EL~stV~v~~y~~---~~g~~~~lQ--------~i  233 (346)
T COG2706         165 GTDRIFLYDLDDGKLTPADPAEVKPGAGPRHIVFHPNGKYAYLVNELNSTVDVLEYNP---AVGKFEELQ--------TI  233 (346)
T ss_pred             CCceEEEEEcccCccccccccccCCCCCcceEEEcCCCcEEEEEeccCCEEEEEEEcC---CCceEEEee--------ee
Confidence            10       0 11111111122356899999999999999999999999999887753   123343333        33


Q ss_pred             cccCccccCccccCCCCceeEEEEccCCCEEEEEeCCCCcEEEEEecCC-CCceEeeEEeeCceecCCCceEEecCCCCC
Q psy11412        164 RSMPLSSLGSWKYPARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDT-AHPVLVGQIFLGGKIQSDSGVTVIDDPELD  242 (290)
Q Consensus       164 ~~~p~~~~~~~~~~~~~~~~~i~~SpDGr~Lyvs~r~~~~V~v~Dv~d~-~~~~~v~~i~~Gg~~~~~~~v~~~~~~~~~  242 (290)
                      .++|..      ..+..+.++|++||||||||+|||++++|++|.|+.- +.+..++.++++|+                
T Consensus       234 ~tlP~d------F~g~~~~aaIhis~dGrFLYasNRg~dsI~~f~V~~~~g~L~~~~~~~teg~----------------  291 (346)
T COG2706         234 DTLPED------FTGTNWAAAIHISPDGRFLYASNRGHDSIAVFSVDPDGGKLELVGITPTEGQ----------------  291 (346)
T ss_pred             ccCccc------cCCCCceeEEEECCCCCEEEEecCCCCeEEEEEEcCCCCEEEEEEEeccCCc----------------
Confidence            444432      2334688999999999999999999999999999643 34667888888883                


Q ss_pred             CCCCcceeecccccCCcceEEEccCCCEEEEEcCC
Q psy11412        243 KQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSL  277 (290)
Q Consensus       243 ~~~~~~~~~~~~~~~~P~~~a~sPDG~~L~Van~~  277 (290)
                                     .||+|.|+|+|++|+|||+-
T Consensus       292 ---------------~PR~F~i~~~g~~Liaa~q~  311 (346)
T COG2706         292 ---------------FPRDFNINPSGRFLIAANQK  311 (346)
T ss_pred             ---------------CCccceeCCCCCEEEEEccC
Confidence                           69999999999999999983



>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0918|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0918|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PF08309 LVIVD: LVIVD repeat; InterPro: IPR013211 This repeat is found in bacterial and archaeal cell surface proteins, many of which are hypothetical Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>PF08309 LVIVD: LVIVD repeat; InterPro: IPR013211 This repeat is found in bacterial and archaeal cell surface proteins, many of which are hypothetical Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
2ece_A462 X-Ray Structure Of Hypothetical Selenium-Binding Pr 9e-24
2ece_A462 X-Ray Structure Of Hypothetical Selenium-Binding Pr 2e-18
>pdb|2ECE|A Chain A, X-Ray Structure Of Hypothetical Selenium-Binding Protein From Sulfolobus Tokodaii, St0059 Length = 462 Back     alignment and structure

Iteration: 1

Score = 107 bits (267), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 61/149 (40%), Positives = 87/149 (58%), Gaps = 24/149 (16%) Query: 1 FYRQSDGTYKADKVIDIPAKQVQG-----YPGGDKVPAMVTDILISLDDRYLYTSNWMHG 55 FY DG + A+KVI+IPA+ ++G VP +VTDI ISLDD++LY S W G Sbjct: 286 FYE--DGKWNAEKVIEIPAEPLEGNLPEILKPFKAVPPLVTDIDISLDDKFLYLSLWGIG 343 Query: 56 DIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMF 115 ++RQYDI + PVL G++ LGG D P G + TG+ QM Sbjct: 344 EVRQYDISNPFKPVLTGKVKLGGIFHR------ADHP-----------AGHKLTGAPQML 386 Query: 116 QLSLDGKRIYVSSSLFSPWDKEIYPDLVK 144 ++S DG+R+YV++SL+S WD + YP+ +K Sbjct: 387 EISRDGRRVYVTNSLYSTWDNQFYPEGLK 415
>pdb|2ECE|A Chain A, X-Ray Structure Of Hypothetical Selenium-Binding Protein From Sulfolobus Tokodaii, St0059 Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
2ece_A462 462AA long hypothetical selenium-binding protein; 4e-36
2ece_A462 462AA long hypothetical selenium-binding protein; 2e-28
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 9e-05
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 1e-04
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Length = 462 Back     alignment and structure
 Score =  133 bits (336), Expect = 4e-36
 Identities = 58/149 (38%), Positives = 86/149 (57%), Gaps = 22/149 (14%)

Query: 1   FYRQSDGTYKADKVIDIPAKQVQG-----YPGGDKVPAMVTDILISLDDRYLYTSNWMHG 55
            +   DG + A+KVI+IPA+ ++G           VP +VTDI ISLDD++LY S W  G
Sbjct: 284 LWFYEDGKWNAEKVIEIPAEPLEGNLPEILKPFKAVPPLVTDIDISLDDKFLYLSLWGIG 343

Query: 56  DIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMF 115
           ++RQYDI +   PVL G++ LGG                 +   P    G + TG+ QM 
Sbjct: 344 EVRQYDISNPFKPVLTGKVKLGGIFH--------------RADHP---AGHKLTGAPQML 386

Query: 116 QLSLDGKRIYVSSSLFSPWDKEIYPDLVK 144
           ++S DG+R+YV++SL+S WD + YP+ +K
Sbjct: 387 EISRDGRRVYVTNSLYSTWDNQFYPEGLK 415


>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Length = 462 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
2ece_A462 462AA long hypothetical selenium-binding protein; 99.97
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.81
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.78
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.76
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.75
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.74
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.74
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.74
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.73
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.72
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.72
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.72
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.71
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.71
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.7
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.7
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.69
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.68
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.67
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.65
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.65
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 99.64
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.64
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.63
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 99.63
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.63
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 99.62
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.62
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.62
2ece_A462 462AA long hypothetical selenium-binding protein; 99.61
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.6
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 99.59
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.57
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.55
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.55
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.54
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.51
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.5
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.44
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.41
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.4
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.39
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.39
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.39
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.37
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.36
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.36
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.35
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.34
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.32
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.32
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.31
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.31
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.3
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.29
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.28
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.28
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.28
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.26
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.26
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.26
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.25
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.24
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.24
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.24
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.23
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.22
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.22
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.22
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.22
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.22
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.22
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.22
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.2
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.2
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.2
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.19
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.19
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.19
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 99.19
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.18
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.18
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.18
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.18
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.18
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.18
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.17
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.17
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.17
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.16
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.16
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.16
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.16
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.15
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.15
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.15
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.15
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.14
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.14
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.14
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.13
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.12
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.12
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.12
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.11
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.11
2qe8_A343 Uncharacterized protein; structural genomics, join 99.11
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.1
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.1
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.09
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.09
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.09
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.09
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.08
2pm7_B297 Protein transport protein SEC13, protein transport 99.08
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.08
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.08
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.08
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.08
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.08
3v65_B 386 Low-density lipoprotein receptor-related protein; 99.07
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.07
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.07
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.06
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.06
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.05
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.05
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.05
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.05
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 99.05
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.04
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.04
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.04
2pm7_B297 Protein transport protein SEC13, protein transport 99.03
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.03
3jrp_A379 Fusion protein of protein transport protein SEC13 99.03
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.03
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.02
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.02
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.02
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.01
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.0
3kya_A 496 Putative phosphatase; structural genomics, joint c 99.0
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.0
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 98.99
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.99
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 98.98
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.98
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.98
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.97
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.96
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.96
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.96
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 98.96
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 98.96
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.96
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.95
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.93
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.93
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.93
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.93
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.93
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.93
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.92
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 98.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.91
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.91
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.9
3jro_A 753 Fusion protein of protein transport protein SEC13 98.89
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.89
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 98.89
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 98.89
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.88
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.88
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.87
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 98.87
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.86
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 98.86
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.86
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 98.85
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.84
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.84
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.82
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.82
3v65_B386 Low-density lipoprotein receptor-related protein; 98.82
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.81
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.81
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 98.8
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.8
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.8
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.8
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.8
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.79
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 98.78
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.78
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.76
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 98.76
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.76
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.75
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.74
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.74
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.74
3jro_A 753 Fusion protein of protein transport protein SEC13 98.74
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.74
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.73
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.73
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.73
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.72
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.71
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.71
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.71
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.71
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.7
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.69
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.67
3kya_A496 Putative phosphatase; structural genomics, joint c 98.66
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.65
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.65
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.63
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.63
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.63
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.62
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.61
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.59
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.58
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.58
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.57
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.57
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.56
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 98.56
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.56
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.54
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.53
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.53
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.52
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.52
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.51
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.51
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.48
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.48
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.47
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.45
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.43
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 98.41
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.4
3sre_A 355 PON1, serum paraoxonase; directed evolution, 6-bla 98.38
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.37
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 98.34
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 98.33
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 98.31
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.29
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.22
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.22
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.18
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 98.11
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.0
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.0
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.93
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.84
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.83
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.8
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.8
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 97.78
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.78
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.75
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.71
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.64
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.6
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 97.55
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.51
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.49
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.43
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.39
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.28
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 96.97
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.92
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 96.88
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 96.79
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.64
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.5
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.4
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.65
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.61
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.17
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.17
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 94.52
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 93.65
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.5
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.08
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 90.2
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 89.73
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 89.57
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 88.8
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 86.71
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 86.08
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 86.06
3q6k_A 381 43.2 kDa salivary protein; beta propeller, binding 85.76
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 84.98
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 82.77
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 82.45
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 81.95
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
Probab=99.97  E-value=4e-31  Score=253.53  Aligned_cols=217  Identities=29%  Similarity=0.496  Sum_probs=159.1

Q ss_pred             EEEEecCCCccCCCCCCCCCC----CceEEEEEcCCCCEEEEEeCC------------------CCeEEEEEcCCCCCce
Q psy11412         12 DKVIDIPAKQVQGYPGGDKVP----AMVTDILISLDDRYLYTSNWM------------------HGDIRQYDIRDTAHPV   69 (290)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~v~----~~p~~va~SpDGr~Lyva~~~------------------~g~V~v~dv~d~~~~~   69 (290)
                      --++|..+.+++...   +++    ..++.+-++||++++|+++++                  +++|.+||+..   .+
T Consensus       166 v~vlD~~T~~v~~~~---~~~~~~~~~~Yd~~~~p~~~~mvsS~wg~p~~~~~g~~~~~~~~~~~d~V~v~D~~~---~k  239 (462)
T 2ece_A          166 ILMLDHYSFEPLGKW---EIDRGDQYLAYDFWWNLPNEVLVSSEWAVPNTIEDGLKLEHLKDRYGNRIHFWDLRK---RK  239 (462)
T ss_dssp             EEEECTTTCCEEEEC---CSBCTTCCCCCCEEEETTTTEEEECBCCCHHHHTTCCCTTTHHHHSCCEEEEEETTT---TE
T ss_pred             EEEEECCCCeEEEEE---ccCCCCccccceEEECCCCCEEEEccCcCccccccccchhhhhhccCCEEEEEECCC---Cc
Confidence            456777777888776   443    245568889999999999864                  79999999965   36


Q ss_pred             eeeEEeecccccCCCceEEecCCCCcCCCCcceeeccccCCCceEEEE--ccCCCEEEEEcC-----CCCCcceeecccc
Q psy11412         70 LVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQL--SLDGKRIYVSSS-----LFSPWDKEIYPDL  142 (290)
Q Consensus        70 ~~~~i~~g~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~g~gPr~vaf--sPdG~~lYv~ne-----l~~~~d~~~~~~~  142 (290)
                      +++++.+|.                             .|.+|+||.|  ||+|+++||++|     +.+++.++.+.  
T Consensus       240 ~~~tI~vg~-----------------------------~g~~P~~i~f~~~Pdg~~aYV~~e~~~~~Lss~V~v~~~d--  288 (462)
T 2ece_A          240 RIHSLTLGE-----------------------------ENRMALELRPLHDPTKLMGFINMVVSLKDLSSSIWLWFYE--  288 (462)
T ss_dssp             EEEEEESCT-----------------------------TEEEEEEEEECSSTTCCEEEEEEEEETTTCCEEEEEEEEE--
T ss_pred             EeeEEecCC-----------------------------CCCccceeEeeECCCCCEEEEEEeeeccCCCceEEEEEec--
Confidence            666666641                             1368999988  999999999999     98888776663  


Q ss_pred             cCCCceeecceeeeeeecccccccCccccCccccC-CCCceeEEEEccCCCEEEEEeCCCCcEEEEEecCCCCceEeeEE
Q psy11412        143 VKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYP-ARSMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQI  221 (290)
Q Consensus       143 ~~~g~~~~~~~~~~~~~~~~i~~~p~~~~~~~~~~-~~~~~~~i~~SpDGr~Lyvs~r~~~~V~v~Dv~d~~~~~~v~~i  221 (290)
                        ++ .+...+++++........+|.... +  .. .++.+++|++|||||+||+|||++|+|++|||++++++++++++
T Consensus       289 --~g-~~~~~~vIdi~~~~v~~~lp~~~~-~--f~~~~~~pa~I~lS~DGrfLYVSnrg~d~VavfdV~d~~~~~lv~~I  362 (462)
T 2ece_A          289 --DG-KWNAEKVIEIPAEPLEGNLPEILK-P--FKAVPPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKV  362 (462)
T ss_dssp             --TT-EEEEEEEEEECCEECCSSCCGGGG-G--GTEECCCCCCEEECTTSCEEEEEETTTTEEEEEECSSTTSCEEEEEE
T ss_pred             --CC-ceeEEEEEeCCCcccccccccccc-c--cccCCCceeEEEECCCCCEEEEEeCCCCEEEEEEecCCCCcEEEEEE
Confidence              22 344444444322221111111000 0  00 02467899999999999999999999999999888889999999


Q ss_pred             eeCceecCCCceEEecCCCCCCCCCcceeecccccCCcceEEEccCCCEEEEEcCCCCCCCcccCCC
Q psy11412        222 FLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQLSLDGKRIYVSSSLFSPWDKEIYPD  288 (290)
Q Consensus       222 ~~Gg~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~P~~~a~sPDG~~L~Van~~~~~~~~~~~~~  288 (290)
                      ++||.+.+              .+++   +|.++.++|++|+|||||++|||||++|++||+||||+
T Consensus       363 ~tGG~~~~--------------~~~~---~G~~~~ggPr~~~lSpDGk~LyVaNsl~~~wd~Qfyp~  412 (462)
T 2ece_A          363 KLGGIFHR--------------ADHP---AGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPE  412 (462)
T ss_dssp             ECBTTTTC--------------BCCT---TSCCCCSCCCCEEECTTSSEEEEECCCCHHHHHHHSTT
T ss_pred             EeCCeecc--------------cccc---ccccCCCCCCEEEEcCCCCEEEEEcCCcccccccccCC
Confidence            99984310              1111   44555568999999999999999999999999999997



>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.78
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.78
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.67
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.67
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.63
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.63
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.62
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.55
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.54
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.52
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.51
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.5
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.49
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.39
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.36
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.35
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.34
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.31
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.29
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.29
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.28
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.28
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.26
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.25
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.23
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.21
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.19
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.18
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 99.17
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 99.15
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.13
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.11
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.1
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.09
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.07
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.06
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.0
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 98.96
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.92
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.88
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.86
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.85
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.85
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.8
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.69
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.67
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.67
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.66
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.62
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.62
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.61
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.54
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.5
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.49
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.45
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.42
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.41
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.41
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.38
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.37
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.35
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.34
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.26
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.17
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.14
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.94
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.83
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.81
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.77
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.71
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.68
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.65
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 97.4
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.09
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.92
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 96.86
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.62
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.46
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.2
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.58
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 85.53
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 84.86
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: 3-carboxy-cis,cis-mucoante lactonizing enzyme
family: 3-carboxy-cis,cis-mucoante lactonizing enzyme
domain: 3-carboxy-cis,cis-mucoante lactonizing enzyme
species: Neurospora crassa [TaxId: 5141]
Probab=99.89  E-value=3.3e-22  Score=184.70  Aligned_cols=177  Identities=10%  Similarity=0.125  Sum_probs=116.1

Q ss_pred             CCceEEEEEcCCCCEEEEEeCCCCeEEEEEcCCCCCceeeeEEeecccccCCCceEEecCCCCcCCCCcceeeccccCCC
Q psy11412         32 PAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGS  111 (290)
Q Consensus        32 ~~~p~~va~SpDGr~Lyva~~~~g~V~v~dv~d~~~~~~~~~i~~g~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~g~g  111 (290)
                      ..+||+++|+|||++||+++.+.++|.+|++...+.......+..                             ...|.+
T Consensus       144 ~~h~h~v~~sPdG~~l~v~d~g~d~v~~~~~~~~g~~~~~~~~~~-----------------------------~~~g~g  194 (365)
T d1jofa_         144 NTGIHGMVFDPTETYLYSADLTANKLWTHRKLASGEVELVGSVDA-----------------------------PDPGDH  194 (365)
T ss_dssp             TCCEEEEEECTTSSEEEEEETTTTEEEEEEECTTSCEEEEEEEEC-----------------------------SSTTCC
T ss_pred             CCcceEEEECCCCCEEEEeeCCCCEEEEEEccCCCceeeccceee-----------------------------cCCCCc
Confidence            348999999999999999999999999999865444433332211                             113589


Q ss_pred             ceEEEEccCCCEEEEEcCCCCCcceeecccccCCCceeecceeeeeeecccccccCccccCccccCCCCceeEEEEccCC
Q psy11412        112 SQMFQLSLDGKRIYVSSSLFSPWDKEIYPDLVKTDAAFGSDEIMEFIQRNEMRSMPLSSLGSWKYPARSMVTDILISLDD  191 (290)
Q Consensus       112 Pr~vafsPdG~~lYv~nel~~~~d~~~~~~~~~~g~~~~~~~~~~~~~~~~i~~~p~~~~~~~~~~~~~~~~~i~~SpDG  191 (290)
                      |||++|||||+++|+++|+.+++.++.+..  .....+......+.....    .+......  ......+++|+|||||
T Consensus       195 Pr~i~f~pdg~~~yv~~e~~~~V~v~~~~~--~~~~~~~~~~~~~~~~~~----~~~~~~~~--~~~~~~~~~i~~spdG  266 (365)
T d1jofa_         195 PRWVAMHPTGNYLYALMEAGNRICEYVIDP--ATHMPVYTHHSFPLIPPG----IPDRDPET--GKGLYRADVCALTFSG  266 (365)
T ss_dssp             EEEEEECTTSSEEEEEETTTTEEEEEEECT--TTCCEEEEEEEEESSCTT----CCCBCTTT--SSBSEEEEEEEECTTS
T ss_pred             eEEEEECCCCceEEEeccCCCEEEEEEecC--CCceEEEEeeeecccccc----cccccccc--ccccCCccceEECCCC
Confidence            999999999999999999988877765432  011111111111100000    00000000  1112368899999999


Q ss_pred             CEEEEEeCCCCc-----EEEEEecCCCCceE---eeEEeeCceecCCCceEEecCCCCCCCCCcceeecccccCCcceEE
Q psy11412        192 RYLYTSNWMHGD-----IRQYDIRDTAHPVL---VGQIFLGGKIQSDSGVTVIDDPELDKQPDPVIIKGRRFTGSSQMFQ  263 (290)
Q Consensus       192 r~Lyvs~r~~~~-----V~v~Dv~d~~~~~~---v~~i~~Gg~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~P~~~a  263 (290)
                      |+||++||+++.     |..|++.+.+....   +...++.                               |++|++|+
T Consensus       267 ~~lyvsnr~~~~~~~~~i~~~~~~~~g~~~~~~~~~~~~~~-------------------------------G~~p~~i~  315 (365)
T d1jofa_         267 KYMFASSRANKFELQGYIAGFKLRDCGSIEKQLFLSPTPTS-------------------------------GGHSNAVS  315 (365)
T ss_dssp             SEEEEEEEESSTTSCCEEEEEEECTTSCEEEEEEEEECSSC-------------------------------CTTCCCEE
T ss_pred             CEEEEEcccCCCccceEEEEEEecCCCceeeEeEeeEEEcC-------------------------------CCCccEEE
Confidence            999999998876     88898865433221   1111111                               24899999


Q ss_pred             Ecc-CCCEEEEEcC
Q psy11412        264 LSL-DGKRIYVSSS  276 (290)
Q Consensus       264 ~sP-DG~~L~Van~  276 (290)
                      |+| ||++|||||+
T Consensus       316 ~~p~~G~~l~va~~  329 (365)
T d1jofa_         316 PCPWSDEWMAITDD  329 (365)
T ss_dssp             ECTTCTTEEEEECS
T ss_pred             ecCCCCCEEEEEeC
Confidence            999 8999999997



>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure